Sample records for total active mass

  1. Relative Importance of Lean and Fat Mass on Bone Mineral Density in Iranian Children and Adolescents.

    PubMed

    Jeddi, Marjan; Dabbaghmanesh, Mohammad Hossein; Ranjbar Omrani, Gholamhossein; Ayatollahi, Sayed Mohammad Taghi; Bagheri, Zahra; Bakhshayeshkaram, Marzieh

    2015-07-01

    Body weight is made up of lean and fat mass and both are involved in growth and development. Impression of these two components in bone density accrual has been controversial. The aim of this study was to evaluate the relationship between fat and lean mass and bone density in Iranian children and adolescents. A cross-sectional study was performed on 472 subjects (235 girls, 237 boys) aged 9-18 years old in Fars Province. The participants' weight, height, waist circumference, stage of puberty, and level of physical activity were recorded. Bone Mineral Content (BMC), Bone Mineral Density (BMD), total body fat and lean mass were measured using dual-energy X-ray absorptiometry. Results showed that 12.2% of boys and 12.3% of girls were overweight and 5.5% of boys and 4.7% of girls were obese. Obese individuals had greater total body BMD (0.96 ± 0.11) than normal-weight ones (0.86 ± 0.11) (P < 0.001). We found the greatest correlation between total body BMD and total body lean mass (R = 0.78. P < 0.001) and the least correlation with total body fat percentage (R = 0.03, P = 0.44). Total lean mass in more active boys was 38.1 ± 10.9 and in less active boys was 32.3 ± 11.0 (P < 0.001). The results of multiple regression analysis showed that age and total body lean mass were independent factors of BMD in growing children and adolescents. These findings suggest that lean mass was the most important predictor of BMD in both genders. Physical activity appears to positively impact on lean mass and needs to be considered in physical education and health-enhancing programs in Iranian school children.

  2. Influence of extracurricular sport activities on body composition and physical fitness in boys: a 3-year longitudinal study.

    PubMed

    Ara, I; Vicente-Rodriguez, G; Perez-Gomez, J; Jimenez-Ramirez, J; Serrano-Sanchez, J A; Dorado, C; Calbet, J A L

    2006-07-01

    To analyse the effect of extracurricular physical activities on fat mass accumulation and physical fitness during growth in early pubertal males. Longitudinal study. A total of 42 male children (9.4+/-1.4 years, Tanner I-II and 12.7+/-1.5 years, Tanner III-IV, before and after the 3.3 years follow-up, respectively), randomly sampled from the population of Gran Canaria (Spain), 26 of them physically active (PA, at least 3 h per week during 3 years) and 16 non-physically active (non-PA). Body composition (dual-energy X-ray absorptiometry), anthropometrics (body circumferences and skinfolds) and physical fitness variables (dynamic and isometric force, anaerobic capacity and maximal aerobic power) were determined in all subjects. Both groups had comparable body sizes at the start and the end of the study. Body mass index increased with growth more in the PA than in the non-PA group (P<0.05). However, fat mass accumulation with growth was lower in the PA than in the non-PA (P<0.05). There was a positive relationship between the increment of total and trunkal fat mass, especially in non-active children (r2=0.93). In contrast, there was an inverse relationship between the total lean mass growth and the accumulation of total and regional fat mass (r=-0.37 to -0.41, all P<0.05). Physical fitness was maintained in the PA, while it worsened in the non-PA children. Without any dietary intervention, children who regularly participate in at least 3 h per week of sports activities are more protected against total and regional fat mass accumulation. They also increase their total lean and bone mass to a greater extent than children who do not participate in extracurricular sport activities. In addition, PA children maintain their physical fitness during growth, while it deteriorates in the non-PA children.

  3. Total ion chromatographic fingerprints combined with chemometrics and mass defect filter to predict antitumor components of Picrasma quassioids.

    PubMed

    Shi, Yuanyuan; Zhan, Hao; Zhong, Liuyi; Yan, Fangrong; Feng, Feng; Liu, Wenyuan; Xie, Ning

    2016-07-01

    A method of total ion chromatogram combined with chemometrics and mass defect filter was established for the prediction of active ingredients in Picrasma quassioides samples. The total ion chromatogram data of 28 batches were pretreated with wavelet transformation and correlation optimized warping to correct baseline drifts and retention time shifts. Then partial least squares regression was applied to construct a regression model to bridge the total ion chromatogram fingerprints and the antitumor activity of P. quassioides. Finally, the regression coefficients were used to predict the active peaks in total ion chromatogram fingerprints. In this strategy, mass defect filter was employed to classify and characterize the active peaks from a chemical point of view. A total of 17 constituents were predicted as the potential active compounds, 16 of which were identified as alkaloids by this developed approach. The results showed that the established method was not only simple and easy to operate, but also suitable to predict ultraviolet undetectable compounds and provide chemical information for the prediction of active compounds in herbs. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Lean muscle mass in classic or ovulatory PCOS: association with central obesity and insulin resistance.

    PubMed

    Mario, F M; do Amarante, F; Toscani, M K; Spritzer, P M

    2012-10-01

    This age-matched case-control study assessed total and segmental lean muscle mass in classic or ovulatory polycystic ovary syndrome (PCOS) patients and investigated whether lean mass is associated with hormone and metabolic features. Participants underwent anthropometric and clinical evaluation. Habitual physical activity was assessed with a digital pedometer, and body composition by dual-energy X-ray absorptiometry. Laboratory measurements included total cholesterol, cholesterol fractions, triglycerides, glucose, total serum testosterone, serum insulin, estradiol, luteinizing hormone, and SHBG. Energy intake was calculated using a food frequency questionnaire. Classic PCOS patients had higher body mass index (BMI), waist circumference, testosterone and lipid accumulation product values than ovulatory PCOS and controls. Energy consumption, homeostasis model assessment index, SHBG, free androgen index and triglycerides, total and trunk lean mass were higher only in classic PCOS women vs. controls. Arm, leg, trunk, total or limb lean masses were not correlated with hormone levels in any of the groups. However, in PCOS women lipid accumulation product was positively correlated with total (r=0.56, p=0.001), trunk (r=0.59, p=0.001), arm (r=0.54, p=0.001), leg (r=0.44, p=0.03) and limb (r=0.48, p=0.001) lean masses. BMI was positively correlated with all lean mass segments and independently associated with total lean mass. Lipid accumulation product and BMI were independently associated with trunk lean mass variation. The increase in lean mass in classic PCOS appears to be associated with insulin resistance and central obesity rather than with energy intake, physical activity or androgens. © J. A. Barth Verlag in Georg Thieme Verlag KG Stuttgart · New York.

  5. Predictors of VO2Peak in children age 6- to 7-years-old.

    PubMed

    Dencker, Magnus; Hermansen, Bianca; Bugge, Anna; Froberg, Karsten; Andersen, Lars B

    2011-02-01

    This study investigated the predictors of aerobic fitness (VO2PEAK) in young children on a population-base. Participants were 436 children (229 boys and 207 girls) aged 6.7 ± 0.4 yrs. VO2PEAK was measured during a maximal treadmill exercise test. Physical activity was assessed by accelerometers. Total body fat and total fat free mass were estimated from skinfold measurements. Regression analyses indicated that significant predictors for VO2PEAK per kilogram body mass were total body fat, maximal heart rate, sex, and age. Physical activity explained an additional 4-7%. Further analyses showed the main contributing factors for absolute values of VO2PEAK were fat free mass, maximal heart rate, sex, and age. Physical activity explained an additional 3-6%.

  6. L-Carnitine treatment reduces severity of physical and mental fatigue and increases cognitive functions in centenarians: a randomized and controlled clinical trial.

    PubMed

    Malaguarnera, Mariano; Cammalleri, Lisa; Gargante, Maria Pia; Vacante, Marco; Colonna, Valentina; Motta, Massimo

    2007-12-01

    Centenarians are characterized by weakness, decreasing mental health, impaired mobility, and poor endurance. L-Carnitine is an important contributor to cellular energy metabolism. This study evaluated the efficacy of L-carnitine on physical and mental fatigue and on cognitive functions of centenarians. This was a placebo-controlled, randomized, double-blind, 2-phase study. Sixty-six centenarians with onset of fatigue after even slight physical activity were recruited to the study. The 2 groups received either 2 g levocarnitine once daily (n = 32) or placebo (n = 34). Efficacy measures included changes in total fat mass, total muscle mass, serum triacylglycerol, total cholesterol, HDL cholesterol, LDL cholesterol, Mini-Mental State Examination (MMSE), Activities of Daily Living, and a 6-min walking corridor test. At the end of the study period, the levocarnitine-treated centenarians, compared with the placebo group, showed significant improvements in the following markers: total fat mass (-1.80 compared with 0.6 kg; P < 0.01), total muscle mass (3.80 compared with 0.8 kg; P < 0.01), plasma concentrations of total carnitine (12.60 compared with -1.70 mumol; P < 0.05), plasma long-chain acylcarnitine (1.50 compared with -0.1 micromol; P < 0.001), and plasma short-chain acylcarnitine (6.0 compared with -1.50 micromol; P < 0.001). Significant differences were also found in physical fatigue (-4.10 compared with -1.10; P < 0.01), mental fatigue (-2.70 compared with 0.30; P < 0.001), fatigue severity (-23.60 compared with 1.90; P < 0.001), and MMSE (4.1 compared with 0.6; P < 0.001). Our study indicates that oral administration of levocarnitine produces a reduction of total fat mass, increases total muscular mass, and facilitates an increased capacity for physical and cognitive activity by reducing fatigue and improving cognitive functions.

  7. Influence of muscle strength, physical activity and weight on bone mass in a population-based sample of 1004 elderly women.

    PubMed

    Gerdhem, P; Ringsberg, K A M; Akesson, K; Obrant, K J

    2003-09-01

    High physical activity level has been associated with high bone mass and low fracture risk and is therefore recommended to reduce fractures in old age. The aim of this study was to estimate the effect of potentially modifiable variables, such as physical activity, muscle strength, muscle mass and weight, on bone mass in elderly women. The influence of isometric thigh muscle strength, self-estimated activity level, body composition and weight on bone mineral density (dual energy X-ray absorptiometry; DXA) in total body, hip and spine was investigated. Subjects were 1004 women, all 75 years old, taking part in the Malmö Osteoporosis Prospective Risk Assessment (OPRA) study. Physical activity and muscle strength accounted for 1-6% of the variability in bone mass, whereas weight, and its closely associated variables lean mass and fat mass, to a much greater extent explained the bone mass variability. We found current body weight to be the variable with the most substantial influence on the total variability in bone mass (15-32% depending on skeletal site) in a forward stepwise regression model. Our findings suggest that in elderly women, the major fracture-preventive effect of physical activity is unlikely to be mediated through increased bone mass. Retaining or even increasing body weight is likely to be beneficial to the skeleton, but an excess body weight increase may have negative effects on health. Nevertheless, training in elderly women may have advantages by improving balance, co-ordination and mobility and therefore decreasing the risk of fractures.

  8. Primary and secondary carbonaceous species in the atmosphere of Western Riverside County, California

    NASA Astrophysics Data System (ADS)

    Na, Kwangsam; Sawant, Aniket A.; Song, Chen; Cocker, David R.

    Elemental carbon (EC), organic carbon (OC) and PM 2.5 mass concentrations were measured from September 2001 through January 2002 in Mira Loma, CA. EC and OC were analyzed using the NIOSH (National Institute of Occupational Safety and Health) 5040 thermal/optical transmittance method. OC concentrations in Mira Loma were found to be higher than those of other urban sites in the South Coast Air Basin (SoCAB), while EC concentrations were comparable to or lower than those of other SoCAB sites. Overall, OC and EC concentrations accounted for 26% and 5% of the total PM 2.5, respectively. OC/EC ratios ranged from 1.6 to 12.8 with an average of 5.2. These values were higher than those observed at other urban sites in the United States by a factor of 2. A stronger correlation between suspended OC and EC concentrations was noted in months with lower photochemical activity (December and January, r=0.82) than in months with greater photochemical activity (September and October, r=0.64). The elevated levels of OC, OC/EC ratios, and the seasonal difference in correlation between OC and EC concentrations were attributed in part to significant secondary organic aerosol formation. The fraction of total organic carbon that was secondary organic carbon (SOC) was estimated using the OC/EC minimum ratio method and Chemical Mass Balance (CMB) modeling. Based on the OC/EC minimum ratio method, the contribution of SOC to the total organic carbon tended to be higher during the months with greater photochemical activity (63%) than those with lower photochemical activity (44%). Based on CMB modeling, SOC contributed to 14% of the total PM 2.5 mass and 57% of the total organic carbon during the study period. Overall, these findings suggest that photochemical activity can appreciably affect total PM 2.5 mass concentrations in Mira Loma, and that measures to control emissions of SOC precursors incorporated as part of a region-wide air quality management plan could lead to a perceptible drop in total PM 2.5 mass concentrations in this area.

  9. Field activity cost estimates for the first 3 years of the World Bank Loan Project for schistosomiasis control in China.

    PubMed

    Guo, J; Booth, M; Jenkins, J; Wang, H; Tanner, M

    1998-12-01

    The World Bank Loan Project for schistosomiasis in China commenced field activities in 1992. In this paper, we describe disease control strategies for levels of different endemicity, and estimate unit costs and total expenditure of screening, treatment (cattle and humans) and snail control for 8 provinces where Schistosoma japonicum infection is endemic. Overall, we estimate that more than 21 million US dollars were spent on field activities during the first three years of the project. Mollusciciding (43% of the total expenditure) and screening (28% of the total) are estimated to have the most expensive field activities. However, despite the expense of screening, a simple model predicts that selective chemotherapy could have been cheaper than mass chemotherapy in areas where infection prevalence was higher than 15%, which was the threshold for mass chemotherapy intervention. It is concluded that considerable cost savings could be made in the future by narrowing the scope of snail control activities, redefining the threshold infection prevalence for mass chemotherapy, defining smaller administrative units, and developing rapid assessment tools.

  10. Analysis of fat and muscle mass in patients with inflammatory bowel disease during remission and active phase.

    PubMed

    Rocha, Raquel; Santana, Genoile Oliveira; Almeida, Neogélia; Lyra, Andre Castro

    2009-03-01

    Inflammatory bowel disease (IBD) is often associated with malnutrition. The aim of this study was to compare the body composition of outpatients with IBD during remission and active phase. In order to evaluate disease activity we used Crohn's Disease Activity Index for Crohn's disease (CD) patients and Lichtiger's Index for ulcerative colitis (UC) patients. All patients underwent the analysis of BMI, arm muscle area (AMA) and triceps plus subscapula skinfold thickness (TST+SST) to identify total, muscle and fat mass, respectively. In total 102 patients were evaluated (CD, n 50; UC, n 52) and the majority was young women. Malnutrition according to BMI was found in 14.0 % of patients with CD and 5.7 % of UC patients. Muscle mass depletion was detected in more than half of the CD and UC patients. The BMI, TST+SST and AMA values were lower in the active phase only in CD patients (P < 0.05). Fat mass depletion was associated with active phase in both CD and UC patients. Body composition parameters obtained using BMI, TST+SST and AMA were not correlated with the presence of fistula in CD patients (P>0.05). In conclusion, patients without signs of malnutrition had fat mass depletion especially in the active phase and muscle mass depletion occurred both in CD and UC patients.

  11. 77 FR 61048 - Agency Information Collection Activity Under OMB Review

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-10-05

    ... Information Collection Activity Under OMB Review AGENCY: Federal Transit Administration, DOT. ACTION: Notice... necessary to determine eligibility of applicants and ensure mass transportation service at a minimum cost... will improve mass transportation service or help transportation service meet the total urban...

  12. Psychometric properties of the modified RESIDE physical activity questionnaire among low-income overweight women.

    PubMed

    Jones, Sydney A; Evenson, Kelly R; Johnston, Larry F; Trost, Stewart G; Samuel-Hodge, Carmen; Jewell, David A; Kraschnewski, Jennifer L; Keyserling, Thomas C

    2015-01-01

    This study explored the criterion-related validity and test-retest reliability of the modified RESIDential Environment physical activity questionnaire and whether the instrument's validity varied by body mass index, education, race/ethnicity, or employment status. Validation study using baseline data collected for randomized trial of a weight loss intervention. Participants recruited from health departments wore an ActiGraph accelerometer and self-reported non-occupational walking, moderate and vigorous physical activity on the modified RESIDential Environment questionnaire. We assessed validity (n=152) using Spearman correlation coefficients, and reliability (n=57) using intraclass correlation coefficients. When compared to steps, moderate physical activity, and bouts of moderate/vigorous physical activity measured by accelerometer, these questionnaire measures showed fair evidence for validity: recreational walking (Spearman correlation coefficients 0.23-0.36), total walking (Spearman correlation coefficients 0.24-0.37), and total moderate physical activity (Spearman correlation coefficients 0.18-0.36). Correlations for self-reported walking and moderate physical activity were higher among unemployed participants and women with lower body mass indices. Generally no other variability in the validity of the instrument was found. Evidence for reliability of RESIDential Environment measures of recreational walking, total walking, and total moderate physical activity was substantial (intraclass correlation coefficients 0.56-0.68). Evidence for questionnaire validity and reliability varied by activity domain and was strongest for walking measures. The questionnaire may capture physical activity less accurately among women with higher body mass indices and employed participants. Capturing occupational activity, specifically walking at work, may improve questionnaire validity. Copyright © 2014 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

  13. Effect of electrode mass ratio on aging of activated carbon based supercapacitors utilizing organic electrolytes

    NASA Astrophysics Data System (ADS)

    Cericola, D.; Kötz, R.; Wokaun, A.

    2011-03-01

    The accelerated degradation of carbon based supercapacitors utilizing 1 M Et4NBF4 in acetonitrile and in propylene carbonate as electrolyte is investigated for a constant cell voltage of 3.5 V as a function of the positive over total electrode mass ratio. The degradation rate of the supercapacitor using acetonitrile as a solvent can be decreased by increasing the mass of the positive electrode. With a mass ratio (positive electrode mass/total electrode mass) of 0.65 the degradation rate is minimum. For the capacitor utilizing propylene carbonate as a solvent a similar effect was observed. The degradation rate was smallest for a mass ratio above 0.5.

  14. The SLUGGS survey: a comparison of total-mass profiles of early-type galaxies from observations and cosmological simulations, to ˜4 effective radii

    NASA Astrophysics Data System (ADS)

    Bellstedt, Sabine; Forbes, Duncan A.; Romanowsky, Aaron J.; Remus, Rhea-Silvia; Stevens, Adam R. H.; Brodie, Jean P.; Poci, Adriano; McDermid, Richard; Alabi, Adebusola; Chevalier, Leonie; Adams, Caitlin; Ferré-Mateu, Anna; Wasserman, Asher; Pandya, Viraj

    2018-06-01

    We apply the Jeans Anisotropic Multi-Gaussian Expansion dynamical modelling method to SAGES Legacy Unifying Globulars and GalaxieS (SLUGGS) survey data of early-type galaxies in the stellar mass range 1010 < M*/M⊙ < 1011.6 that cover a large radial range of 0.1-4.0 effective radii. We combine SLUGGS and ATLAS3D data sets to model the total-mass profiles of a sample of 21 fast-rotator galaxies, utilizing a hyperparameter method to combine the two independent data sets. The total-mass density profile slope values derived for these galaxies are consistent with those measured in the inner regions of galaxies by other studies. Furthermore, the total-mass density slopes (γtot) appear to be universal over this broad stellar mass range, with an average value of γtot = -2.24 ± 0.05 , i.e. slightly steeper than isothermal. We compare our results to model galaxies from the Magneticum and EAGLE cosmological hydrodynamic simulations, in order to probe the mechanisms that are responsible for varying total-mass density profile slopes. The simulated-galaxy slopes are shallower than the observed values by ˜0.3-0.5, indicating that the physical processes shaping the mass distributions of galaxies in cosmological simulations are still incomplete. For galaxies with M* > 1010.7 M⊙ in the Magneticum simulations, we identify a significant anticorrelation between total-mass density profile slopes and the fraction of stellar mass formed ex situ (i.e. accreted), whereas this anticorrelation is weaker for lower stellar masses, implying that the measured total-mass density slopes for low-mass galaxies are less likely to be determined by merger activity.

  15. A low-cost method for estimating energy expenditure during soccer refereeing.

    PubMed

    Ardigò, Luca Paolo; Padulo, Johnny; Zuliani, Andrea; Capelli, Carlo

    2015-01-01

    This study aimed to apply a validated bioenergetics model of sprint running to recordings obtained from commercial basic high-sensitivity global positioning system receivers to estimate energy expenditure and physical activity variables during soccer refereeing. We studied five Italian fifth division referees during 20 official matches while carrying the receivers. By applying the model to the recorded speed and acceleration data, we calculated energy consumption during activity, mass-normalised total energy consumption, total distance, metabolically equivalent distance and their ratio over the entire match and the two halves. Main results were as follows: (match) energy consumption = 4729 ± 608 kJ, mass normalised total energy consumption = 74 ± 8 kJ · kg(-1), total distance = 13,112 ± 1225 m, metabolically equivalent distance = 13,788 ± 1151 m and metabolically equivalent/total distance = 1.05 ± 0.05. By using a very low-cost device, it is possible to estimate the energy expenditure of soccer refereeing. The provided predicting mass-normalised total energy consumption versus total distance equation can supply information about soccer refereeing energy demand.

  16. Atmospheric mass-loss of extrasolar planets orbiting magnetically active host stars

    NASA Astrophysics Data System (ADS)

    Lalitha, Sairam; Schmitt, J. H. M. M.; Dash, Spandan

    2018-06-01

    Magnetic stellar activity of exoplanet hosts can lead to the production of large amounts of high-energy emission, which irradiates extrasolar planets, located in the immediate vicinity of such stars. This radiation is absorbed in the planets' upper atmospheres, which consequently heat up and evaporate, possibly leading to an irradiation-induced mass-loss. We present a study of the high-energy emission in the four magnetically active planet-bearing host stars, Kepler-63, Kepler-210, WASP-19, and HAT-P-11, based on new XMM-Newton observations. We find that the X-ray luminosities of these stars are rather high with orders of magnitude above the level of the active Sun. The total XUV irradiation of these planets is expected to be stronger than that of well-studied hot Jupiters. Using the estimated XUV luminosities as the energy input to the planetary atmospheres, we obtain upper limits for the total mass- loss in these hot Jupiters.

  17. NRLMSISE-00 Empirical Model of the Atmosphere: Statistical Comparisons and Scientific Issues

    NASA Technical Reports Server (NTRS)

    Aikin, A. C.; Picone, J. M.; Hedin, A. E.; Drob, D. P.

    2001-01-01

    The new NRLMSISE-00 model and the associated NRLMSIS database now include the following data: (1) total mass density from satellite accelerometers and from orbit determination, including the Jacchia and Barlier data; (2) temperature from incoherent scatter radar, and; (3) molecular oxygen number density, [O2], from solar ultraviolet occultation aboard the Solar Maximum Mission (SMM). A new component, 'anomalous oxygen,' allows for appreciable O(+) and hot atomic oxygen contributions to the total mass density at high altitudes and applies primarily to drag estimation above 500 km. Extensive tables compare our entire database to the NRLMSISE-00, MSISE-90, and Jacchia-70 models for different altitude bands and levels of geomagnetic activity. We also investigate scientific issues related to the new data sets in the NRLMSIS database. Especially noteworthy is the solar activity dependence of the Jacchia data, with which we investigate a large O(+) contribution to the total mass density under the combination of summer, low solar activity, high latitudes, and high altitudes. Under these conditions, except at very low solar activity, the Jacchia data and the Jacchia-70 model indeed show a significantly higher total mass density than does MSISE-90. However, under the corresponding winter conditions, the MSIS-class models represent a noticeable improvement relative to Jacchia-70 over a wide range of F(sub 10.7). Considering the two regimes together, NRLMSISE-00 achieves an improvement over both MSISE-90 and Jacchia-70 by incorporating advantages of each.

  18. Lifetime physical activity and calcium intake related to bone density in young women.

    PubMed

    Wallace, Lorraine Silver; Ballard, Joyce E

    2002-05-01

    Osteoporosis is a significant public health problem associated with increased mortality and morbidity. Our aim in this cross-sectional study was to investigate the relationship between lifetime physical activity and calcium intake and bone mineral density (BMD) and BMC (bone mineral content) in 42 regularly menstruating Caucasian women (age 21.26+/-1.91 years, BMI 23.83+/-5.85). BMD and BMC at the lumbar spine (L2-L4), hip (femoral neck, trochanter, total), and total body were assessed by dual energy x-ray absorptiometry (DXA). Lifetime history of physical activity and calcium intake was obtained by a structured interview using valid and reliable instruments. Measures of both lifetime physical activity and calcium intake were highly correlated. In stepwise multiple regression analyses, lean mass was the most important and consistent factor for predicting BMD and BMC at all skeletal sites (attributable r2 = 28.8%-78.7%). Lifetime physical activity contributed to 3.0% of the variation in total body BMD, and life-time weight-bearing physical activity explained 15.1% of variance in lumbar spine BMC. Current calcium intake predicted 6% of the variance in BMD at the femoral neck and trochanter. We found lean mass to be a powerful predictor of BMD and BMC in young women. Because lean mass can be modified to some extent by physical activity, public health efforts must be directed at increasing physical activity throughout the lifespan. Furthermore, our results suggest that adequate calcium intake may help to enhance bone mass, thus decreasing the risk of osteoporotic fracture later in life.

  19. Effects of Habitual Physical Activity and Fitness on Tibial Cortical Bone Mass, Structure and Mass Distribution in Pre-pubertal Boys and Girls: The Look Study.

    PubMed

    Duckham, Rachel L; Rantalainen, Timo; Ducher, Gaele; Hill, Briony; Telford, Richard D; Telford, Rohan M; Daly, Robin M

    2016-07-01

    Targeted weight-bearing activities during the pre-pubertal years can improve cortical bone mass, structure and distribution, but less is known about the influence of habitual physical activity (PA) and fitness. This study examined the effects of contrasting habitual PA and fitness levels on cortical bone density, geometry and mass distribution in pre-pubertal children. Boys (n = 241) and girls (n = 245) aged 7-9 years had a pQCT scan to measure tibial mid-shaft total, cortical and medullary area, cortical thickness, density, polar strength strain index (SSIpolar) and the mass/density distribution through the bone cortex (radial distribution divided into endo-, mid- and pericortical regions) and around the centre of mass (polar distribution). Four contrasting PA and fitness groups (inactive-unfit, inactive-fit, active-unfit, active-fit) were generated based on daily step counts (pedometer, 7-days) and fitness levels (20-m shuttle test and vertical jump) for boys and girls separately. Active-fit boys had 7.3-7.7 % greater cortical area and thickness compared to inactive-unfit boys (P < 0.05), which was largely due to a 6.4-7.8 % (P < 0.05) greater cortical mass in the posterior-lateral, medial and posterior-medial 66 % tibial regions. Cortical area was not significantly different across PA-fitness categories in girls, but active-fit girls had 6.1 % (P < 0.05) greater SSIpolar compared to inactive-fit girls, which was likely due to their 6.7 % (P < 0.05) greater total bone area. There was also a small region-specific cortical mass benefit in the posterior-medial 66 % tibia cortex in active-fit girls. Higher levels of habitual PA-fitness were associated with small regional-specific gains in 66 % tibial cortical bone mass in pre-pubertal children, particularly boys.

  20. Magnetic Causes of Solar Coronal Mass Ejections: Dominance of the Free Magnetic Energy over Either the Magnetic Twist or Size Alone

    NASA Technical Reports Server (NTRS)

    Falconer, D. A.; Moore, R. L.; Gary, G. A.

    2006-01-01

    We report further results from our ongoing assessment of magnetogram-based measures of active-region nonpotentiality and size as predictors of coronal mass ejections (CMEs). We have devised improved generalized measures of active-region nonpotentiality that apply to active regions of any degree of magnetic complexity, rather than being limited to bipolar active regions as our initial measures were. From a set of approx.50 active-regions, we have found that measures of total nonpotentiality have a 75-80% success rate n predicting whether an active region will produce a CME in 2 days after the magnetogram. This makes measures of total nonpotentiality a better predictor than either active-region size, or active region twist (size-normalized nonpotentiality), which have a approx.65% success rates. We have also found that we can measure from the line-of-sight magnetograms an active region's total nonpotentiality and the size, which allows use to use MDI to evaluate these quantities for 4-5 consecutive days for each active region, and to investigate if there is some combination of size and total nonpotentiality that have a stronger predictive power than does total nonpotentiality. This work was funded by NASA through its LWS TR&T Program and its Solar and Heliospheric Physics SR&T Program, and by NSF through its Solar Terrestrial Research and SHINE programs.

  1. Interacting effects of water temperature and swimming activity on body composition and mortality of fasted juvenile rainbow trout

    USGS Publications Warehouse

    Simpkins, D.G.; Hubert, W.A.; Martinez Del Rio, C.; Rule, D.C.

    2003-01-01

    Abstract: We assessed changes in proximate body composition, wet mass, and the occurrence of mortality among sedentary and actively swimming (15 cm/s) juvenile rainbow trout (Oncorhynchus mykiss) (120-142 mm total length) that were held at 4.0, 7.5, or 15.0 ??C and fasted for 140 days. Warmer water temperatures and swimming activity accentuated declines in lipid mass, but they did not similarly affect lean mass and wet mass. Swimming fish conserved lean mass independent of water temperature. Because lean mass exceeded lipid mass, wet mass was not affected substantially by decreases in lipid mass. Consequently, wet mass did not accurately reflect the effects that water temperature and swimming activity had on mortality of fasted rainbow trout. Rather, lipid mass was more accurate in predicting death from starvation. Juvenile rainbow trout survived long periods without food, and fish that died of starvation appeared to have similar body composition. It appears that the ability of fish to endure periods without food depends on the degree to which lipid mass and lean mass can be utilized as energy sources.

  2. Active Brown Fat During 18F-FDG PET/CT Imaging Defines a Patient Group with Characteristic Traits and an Increased Probability of Brown Fat Redetection.

    PubMed

    Gerngroß, Carlos; Schretter, Johanna; Klingenspor, Martin; Schwaiger, Markus; Fromme, Tobias

    2017-07-01

    Brown adipose tissue (BAT) provides a means of nonshivering thermogenesis. In humans, active BAT can be visualized by 18 F-FDG uptake as detected by PET combined with CT. The retrospective analysis of clinical scans is a valuable source to identify anthropometric parameters that influence BAT mass and activity and thus the potential efficacy of envisioned drugs targeting this tissue to treat metabolic disease. Methods: We analyzed 2,854 18 F-FDG PET/CT scans from 1,644 patients and identified 98 scans from 81 patients with active BAT. We quantified the volume of active BAT depots (mean values in mL ± SD: total BAT, 162 ± 183 [ n = 98]; cervical, 40 ± 37 [ n = 53]; supraclavicular, 66 ± 68 [ n = 71]; paravertebral, 51 ± 53 [ n = 69]; mediastinal, 43 ± 40 [ n = 51]; subphrenic, 21 ± 21 [ n = 29]). Because only active BAT is detectable by 18 F-FDG uptake, these numbers underestimate the total amount of BAT. Considering only 32 scans of the highest activity as categorized by a visual scoring strategy, we determined a mean total BAT volume of 308 ± 208 mL. In 30 BAT-positive patients with 3 or more repeated scans, we calculated a much higher mean probability to redetect active BAT (52% ± 25%) as compared with the overall prevalence of 4.9%. We calculated a BAT activity index (BFI) based on volume and intensity of individual BAT depots. Results: We detected higher total BFI in younger patients ( P = 0.009), whereas sex, body mass index, height, mass, outdoor temperature, and blood parameters did not affect total or depot-specific BAT activity. Surprisingly, renal creatinine clearance as estimated from mass, age, and plasma creatinine was a significant predictor of BFI on the total ( P = 0.005) as well as on the level of several individual depots. In summary, we detected a high amount of more than 300 mL of BAT tissue. Conclusion: BAT-positive patients represent a group with a higher than usual probability to activate BAT during a scan. Estimated renal creatinine clearance correlated with the extent of activated BAT in a given scan. These data imply an efficacy of drugs targeting BAT to treat metabolic disease that is at the same time higher and subject to a larger individual variation than previously assumed. © 2017 by the Society of Nuclear Medicine and Molecular Imaging.

  3. Biochemical differences in the mass and activity tests of lipoprotein-associated phospholipase A2 explain the discordance in results between the two assay methods.

    PubMed

    Zhuo, Shaoqiu; Wolfert, Robert L; Yuan, Chong

    2017-12-01

    There are two platforms for the detection of Lp-PLA 2 in sera or plasmas: by its enzymatic activity (PLAC® activity test) and by its mass concentration (PLAC® mass test). It has been long recognized that these two platforms are not correlated well. The underlying cause for this is therefore investigated by the biochemical characterization of the two PLAC tests. Human sera with and without the treatment by detergent were fractionated by using a Superose-6 column in phosphate buffered saline and the phospholipid associated Lp-PLA 2 was assessed by both PLAC mass and activity tests. The Lp-PLA 2 values of the two PLAC tests were compared under such conditions. Fractionation of sera and plasmas indicates that the association of Lp-PLA 2 with phospholipids, especially LDL and other large size phospholipid vesicles, may block the detection of the enzyme by antibodies in the immunoassay format under the conditions of the PLAC mass test. Inclusion of high concentration (>CMC, critical micelle concentration) of detergents in the assay buffer of PLAC mass test dissociates Lp-PLA 2 from phospholipid vesicles and results in the full detection of all Lp-PLA 2 in sera or plasmas for concentration. Such assay modification significantly improves the correlation between the PLAC mass and PLAC activity tests. PLAC mass test only detects a small portion of the total Lp-PLA 2 , mainly the Lp-PLA 2 associated with HDL. This is the main cause of the discordance and poor correlation between the PLAC mass and activity tests. Our results demonstrate the PLAC activity test is more accurate in assessing the total level of circulating Lp-PLA 2 . Copyright © 2017 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  4. High-intensity interval training reduces abdominal fat mass in postmenopausal women with type 2 diabetes.

    PubMed

    Maillard, F; Rousset, S; Pereira, B; Traore, A; de Pradel Del Amaze, P; Boirie, Y; Duclos, M; Boisseau, N

    2016-12-01

    This study compared the effect of high-intensity interval training (HIIT) and moderate-intensity continuous training (MICT) for 16 weeks on whole-body and abdominal fat mass (FM) in postmenopausal women with type 2 diabetes (T2D). Seventeen women (69±1 years; BMI: 31±1kg.m -2 ) were randomly assigned to either a HIIT [60×(8s at 77-85% HR max , 12s of active recovery)] or MICT (40min at 55-60% of their individual HRR) cycling program for 16 weeks, 2 days/week. Dual-energy X-ray absorptiometry was used to measure whole-body and regional FM content, including abdominal adiposity and visceral adipose tissue. Plasma cholesterol, HDL, LDL, triglycerides, glucose and HbA 1c levels were measured. Levels of nutritional intake and physical activity were evaluated by 7-day self-reports. Dietary energy (caloric) intake, physical activity level and total body mass did not vary in either group from the beginning to the end of the training intervention. Overall, total FM decreased and total fat-free mass significantly increased over time (by around 2-3%). Total FM reduction at the end of the intervention was not significantly different between groups. However, significant loss of total abdominal (-8.3±2.2%) and visceral (-24.2±7.7%) FM was observed only with HIIT. Time effects were noted for HbA 1c and total cholesterol/HDL ratio. With no concomitant caloric restriction, an HIIT program in postmenopausal women with T2D (twice a week for 16 weeks) appeared to be more effective for reducing central obesity than MICT, and could be proposed as an alternative exercise training program for this population. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  5. Sarcopenia is a risk factor for elevated aminotransferase in men independently of body mass index, dietary habits, and physical activity.

    PubMed

    Yoo, Ki Deok; Jun, Dae Won; Lee, Kang Nyeong; Lee, Hang Lak; Lee, Oh Young; Yoon, Byung Chul; Choi, Ho Soon

    2015-04-01

    Aminotransferase activity is a surrogate marker of liver injury showing strong correlations with obesity and metabolic syndrome. However, elevated aminotransferase activity is not uncommon in non-obese and non-alcoholic patients in clinical practice. To examine the relationship between sarcopenia and aminotransferase activity in a large population-based cohort. Data from the Korean National Health and Nutrition Examinations were used. A total of 13,431 subjects were included. A whole-body dual X-ray absorptiometry scan was performed on each patient to measure total and regional muscle mass. Appendicular skeletal muscle mass indices were also obtained. The prevalence of sarcopenia was significantly higher in the group with elevated aminotransferase levels than in the normal liver enzyme group (males: 26.5% vs. 16.9%; females: 38.3% vs. 22.1%, p<0.05). The skeletal muscle index was negatively correlated with most cardiometabolic risk factors, including fasting glucose and cholesterol levels. The frequency of elevated aminotransferase increased in male patients with sarcopenia after adjusting for potential confounding factors including age, body mass index, fasting glucose level, dietary, and exercise habits. However, the correlation was no longer observed in women after adjusting for body mass index. Sarcopenia is a risk factor for elevated aminotransferase in men, independently of body mass index, dietary habits, and physical activity. Copyright © 2015 Editrice Gastroenterologica Italiana S.r.l. Published by Elsevier Ltd. All rights reserved.

  6. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Reines, Amy E.; Volonteri, Marta, E-mail: reines@umich.edu

    Scaling relations between central black hole (BH) mass and host galaxy properties are of fundamental importance to studies of BH and galaxy evolution throughout cosmic time. Here we investigate the relationship between BH mass and host galaxy total stellar mass using a sample of 262 broad-line active galactic nuclei (AGNs) in the nearby universe (z < 0.055), as well as 79 galaxies with dynamical BH masses. The vast majority of our AGN sample is constructed using Sloan Digital Sky Survey spectroscopy and searching for Seyfert-like narrow-line ratios and broad Hα emission. BH masses are estimated using standard virial techniques. Wemore » also include a small number of dwarf galaxies with total stellar masses M{sub stellar} ≲ 10{sup 9.5} M{sub ⊙} and a subsample of the reverberation-mapped AGNs. Total stellar masses of all 341 galaxies are calculated in the most consistent manner feasible using color-dependent mass-to-light ratios. We find a clear correlation between BH mass and total stellar mass for the AGN host galaxies, with M{sub BH} ∝ M{sub stellar}, similar to that of early-type galaxies with dynamically detected BHs. However, the relation defined by the AGNs has a normalization that is lower by more than an order of magnitude, with a BH-to-total stellar mass fraction of M{sub BH}/M{sub stellar} ∼ 0.025% across the stellar mass range 10{sup 8} ≤ M{sub stellar}/M{sub ⊙} ≤ 10{sup 12}. This result has significant implications for studies at high redshift and cosmological simulations in which stellar bulges cannot be resolved.« less

  7. A Launch Requirements Trade Study for Active Space Radiation Shielding for Long Duration Human Missions

    NASA Technical Reports Server (NTRS)

    Singleterry, Robert C., Jr.; Bollweg, Ken; Martin, Trent; Westover, Shayne; Battiston, Roberto; Burger, William J.; Meinke, Rainer

    2015-01-01

    A trade study for an active shielding concept based on magnetic fields in a solenoid configuration versus mass based shielding was developed. Monte Carlo simulations were used to estimate the radiation exposure for two values of the magnetic field strength and the mass of the magnetic shield configuration. For each field strength, results were reported for the magnetic region shielding (end caps ignored) and total region shielding (end caps included but no magnetic field protection) configurations. A value of 15 cSv was chosen to be the maximum exposure for an astronaut. The radiation dose estimate over the total shield region configuration cannot be used at this time without a better understanding of the material and mass present in the end cap regions through a detailed vehicle design. The magnetic shield region configuration, assuming the end cap regions contribute zero exposure, can be launched on a single Space Launch System rocket and up to a two year mission can be supported. The magnetic shield region configuration results in two versus nine launches for a comparable mass based shielding configuration. The active shielding approach is clearly more mass efficient because of the reduced number of launches than the mass based shielding for long duration missions.

  8. The Mass Index and Total Mass of the Geminid Meteoroid Stream as Found with Radar, Optical, and Lunar Impact Data

    NASA Technical Reports Server (NTRS)

    Blaauw, R.

    2016-01-01

    The Geminid meteor shower was observed in 2015 using the Western Meteor Physics Group’s Canadian Meteor Orbit Radar (CMOR), Marshall Space Flight Center’s (MSFC) eight wide-field optical cameras, and MSFC’s lunar impact monitoring. These observations allowed Geminid fluxes to be calculated in three unique mass-ranges, from 1.8 (exponent -4) grams to 30 grams. From these fluxes, a mass index of 1.68 plus or minus 0.04 is found, which is in excellent agreement with past Geminid mass indices such as 1.69 found by Blaauw et al using only radar data and 1.7 found by Arlt and Rendtel using visual data. This mass index, however, is found over five orders of magnitude of mass, which allows a higher level of confidence that this mass index holds over a large portion of the stream. Mass indices are an important quantity to be accurately measured for a shower, indicating the distribution of mass in a well-studied stream in which we know the parent body (3200 Phaethon), improving forecasts of the shower activity, and allow fluxes to be scaled to high and low masses. The quantities derived here, along with a profile of the Geminid meteor shower activity in 2015 from CMOR, permit the total Geminid mass the Earth encountered in 2015 to be found, along with a minimum total mass of the Geminid meteoroid stream. Attempts have been made in the past to measure the mass of meteoroid streams using Zenithal Hourly Rate (ZHR) profiles, but here this new and improved treatment uses empirically derived fluxes and measured mass indices for the 2015 encounter with the meteoroid stream. This is to be compared with other meteoroid stream mass estimates including that of the Perseids, caused by comet Swift Tuttle.

  9. Occurrences and behaviors of naphthenic acids in a petroleum refinery wastewater treatment plant.

    PubMed

    Wang, Beili; Wan, Yi; Gao, Yingxin; Zheng, Guomao; Yang, Min; Wu, Song; Hu, Jianying

    2015-05-05

    Naphthenic acids (NAs) are one class of compounds in wastewaters from petroleum industries that are known to cause toxic effects, and their removal from oilfield wastewater is an important challenge for remediation of large volumes of petrochemical effluents. The present study investigated occurrences and behaviors of total NAs and aromatic NAs in a refinery wastewater treatment plant, located in north China, which combined physicochemical and biological processes. Concentrations of total NAs were semiquantified to be 113-392 μg/L in wastewater from all the treatment units, and the percentages of aromatic NAs in total NAs was estimated to be 2.1-8.8%. The mass reduction for total NAs and aromatic NAs was 15±16% and 7.5±24% after the physicochemical treatment, respectively. Great mass reduction (total NAs: 65±11%, aromatic NAs: 86±5%) was observed in the biological treatment units, and antiestrogenic activities observed in wastewater from physicochemical treatment units disappeared in the effluent of the activated sludge system. The distributions of mass fractions of NAs demonstrated that biodegradation via activated sludge was the major mechanism for removing alicyclic NAs, aromatic NAs, and related toxicities in the plant, and the polycyclic NA congener classes were relatively recalcitrant to biodegradation, which is a complete contrast to the preferential adsorption of NAs with higher cyclicity (low Z value). Removal efficiencies of total NAs were 73±17% in summer, which were higher than those in winter (53±15%), and the seasonal variation was possibly due to the relatively high microbial biotransformation activities in the activated sludge system in summer (indexed by O3-NAs/NAs). The results of the investigations indicated that biotransformation of NA mixtures by the activated sludge system were largely affected by temperature, and employing an efficient adsorbent together with biodegradation processes would help cost-effectively remove NAs in petroleum effluents.

  10. Total pollen counts do not influence active surface measurements

    NASA Astrophysics Data System (ADS)

    Moshammer, Hanns; Schinko, Herwig; Neuberger, Manfred

    We investigated the temporal association of various aerosol parameters with pollen counts in the pollen season (April 2001) in Linz, Austria. We were especially interested in the relationship between active surface (or Fuchs' surface) because we had shown previously (Atmos. Environ. 37 (2003) 1737-1744) that this parameter during the same observation period was a better predictor for acute respiratory symptoms in school children (like wheezing, shortness of breath, and cough) and reduced lung function on the same day than particle mass (PM 10). While active surface is most sensitive for fine particles with a diameter of less than 100 nm it has no strict upper cut-off regarding particle size and so could eventually be influenced also by larger particles if their numbers were high. All particle mass parameters tested (TSP, PM 10, PM 1) were weakly ( r approximately 0.2) though significantly correlated with pollen counts but neither was active surface nor total particle counts (CPC). The weak association of particle mass and pollen counts was due mainly to similar diurnal variations and a linear trend over time. Only the mass of the coarse fraction (TSP minus PM 10) remained associated with pollen counts significantly after controlling for these general temporal patterns.

  11. Physical Activity and Sedentary Behavior in Adolescents With Type 1 Diabetes

    PubMed Central

    Michaliszyn, Sara Fleet; Faulkner, Melissa Spezia

    2014-01-01

    The purpose of this study was to describe the associations between levels of physical activity measured by accelerometry and changes in fitness, body composition, lipids, and glucose control (i.e., glycosolated hemoglobin [A1C]) in a sample of 16 adolescents with type 1 diabetes participating in a personalized exercise program. More sedentary activity was associated with lower fitness and fat free mass and increased total cholesterol, low-density lipoprotein (LDL-c), and triglycerides (p < .05). Greater amounts of moderate to vigorous activity were associated with higher fitness and fat free mass, and decreased total cholesterol, LDL-c, triglycerides, and A1C (p < .05). Findings support the beneficial effects of increased moderate activity and decreased sedentary behavior to reduce cardiovascular risks and improve glucose control in adolescents with type 1 diabetes. PMID:20672318

  12. Immigration, acculturation, and risk factors for obesity and cardiovascular disease: a comparison between Latinos of Peruvian descent in Peru and in the United States.

    PubMed

    Lizarzaburu, Jesus L; Palinkas, Lawrence A

    2002-01-01

    To determine whether migration and acculturation was associated with risk factors for obesity and cardiovascular disease, whether this association is linear or curvilinear, and whether the socio-cultural context alters the association between obesity and cardiovascular disease and individual-level variables. Lima, Peru, San Diego and San Francisco, California. Ninety-two Peruvian residents of Lima and 83 Peruvian immigrant residents of California. total cholesterol, blood pressure, body mass index, waist-to-hip ratio. A significant linear association was found between migration and acculturation and alcohol consumption and total cholesterol in men and women, systolic (SBP) and diastolic (DBP) blood pressure and body mass index in men, and physical activity in women. Immigration/acculturation level was a significant independent predictor of total cholesterol. Age and body mass index were independent predictors of total cholesterol only in Peru. Sex was an independent predictor of DBP only in the United States. Body mass index was an in dependent predictor of DBP only in Peru. Household income was an independent predictor of SBP and DBP only in Peru and body mass index only in the United States, while level of education was inversely associated with body mass index only in Peru. Regular strenuous physical activity was an independent predictor of obesity measures only in the United States. The socio-cultural context alters the risk of obesity and cardiovascular disease associated with individual-level variables and accounts for gender and cross-national differences in the migration-illness association.

  13. V380 Dra: New short-period totally eclipsing active binary

    NASA Astrophysics Data System (ADS)

    Özdarcan, O.

    2014-02-01

    In this study, first complete and standard BVR light curves and photometric analysis of the eclipsing binary system V380 Dra are presented. Photometric analysis result indicates that the system has components which are cool main sequence stars. In light and color curves, remarkable asymmetry is observed, especially after secondary minimum, which is believed to be a result of chromospheric activity in one or both components. O-C diagram of available small number of eclipse times, together with new eclipse timings in this work, exhibits no significant variation. Preliminary light curve solution shows that the secondary minimum is total eclipse. By using the advantage of total eclipse and mass-luminosity relation, it is found that the system has a possible mass ratio of q = 0.81. First estimation of masses and radii of primary and secondary components are M1 = 0.77 M⊙,M2 = 0.62 M⊙ and R1 = 0.93 R⊙,R2 = 0.77 R⊙, respectively.

  14. Speciation of As(III) and As(V) in water and sediment using reverse-phase ion-pair high-performance liquid chromatography-neutron activation analysis (HPLC-NAA).

    PubMed

    Tulasi, Delali; Adotey, Dennis; Affum, Andrews; Carboo, Derick; Serfor-Armah, Yaw

    2013-10-01

    Total As content and the As species distribution in water and sediments from the Kwabrafo stream, a major water body draining the Obuasi gold mining community in southwestern Ghana, have been investigated. Total As content was determined by instrumental neutron activation analysis (INAA). Ion-pair reverse phase high-performance liquid chromatography-neutron activation analysis (HPLC-NAA) was used for speciation of As species. Solid phase extraction with phosphate buffer was used to extract soluble As species from lyophilized sediment. The mass balance after phosphate extraction of soluble As species in sediment varied from 89 to 96 %. Compositionally appropriate reference material International Atomic Energy Agency (IAEA)-Lake Sediment (SL)-1 was used to check the validity of INAA method for total As determination. The measured values are in good agreement with the IAEA recommended value and also within the 95 % confidence interval. The accuracy of the measurement in terms of relative deviation from the IAEA recommended value was ±0.83 %. "In-house" prepared As(III) and As(V) standards were used to validate the HPLC-INAA method used for the As species determination. Total As concentration in the water samples ranged from 1.15 to 9.20 mg/L. As(III) species in water varied from 0.13 to 0.7 mg/L, while As(V) species varied from 0.79 to 3.85 mg/L. Total As content in sediment ranged from 2,134 to 3,596 mg/kg dry mass. The levels of As(III) and As(V) species in the sediment ranges from 138 to 506 mg/kg dry mass and 156 to 385 mg/kg dry mass, respectively.

  15. Trajectories of the relationships of physical activity with body composition changes in older men: the MrOS study.

    PubMed

    Laddu, Deepika R; Cawthon, Peggy M; Parimi, Neeta; Hoffman, Andrew R; Orwoll, Eric; Miljkovic, Iva; Stefanick, Marcia L

    2017-06-05

    Excess adiposity gains and significant lean mass loss may be risk factors for chronic disease in old age. Long-term patterns of change in physical activity (PA) and their influence on body composition decline during aging has not been characterized. We evaluated the interrelationships of PA and body composition at the outset and over longitudinal follow-up to changes in older men. Self-reported PA by the Physical Activity Scale for the Elderly (PASE), clinic body weight, and whole-body lean mass (LM) and fat mass, by dual-energy x-ray absorptiometry (DXA), were assessed in 5964 community-dwelling men aged ≥65 years at baseline (2000-2002) and at two subsequent clinic visits up until March 2009 (an average 4.6 and 6.9 years later). Group-based trajectory modeling (GBTM) identified patterns of change in PA and body composition variables. Relationships of PA and body composition changes were then assessed. GBTM identified three discrete trajectory patterns, all with declining PA, associated primarily with initial PA levelshigh-activity (7.2% of men), moderate-activity (50.0%), and low-activity (42.8%). In separate models, GBTM identified eight discrete total weight change groups, five fat mass change groups, and six LM change groups. Joint trajectory modeling by PA and body composition group illustrated significant declines in total weight and LM, whereas fat mass levels were relatively unchanged among high-activity and low-activity-declining groups, and significantly increased in the moderate-activity-declining group. Although patterns of change in PA and body composition were identified, groups were primarily differentiated by initial PA or body composition rather than by distinct trajectories of change in these variables.

  16. Relationship of aging and nutritional status to innate immunity in tube-fed bedridden patients.

    PubMed

    Takeuchi, Yoshiaki; Tashiro, Tomoe; Yamamura, Takuya; Takahashi, Seiichiro; Katayose, Kozo; Kohga, Shin; Takase, Mitsunori; Imawari, Michio

    2017-01-01

    Aging and malnutrition are known to influence immune functions. The aim of this study was to investigate the relationship of aging and malnutrition to innate immune functions in tube-fed bedridden patients. A cross-sectional survey was performed in 71 tube-fed bedridden patients aged 50-95 years (mean age±SD, 80.2±8.5 years) with serum albumin concentrations between 2.5 and 3.5 g/dL. We evaluated associations of age and nutritional variables with natural-killer cell activity, neutrophilphagocytic activity, and neutrophil-sterilizing activity. Nutritional variables included body mass index, weightadjusted energy intake, total lymphocyte count, and serum concentrations of albumin, transferrin, prealbumin, total cholesterol, C-reactive protein, and zinc. Natural-killer cell activity, neutrophil-phagocytic activity, and neutrophil-sterilizing activity were normal or increased in 67 (94%), 63 (89%), and 69 (97%) patients, respectively. Multiple linear regression analysis with a backward elimination method showed that natural-killer cell activity correlated negatively with aging and lymphocyte counts (p<0.01 for both) but positively with body mass index and transferrin (p<0.01 for both). Neutrophil-phagocytic and neutrophil-sterilizing activities were not associated with any variables. In tube-fed bedridden patients with hypo-albuminemia, natural-killer cell activity may be associated with aging, body mass index, transferrin, and lymphocyte counts.

  17. Physical activity and dark skin tone: protective factors against low bone mass in Mexican men.

    PubMed

    Vivanco-Muñoz, Nalleli; Jo, Talavera; Gerardo, Huitron-Bravo; Juan, Tamayo; Clark, Patricia

    2012-01-01

    A cross-sectional study was conducted on 268 Mexican men between the ages of 13 and 80 yr to evaluate the association of clinical factors related with bone mass. Men from high schools, universities, and retirement homes were invited to participate. Body mass index (BMI) was measured, and bone mineral density (BMD) was assessed using dual-energy X-ray absorptiometry for L1-L4 and total hip. Factors related to bone mass were assessed by questionnaire and analyzed using a logistic regression model. Demographic factors (age, education, and occupation), clinical data (BMI, skin tone, previous fracture, history of osteoporosis [OP], and history of fractures), and lifestyle variables (diet, physical activity, sun exposure, and smoking) were evaluated. Physical activity (≥ 60 min/5 times a week) reduced the risk for low BMD for age, osteopenia, and OP at the spine and total hip (odds ratio [OR]: 0.276; 95% confidence interval [CI]: 0.099-0.769; p=0.014; and OR: 0.184; 95% CI: 0.04-0.849; p=0.03, respectively). Dark skin tone was a protective factor, decreasing the risk by up to 70%. In this population of healthy Mexican men (aged 13-80 yr), dark skin and physical activity were protective factors against low bone mass. Copyright © 2012 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.

  18. Smaller size of high metabolic rate organs explains lower resting energy expenditure in Asian-Indian Than Chinese men.

    PubMed

    Song, L L T; Venkataraman, K; Gluckman, P; Chong, Y S; Chee, M-W L; Khoo, C M; Leow, M-Ks; Lee, Y S; Tai, E S; Khoo, E Y H

    2016-04-01

    In Singapore, the obesity prevalence is disproportionately higher in the Asian-Indians and Malays than the Chinese. Lower resting energy expenditure (REE) may be a contributory factor. We explored the association between ethnicity and REE in Chinese, Asian-Indian and Malay men living in Singapore and determined the influence of body composition, mass/volume of high metabolic rate organs, represented by brain volume and trunk fat-free mass (FFM), and physical activity on ethnic differences. Two hundred and forty-four men from Singapore (n=100 Chinese, 70 Asian-Indians and 74 Malays), aged 21-40 years and body mass index of 18.5-30.0 kg m(-2), were recruited in this cross-sectional study. REE was assessed by indirect calorimetry and body composition by dual-energy X-ray absorptiometry. Brain volume was measured by magnetic resonance imaging. Physical activity was assessed by the Singapore Prospective Study Program Physical Activity Questionnaire. REE was significantly lower in Asian-Indians compared with that in Chinese after adjusting for body weight. FFM (total, trunk and limb) and total fat mass were important predictors of REE across all ethnic groups. Brain volume was positively associated with REE only in Malays. Moderate and vigorous physical activity was positively associated with REE only in Asian-Indians and Malays. The difference in REE between Asian-Indians and Chinese was attenuated but remained statistically significant after adjustment for total FFM (59±20 kcal per day), fat mass (67±20 kcal per day) and brain volume (54±22 kcal per day). The association between REE and ethnicity was no longer statistically significant after total FFM was replaced by trunk FFM (which includes heart, liver, kidney and spleen) but not when it was replaced by limb FFM (skeletal muscle). We have demonstrated a lower REE in Asian-Indians compared with Chinese who may contribute to the higher rates of obesity in the former. This difference could be accounted for by differences in metabolically active organs.

  19. Adiposity and TV viewing are related to less bone accrual in young children.

    PubMed

    Wosje, Karen S; Khoury, Philip R; Claytor, Randal P; Copeland, Kristen A; Kalkwarf, Heidi J; Daniels, Stephen R

    2009-01-01

    To examine the relation between baseline fat mass and gain in bone area and bone mass in preschoolers studied prospectively for 4 years, with a focus on the role of physical activity and TV viewing. Children were part of a longitudinal study in which measures of fat, lean and bone mass, height, weight, activity, and diet were taken every 4 months from ages 3 to 7 years. Activity was measured by accelerometer and TV viewing by parent checklist. We included 214 children with total body dual energy x-ray absorptiometry (Hologic 4500A) scans at ages 3.5 and 7 years. Higher baseline fat mass was associated with smaller increases in bone area and bone mass over the next 3.5 years (P < .001). More TV viewing was related to smaller gains in bone area and bone mass accounting for race, sex, and height. Activity by accelerometer was not associated with bone gains. Adiposity and TV viewing are related to less bone accrual in preschoolers.

  20. Body size and pubertal development explain ethnic differences in structural geometry at the femur in Asian, Hispanic, and white early adolescent girls living in the U.S.

    PubMed Central

    Osborne, D.L.; Weaver, C.M.; McCabe, L.D.; McCabe, G.M.; Novotny, R.; Van Loan, M.D.; Going, S.; Matkovic, V.; Boushey, C.J.; Savaiano, D.A.

    2012-01-01

    Variation in structural geometry is present in adulthood, but when this variation arises and what influences this variation prior to adulthood remains poorly understood. Ethnicity is commonly the focus of research of skeletal integrity and appears to explain some of the variation in quantification of bone tissue. However, why ethnicity explains variation in skeletal integrity is unclear. Methods Here we examine predictors of bone cross sectional area (CSA) and section modulus (Z), measured using dual-energy X-ray absorptiometry (DXA) and the Advanced Hip Analysis (AHA) program at the narrow neck of the femur in adolescent (9–14 yr) girls (n=479) living in the United States who were classified as Asian, Hispanic, or white if the subject was 75% of a given group based on parental reported ethnicity. Protocols for measuring height and weight follow standardized procedures. Total body lean mass (LM) and total body fat mass (FM) were quantified in kilograms using DXA. Total dietary and total dairy calcium intakes from the previous month were estimated by the use of an electronic semi-quantitative food frequency questionnaire (eFFQ). Physical activity was estimated for the previous year by a validated self-administered modifiable activity questionnaire for adolescents with energy expenditure calculated from the metabolic equivalent (MET) values from the Compendium of Physical Activities. Multiple regression models were developed to predict CSA and Z. Results Age, time from menarche, total body lean mass (LM), total body fat mass (FM), height, total calcium, and total dairy calcium all shared a significant (p<0.05), positive relationship with CSA. Age, time from menarche, LM, FM, and height shared significant (p<0.05), positive relationships with Z. For both CSA and Z, LM was the most important covariate. Physical activity was not a significant predictor of geometry at the femoral neck (p≥0.339), even after removing LM as a covariate. After adjusting for covariates, ethnicity was not a significant predictor in regression models for CSA and Z. Conclusion Variability in bone geometry at the narrow neck of the femur is best explained by body size and pubertal maturation. After controlling for these covariates there were no differences in bone geometry between ethnic groups. PMID:22944607

  1. Body size and pubertal development explain ethnic differences in structural geometry at the femur in Asian, Hispanic, and white early adolescent girls living in the U.S.

    PubMed

    Osborne, D L; Weaver, C M; McCabe, L D; McCabe, G P; Novotny, R; Van Loan, M D; Going, S; Matkovic, V; Boushey, C J; Savaiano, D A

    2012-11-01

    Variation in structural geometry is present in adulthood, but when this variation arises and what influences this variation prior to adulthood remains poorly understood. Ethnicity is commonly the focus of research of skeletal integrity and appears to explain some of the variation in quantification of bone tissue. However, why ethnicity explains variation in skeletal integrity is unclear. Here we examine predictors of bone cross sectional area (CSA) and section modulus (Z), measured using dual-energy X-ray absorptiometry (DXA) and the Advanced Hip Analysis (AHA) program at the narrow neck of the femur in adolescent (9-14 years) girls (n=479) living in the United States who were classified as Asian, Hispanic, or white if the subject was 75% of a given group based on parental reported ethnicity. Protocols for measuring height and weight follow standardized procedures. Total body lean mass (LM) and total body fat mass (FM) were quantified in kilograms using DXA. Total dietary and total dairy calcium intakes from the previous month were estimated by the use of an electronic semi-quantitative food frequency questionnaire (eFFQ). Physical activity was estimated for the previous year by a validated self-administered modifiable activity questionnaire for adolescents with energy expenditure calculated from the metabolic equivalent (MET) values from the Compendium of Physical Activities. Multiple regression models were developed to predict CSA and Z. Age, time from menarche, total body lean mass (LM), total body fat mass (FM), height, total calcium, and total dairy calcium all shared a significant (p<0.05), positive relationship with CSA. Age, time from menarche, LM, FM, and height shared significant (p<0.05), positive relationships with Z. For both CSA and Z, LM was the most important covariate. Physical activity was not a significant predictor of geometry at the femoral neck (p≥0.339), even after removing LM as a covariate. After adjusting for covariates, ethnicity was not a significant predictor in regression models for CSA and Z. Variability in bone geometry at the narrow neck of the femur is best explained by body size and pubertal maturation. After controlling for these covariates there were no differences in bone geometry between ethnic groups. Published by Elsevier Inc.

  2. Physical Activity in High School during "Free-Time" Periods

    ERIC Educational Resources Information Center

    Silva, Pedro; Sousa, Michael; Sá, Carla; Ribeiro, José; Mota, Jorge

    2015-01-01

    The purpose of this study was to examine youth physical activity (PA) in free-time periods during high school days and their contribution to total PA. Differences in terms of sex, age, body mass index and school level were assessed in a sample of Portuguese adolescents. Participants totalled 213 (135 girls), aged 14.6 ± 1.7, from two different…

  3. Relationship between smartphone addiction and physical activity in Chinese international students in Korea

    PubMed Central

    Kim, Sung-Eun; Kim, Jin-Woo; Jee, Yong-Seok

    2015-01-01

    Background and Aims Excessive usage of smartphones may induce social problems, such as depression and impairment of social and emotional functioning. Moreover, its usage can impede physical activity, but the relationship between smartphone addiction and physical activity is obscure. Therefore, we examined the relationship and the impact of excessive smartphone use on physical activity. Methods This study collected data through the structured questionnaire consisting of general characteristics, the number and hours of smartphone usage, and the Smartphone Addiction Proneness Scale (SAPS) from 110 Chinese international students in Korea. The body composition and physical activity, such as the total daily number of steps and consumed calories, were measured. Results In this study, high-risk smartphone users showed less physical activity, such as the total number of steps taken and the average consumed calories per day. Moreover, their body composition, such as muscle mass and fat mass, was significantly different. Among these factors, the hours of smartphone use revealed the proportional relationship with smartphone addiction (β = 0.209, p = 0.026), while the average number of walking steps per day showed a significant reverse proportional tendency in participants with smartphone addiction (β = –0.883, p < 0.001). Conclusions Participants with smartphone addiction were less likely to walk for each day. Namely, smartphone addiction may negatively influence physical health by reducing the amount of physical activity, such as walking, resulting in an increase of fat mass and a decrease of muscle mass associated with adverse health consequences. PMID:26551911

  4. Relationship between smartphone addiction and physical activity in Chinese international students in Korea.

    PubMed

    Kim, Sung-Eun; Kim, Jin-Woo; Jee, Yong-Seok

    2015-09-01

    Excessive usage of smartphones may induce social problems, such as depression and impairment of social and emotional functioning. Moreover, its usage can impede physical activity, but the relationship between smartphone addiction and physical activity is obscure. Therefore, we examined the relationship and the impact of excessive smartphone use on physical activity. This study collected data through the structured questionnaire consisting of general characteristics, the number and hours of smartphone usage, and the Smartphone Addiction Proneness Scale (SAPS) from 110 Chinese international students in Korea. The body composition and physical activity, such as the total daily number of steps and consumed calories, were measured. In this study, high-risk smartphone users showed less physical activity, such as the total number of steps taken and the average consumed calories per day. Moreover, their body composition, such as muscle mass and fat mass, was significantly different. Among these factors, the hours of smartphone use revealed the proportional relationship with smartphone addiction (β = 0.209, p = 0.026), while the average number of walking steps per day showed a significant reverse proportional tendency in participants with smartphone addiction (β = -0.883, p < 0.001). Participants with smartphone addiction were less likely to walk for each day. Namely, smartphone addiction may negatively influence physical health by reducing the amount of physical activity, such as walking, resulting in an increase of fat mass and a decrease of muscle mass associated with adverse health consequences.

  5. Physical activity modifies the association between dietary protein and lean mass of postmenopausal women

    PubMed Central

    Martinez, Jessica A.; Wertheim, Betsy C.; Thomson, Cynthia A.; Bea, Jennifer W.; Wallace, Robert; Allison, Matthew; Snetselaa, Linda; Chen, Zhao; Nassir, Rami; Thompson, Patricia A.

    2016-01-01

    Background Maintenance of lean muscle mass and related strength is associated with lower risk for numerous chronic diseases of aging in women. Objective To evaluate whether the association between dietary protein and lean mass differs by physical activity level, amino acid composition, and body mass index categories. Design Cross-sectional analysis of a prospective cohort. Participants/setting Postmenopausal women from the Women’s Health Initiative with body composition measurements by dual-energy X-ray absorptiometry (n=8,298). Main outcome measures Percent lean mass, percent fat mass and lean body mass index. Statistical analyses performed Linear regression models adjusted for scanner serial number, age, calibrated energy intake, race/ethnicity, neighborhood socioeconomic status, and recreational physical activity were used to determine the relationship between protein intake and body composition measures. Likelihood ratio tests and stratified analysis were used to investigate physical activity and body mass index as potential effect modifiers. Results Biomarker-calibrated protein intake was positively associated with percent lean mass; women in the highest protein quintile had 6.3 percentage points higher lean mass than the lowest quintile (P < 0.001). This difference rose to 8.5 percentage points for physically active women in the highest protein quintile (Pinteraction = 0.023). Percent fat mass and lean body mass index were both inversely related to protein intake (both P < 0.001). Physical activity further reduced percent fat mass (Pinteraction = 0.022) and lean body mass index (Pinteraction = 0.011). Leucine intake was associated with lean mass, as were branched chain amino acids combined (both P < 0.001), but not independent of total protein. All associations were observed for normal-weight, overweight, and obese women. Conclusions Protein consumption up to 2.02 g/kg body weight daily is positively associated with lean mass in postmenopausal women. Importantly, those that also engage in physical activity have the highest lean mass across body mass index categories. PMID:27914915

  6. Physical Activity Modifies the Association between Dietary Protein and Lean Mass of Postmenopausal Women.

    PubMed

    Martinez, Jessica A; Wertheim, Betsy C; Thomson, Cynthia A; Bea, Jennifer W; Wallace, Robert; Allison, Matthew; Snetselaar, Linda; Chen, Zhao; Nassir, Rami; Thompson, Patricia A

    2017-02-01

    Maintenance of lean muscle mass and related strength is associated with lower risk for numerous chronic diseases of aging in women. Our aim was to evaluate whether the association between dietary protein and lean mass differs by physical activity level, amino acid composition, and body mass index categories. We performed a cross-sectional analysis of a prospective cohort. Participants were postmenopausal women from the Women's Health Initiative with body composition measurements by dual-energy x-ray absorptiometry (n=8,298). Our study measured percent lean mass, percent fat mass, and lean body mass index. Linear regression models adjusted for scanner serial number, age, calibrated energy intake, race/ethnicity, neighborhood socioeconomic status, and recreational physical activity were used to determine the relationship between protein intake and body composition measures. Likelihood ratio tests and stratified analysis were used to investigate physical activity and body mass index as potential effect modifiers. Biomarker-calibrated protein intake was positively associated with percent lean mass; women in the highest protein quintile had 6.3 percentage points higher lean mass than the lowest quintile (P<0.001). This difference rose to 8.5 percentage points for physically active women in the highest protein quintile (P interaction =0.023). Percent fat mass and lean body mass index were both inversely related to protein intake (both P<0.001). Physical activity further reduced percent fat mass (P interaction =0.022) and lean body mass index (P interaction =0.011). Leucine intake was associated with lean mass, as were branched chain amino acids combined (both P<0.001), but not independent of total protein. All associations were observed for normal-weight, overweight, and obese women. Protein consumption up to 2.02 g/kg body weight daily is positively associated with lean mass in postmenopausal women. Importantly, those that also engage in physical activity have the highest lean mass across body mass index categories. Copyright © 2017 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

  7. An on-line high-performance liquid chromatography-diode-array detector-electrospray ionization-ion-trap-time-of-flight-mass spectrometry-total antioxidant capacity detection system applying two antioxidant methods for activity evaluation of the edible flowers from Prunus mume.

    PubMed

    Zhang, Xiaoxia; Lin, Zongtao; Fang, Jinggui; Liu, Meixian; Niu, Yanyan; Chen, Shizhong; Wang, Hong

    2015-10-02

    An on-line high-performance liquid chromatography-diode-array detector-electrospray ionization-ion-trap-time-of-flight-mass spectrometry-total antioxidant capacity detection (HPLC-DAD-ESI-IT-TOF-MS-TACD) system was created for identification and evaluation of antioxidants in Prunus (P.) mume flowers. Applying this system, the HPLC fingerprint, ultraviolet (UV) spectra, mass fragmentations, active profiles against 1,1-diphenylpicryl-2-hydrazyl radical (DPPH•) scavenging activity and ferric reducing antioxidant power (FRAP) of each complex sample were obtained simultaneously after one injection. Synchronous structure identification and activities screening of complex samples were thus accomplished. In this study, 78 compounds were identified from P. mume flowers by their chromatographic behaviors, UV spectra and MS data with the assistance of standard compounds and literature reports. The DPPH and FRAP activity of 24 samples (23 different P. mume varieties and 1 related herbal medicine) were then quantified by their detailed activity profiles from the on-line system, and by the total activity of each sample extract from off-line 96-well plate method. As a result, 21 and 32 compounds in the on-line system showed anti-oxidative effects against DPPH and FRAP, respectively. The established on-line system is efficient, sensitive and reliable to tell the DPPH and FRAP antioxidant activities of individual compound in complex samples, and therefore would be a useful and promising technique for antioxidant screening from different food and medicinal matrices. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. LC/ESI-MS/MS profiling of Ulmus parvifolia extracts and evaluation of its anti-inflammatory, cytotoxic, and antioxidant activities.

    PubMed

    Mina, Suzan A; Melek, Farouk R; Adeeb, Rania M; Hagag, Eman G

    2016-11-01

    In this study, a comparative liquid chromatography/mass spectroscopy (LC/ESI-MS/MS) profiling of different fractions of Ulmus parvifolia leaves and stems was performed. Identification of compounds was based on comparing the mass spectrometric information obtained including m/z values and individual compound fragmentation pattern to tandem mass spectral library search and literature data. Eleven compounds were tentatively identified in the different analyzed fractions. One of the major constituents of this plant was isolated and identified as Icariside E4 [dihydro-dehydro-diconiferyl alcohol-4-O-α-L-rhamnopyranoside] (5). The evaluation of anti-inflammatory activity of the total methanolic extract using nitric oxide inhibition on LPS-stimulated RAW 264.7 cells model strong anti-inflammatory activity with 17.5% inhibition of nitric oxide production versus 10% inhibition for dexamethasone. The cytotoxic activity of the methanolic extract and Icariside E4 was evaluated against four types of human cell lines using MTT assay. Icariside E4 showed cytotoxic effect against Hep-G2, MCF-7, and CACO-2 cell lines compared to a negligible activity for the total extract. The same extract showed a moderate antioxidant activity with SC50=362.5 μg/mL.

  9. The role of physical activity, body mass index and maturity status in body-related perceptions and self-esteem of adolescents.

    PubMed

    Altıntaş, A; Aşçı, F H; Kin-İşler, A; Güven-Karahan, B; Kelecek, S; Özkan, A; Yılmaz, A; Kara, F M

    2014-01-01

    Adolescence represents a transitional period which is marked by physical, social and psychological changes. Changes in body shape and physical activity especially alter and shape the psychological well-being of adolescents. The purpose of this study was to determine the role of physical activity level, body mass index and maturity status in body-related perception and self-esteem of 11-18 years old adolescents. A total of 1012 adolescents participated in this study. The "Social Physique Anxiety Scale", "Body Image Satisfaction Scale", "Physical Self-Perception Profile for Children" and "Rosenberg Self-Esteem Inventory" were administered. Physical activity level and body mass index were assessed using the "Physical Activity Questionnaire" and "Bioelectrical Impedance Analyzer", respectively. Regression analysis indicated that body mass index was the only predictor of perceived body attractiveness, social physique anxiety, body image satisfaction and self-esteem for female adolescents. For male adolescents, both physical activity and body mass index were correlated with perceived body attractiveness and social physique anxiety. Pubertal status were not correlated with self-esteem and body-related perceptions for both males and females adolescents. In summary, body mass index and physical activity plays an important role in body-related perceptions and self-esteem of adolescents.

  10. Adiposity and TV viewing are related to less bone accrual in young children

    PubMed Central

    Wosje, Karen S.; Khoury, Philip R.; Claytor, Randal P.; Copeland, Kristen A.; Kalkwarf, Heidi J.; Daniels, Stephen R.

    2008-01-01

    Objective To examine the relation between baseline fat mass and gain in bone area and bone mass in preschoolers studied prospectively for 4 y, with a focus on the role of physical activity and TV viewing. Study design Children were part of a longitudinal study in which measures of fat, lean and bone mass, height, weight, activity, and diet were taken every 4 months from ages 3 to 7 y. Activity was measured by accelerometer, and TV viewing by parent checklist. We included 214 children with total body dual energy x-ray absorptiometry (Hologic 4500A) scans at ages 3.5 and 7 y. Results Higher baseline fat mass was associated with smaller increases in bone area and bone mass over the next 3.5 y (p<0.001). More TV viewing was related to smaller gains in bone area and bone mass accounting for race, sex, and height. Activity by accelerometer was not associated with bone gains. Conclusions Adiposity and TV viewing are related to less bone accrual in preschoolers. PMID:18692201

  11. Diversity of activity participation determines bone mineral content in the lower limbs of pre-pubertal children with developmental coordination disorder.

    PubMed

    Fong, S S M; Vackova, D; Choi, A W M; Cheng, Y T Y; Yam, T T T; Guo, X

    2018-04-01

    This study examined the relationships between activity participation and bone mineralization in children with developmental coordination disorder. Limited participation in physical, recreational, social, and skill-based and self-improvement activities contributed to lower bone mineral content. For improved bone health, these children should participate in a variety of activities, not only physical activities. Limited activity participation in children with developmental coordination disorder (DCD) may have a negative impact on bone mineral accrual. The objectives of this study were to compare bone mineralization and activity participation patterns of pre-pubertal children with DCD and those with typical development, and to determine the association between activity participation patterns and bone mineralization in children with DCD. Fifty-two children with DCD (mean age = 7.51 years) and 61 children with typical development (mean age = 7.22 years) participated in the study. Appendicular and total body (less head) bone mineral content (BMC) and bone mineral density (BMD) were evaluated by a whole-body dual-energy X-ray absorptiometry scan. Activity participation patterns were assessed using the Children's Assessment of Participation and Enjoyment (CAPE) questionnaire. Children with DCD had lower appendicular and total body BMCs and BMDs than children with typical development overall (p < 0.05). They also had lower CAPE total activity and physical activity diversity scores (p < 0.05). After accounting for the effects of age, sex, height, lean mass, and fat mass, the total activity diversity score remained independently associated with leg BMC in children with DCD, explaining 5.1% of the variance (p = 0.030). However, the physical activity diversity score was no longer associated with leg BMC (p = 0.090). Diversity of activity participation and bone mineralization were lower in pre-pubertal children with DCD. Decreased total activity participation diversity was a contributing factor to lower BMC in the legs of children with DCD.

  12. MASSIVE GALAXIES IN COSMOS: EVOLUTION OF BLACK HOLE VERSUS BULGE MASS BUT NOT VERSUS TOTAL STELLAR MASS OVER THE LAST 9 Gyr?

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Jahnke, Knud; Cisternas, Mauricio; Inskip, Katherine

    2009-12-01

    We constrain the ratio of black hole (BH) mass to total stellar mass of type-1 active galactic nuclei (AGNs) in the COSMOS survey at 1 < z < 2. For 10 AGNs at mean redshift z approx 1.4 with both Hubble Space Telescope (HST)/ACS and HST/NICMOS imaging data, we are able to compute the total stellar mass M {sub *,total}, based on rest-frame UV-to-optical host galaxy colors which constrain mass-to-light ratios. All objects have virial M {sub BH} estimates available from the COSMOS Magellan/IMACS and zCOSMOS surveys. We find within errors zero difference between the M {sub BH}-M {sub *,total}more » relation at z approx 1.4 and the M {sub BH}-M {sub *,bulge} relation in the local universe. Our interpretation is (1) if our objects were purely bulge-dominated, the M {sub BH}-M {sub *,bulge} relation has not evolved since z approx 1.4. However, (2) since we have evidence for substantial disk components, the bulges of massive galaxies (M {sub *,total} = 11.1 +- 0.3 or log M {sub BH} approx 8.3 +- 0.2) must have grown over the last 9 Gyr predominantly by redistribution of the disk into the bulge mass. Since all necessary stellar mass exists in galaxies at z = 1.4, no star formation or addition of external stellar material is required, but only a redistribution, e.g., induced by minor and major merging or through disk instabilities. Merging, in addition to redistributing mass in the galaxy, will add both BH and stellar/bulge mass, but does not change the overall final M {sub BH}/M {sub *,bulge} ratio. Since the overall cosmic stellar and BH mass buildup trace each other tightly over time, our scenario of bulge formation in massive galaxies is independent of any strong BH feedback and means that the mechanism coupling BH and bulge mass until the present is very indirect.« less

  13. Leisure-time physical activity at moderate and high intensity is associated with parameters of body composition, muscle strength and sarcopenia in aged adults with obesity and metabolic syndrome from the PREDIMED-Plus study.

    PubMed

    Rosique-Esteban, Nuria; Babio, Nancy; Díaz-López, Andrés; Romaguera, Dora; Alfredo Martínez, J; Sanchez, Vicente Martin; Schröder, Helmut; Estruch, Ramón; Vidal, Josep; Buil-Cosiales, Pilar; Konieczna, Jadwiga; Abete, Itziar; Salas-Salvadó, Jordi

    2018-06-06

    We aimed to examine the associations of leisure-time physical activity (PA) and sedentary behavior (SB) with the prevalence of sarcopenia, body composition and muscle strength among older adults having overweight/obesity and metabolic syndrome, from the PREDIMED-Plus trial. Cross-sectional baseline analysis including 1539 men and women (65 ± 5 y). Sarcopenia was defined as low muscle mass (according to FNIH cut-offs) plus low muscle strength (lowest sex-specific tertile for 30-s chair-stand test). We applied multivariable-adjusted Cox regression with robust variance and constant time (given the cross-sectional design) for the associations of self-reported leisure-time PA and SB with sarcopenia; and multivariable-linear regression for the associations with dual-energy X-ray absorptiometry (DXA)-derived bone mass, fat mass, lean mass and lower-limb muscle strength. Inverse associations were observed between sarcopenia and each hourly increment in total [prevalence ratio 0.81 (95% confidence interval, 0.70, 0.93)], moderate [0.80 (0.66, 0.97)], vigorous [0.51 (0.32, 0.84)], and moderate-vigorous PA (MVPA) [0.74 (0.62, 0.89)]. Incrementing 1-h/day total-PA and MVPA was inversely associated with body-mass-index, waist circumference (WC), fat mass, and positively associated with bone mass and lower-limb muscle strength (all P <.05). One h/day increase in total SB, screen-based SB and TV-viewing was positively associated with body-mass-index, WC and fat mass. Light-PA was not significantly associated with any outcome. Total-PA and PA at moderate and high intensities may protect against the prevalence of sarcopenia, have a beneficial role on body composition and prevent loss of muscle strength. SB, particularly TV-viewing, may have detrimental effects on body composition in older adults at high cardiovascular risk. Copyright © 2018 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism. All rights reserved.

  14. Obesity classification in military personnel: A comparison of body fat, waist circumference, and body mass index measurements

    USDA-ARS?s Scientific Manuscript database

    The purpose of this study was to evaluate obesity classifications from body fat percentage (BF%), body mass index (BMI), and waist circumference (WC). A total of 451 overweight/obese active duty military personnel completed all three assessments. Most were obese (men, 81%; women, 98%) using National...

  15. Characterization of Total and Size-Fractionated Manganese Exposure by Work Area in a Shipbuilding Yard.

    PubMed

    Jeong, Jee Yeon; Park, Jong Su; Kim, Pan Gyi

    2016-06-01

    Shipbuilding involves intensive welding activities, and welders are exposed to a variety of metal fumes, including manganese, that may be associated with neurological impairments. This study aimed to characterize total and size-fractionated manganese exposure resulting from welding operations in shipbuilding work areas. In this study, we characterized manganese-containing particulates with an emphasis on total mass (n = 86, closed-face 37-mm cassette samplers) and particle size-selective mass concentrations (n = 86, 8-stage cascade impactor samplers), particle size distributions, and a comparison of exposure levels determined using personal cassette and impactor samplers. Our results suggest that 67.4% of all samples were above the current American Conference of Governmental Industrial Hygienists manganese threshold limit value of 100 μg/m(3) as inhalable mass. Furthermore, most of the particles containing manganese in the welding process were of the size of respirable particulates, and 90.7% of all samples exceeded the American Conference of Governmental Industrial Hygienists threshold limit value of 20 μg/m(3) for respirable manganese. The concentrations measured with the two sampler types (cassette: total mass; impactor: inhalable mass) were significantly correlated (r = 0.964, p < 0.001), but the total concentration obtained using cassette samplers was lower than the inhalable concentration of impactor samplers.

  16. Long-term anabolic effects of prostaglandin-E2 on tibial diaphyseal bone in male rats

    NASA Technical Reports Server (NTRS)

    Jee, Webster S. S.; Ke, Hua Zhu; Li, Xiao Jian

    1991-01-01

    The effects of long-term prostaglandin E2 (PGE2) on tibial diaphyseal bone were studied in 7-month-old male Sprague-Dawley rats given daily subcutaneous injections of 0, 1, 3 and 6 mg PGE2/kg/day for 60, 120 and 180 days. The tibial shaft was measured by single photon absorptiometry and dynamic histomorphometric analyses were performed on double-fluorescent labeled undecalcified tibial diaphyseal bone samples. Exogenous PGE2 administration produced the following transient changes in a dose-response manner between zero and 60 days: (1) increased bone width and mineral density; (2) increased total tissue and total bone areas; (3) decreased marrow area; (4) increased periosteal and corticoendosteal lamellar bone formation; (5) activated corticoendosteal lamellar and woven trabecular bone formation; and (6) activated intracortical bone remodeling. A new steady-state of increased tibial diaphyseal bone mass and elevated bone activities were observed from day 60 onward. The elevated bone mass level attained after 60 days of PGE2 treatment was maintained at 120 and 180 days. These observations indicate that the powerful anabolic effects of PGE2 will increase both periosteal and corticoendosteal bone mass and sustain the transient increase in bone mass with continuous daily administration of PGE2.

  17. Physical Activity and Adiposity Markers at Older Ages: Accelerometer Vs Questionnaire Data

    PubMed Central

    Sabia, Séverine; Cogranne, Pol; van Hees, Vincent T.; Bell, Joshua A.; Elbaz, Alexis; Kivimaki, Mika; Singh-Manoux, Archana

    2015-01-01

    Objective Physical activity is critically important for successful aging, but its effect on adiposity markers at older ages is unclear as much of the evidence comes from self-reported data on physical activity. We assessed the associations of questionnaire-assessed and accelerometer-assessed physical activity with adiposity markers in older adults. Design/Setting/Participants This was a cross-sectional study on 3940 participants (age range 60-83 years) of the Whitehall II study who completed a 20-item physical activity questionnaire and wore a wrist-mounted accelerometer for 9 days in 2012 and 2013. Measurements Total physical activity was estimated using metabolic equivalent hours/week for the questionnaire and mean acceleration for the accelerometer. Time spent in moderate-and-vigorous physical activity (MVPA) was also assessed by questionnaire and accelerometer. Adiposity assessment included body mass index, waist circumference, and fat mass index. Fat mass index was calculated as fat mass/height² (kg/m²), with fat mass estimated using bioimpedance. Results Greater total physical activity was associated with lower adiposity for all adiposity markers in a dose-response manner. In men, the strength of this association was 2.4 to 2.8 times stronger with the accelerometer than with questionnaire data. In women, it was 1.9 to 2.3 times stronger. For MVPA, questionnaire data in men suggested no further benefit for adiposity markers past 1 hour/week of activity. This was not the case for accelerometer-assessed MVPA where, for example, compared with men undertaking <1 hour/week of accelerometer-assessed MVPA, waist circumference was 3.06 (95% confidence interval 2.06–4.06) cm lower in those performing MVPA 1–2.5 hours/week, 4.69 (3.47–5.91) cm lower in those undertaking 2.5–4 hours/week, and 7.11 (5.93–8.29) cm lower in those performing ≥4 hours/week. Conclusions The association of physical activity with adiposity markers in older adults was stronger when physical activity was assessed by accelerometer compared with questionnaire, suggesting that physical activity might be more important for adiposity than previously estimated. PMID:25752539

  18. Contribution of indoor-generated particles to residential exposure

    NASA Astrophysics Data System (ADS)

    Isaxon, C.; Gudmundsson, A.; Nordin, E. Z.; Lönnblad, L.; Dahl, A.; Wieslander, G.; Bohgard, M.; Wierzbicka, A.

    2015-04-01

    The majority of airborne particles in residences, when expressed as number concentrations, are generated by the residents themselves, through combustion/thermal related activities. These particles have a considerably smaller diameter than 2.5 μm and, due to the combination of their small size, chemical composition (e.g. soot) and intermittently very high concentrations, should be regarded as having potential to cause adverse health effects. In this study, time resolved airborne particle measurements were conducted for seven consecutive days in 22 randomly selected homes in the urban area of Lund in southern Sweden. The main purpose of the study was to analyze the influence of human activities on the concentration of particles in indoor air. Focus was on number concentrations of particles with diameters <300 nm generated by indoor activities, and how these contribute to the integrated daily residential exposure. Correlations between these particles and soot mass concentration in total dust were also investigated. It was found that candle burning and activities related to cooking (using a frying pan, oven, toaster, and their combinations) were the major particle sources. The frequency of occurrence of a given concentration indoors and outdoors was compared for ultrafine particles. Indoor data was sorted into non-occupancy and occupancy time, and the occupancy time was further divided into non-activity and activity influenced time. It was found that high levels (above 104 cm-3) indoors mainly occur during active periods of occupancy, while the concentration during non-activity influenced time differs very little from non-occupancy time. Total integrated daily residential exposure of ultrafine particles was calculated for 22 homes, the contribution from known activities was 66%, from unknown activities 20%, and from background/non-activity 14%. The collected data also allowed for estimates of particle source strengths for specific activities, and for some activities it was possible to estimate correlations between the number concentration of ultrafine particles and the mass concentration of soot in total dust in 10 homes. Particle source strengths (for 7 specific activities) ranged from 1.6·1012 to 4.5·1012 min-1. The correlation between ultrafine particles and mass concentration of soot in total dust varied between 0.37 and 0.85, with an average of 0.56 (Pearson correlation coefficient). This study clearly shows that due to the importance of indoor sources, residential exposure to ultrafine particles cannot be characterized by ambient measurements alone.

  19. "Bounce at the Bell": a novel program of short bouts of exercise improves proximal femur bone mass in early pubertal children

    PubMed Central

    McKay, H; MacLean, L; Petit, M; MacKelvie-O'Brien, K; Janssen, P; Beck, T; Khan, K

    2005-01-01

    Objectives: To examine the effects of a simple and inexpensive physical activity intervention on change in bone mass and structure in school aged children. Methods: Fifty one children (n = 23 boys and 28 girls; mean age 10.1 years) participated in "Bounce at the Bell" which consisted of 10 counter-movement jumps 3x per day (total ∼3 min/day). Controls were 71 matched children who followed usual school practice. We assessed dietary calcium, physical activity, physical performance, and anthropometry in September and after 8 months of intervention (June). We measured bone mineral content (BMC) and bone area at the lumbar spine, total body, and proximal femur. Proximal femur scans were also analysed for bone geometry and structural strength using the hip structural analysis program. Lean and fat mass (g) were also calculated. Results: Groups were similar at baseline and did not differ in weight, height, total body, lumbar spine, proximal femur, or femoral neck BMC. Control children had a greater increase in adjusted total body BMC (1.4%). Intervention children gained significantly more BMC at the total proximal femur (2%) and the intertrochanteric region (27%). Change in bone structural parameters did not differ between groups. Conclusions: This novel, easily implemented exercise program, took only a few minutes each day and enhanced bone mass at the weight bearing proximal femur in early pubertal children. A large, randomised study of boys and girls should be undertaken powered to test the effectiveness of Bounce at the Bell in children at different stages of maturity, and in boys and girls independently. PMID:16046335

  20. Segregation analysis of abdominal visceral fat: the HERITAGE Family Study.

    PubMed

    Rice, T; Després, J P; Pérusse, L; Gagnon, J; Leon, A S; Skinner, J S; Wilmore, J H; Rao, D C; Bouchard, C

    1997-09-01

    A major gene hypothesis for abdominal visceral fat (AVF) level, both before and after adjustment for total body fat mass, was investigated in 86 white families who participated in the HERITAGE Family Study. In this study, sedentary families were tested for a battery of measures (baseline), endurance exercise trained for 20 weeks, and then remeasured again. The baseline measures reported here are unique in that the variance due to a potentially important environmental factor (activity level) was limited. AVF area was assessed at L4 to L5 by the use of computerized tomography scan, and total body fat mass was assessed with underwater weighing. For fat mass, a putative locus accounted for 64% of the variance, but there was no evidence of a multifactorial component (i.e., no polygenic and/or common familial environmental effects). For AVF area, both a major gene effect accounting for 54% of the variance and a multifactorial component accounting for 17% of the variance were significant. However, after AVF area was adjusted for the effects of total level of body fat, the support for a major gene was reduced. In particular, there was a major effect for fat mass-adjusted AVF area, but it was not transmitted from parents to offspring (i.e., the three transmission probabilities were equal). The importance of this study is twofold. First, these results confirm a previous study that suggested that there is a putative major locus for AVF and for total body fat mass. Second, the findings from the HERITAGE Family Study suggest that the factors underlying AVF area in sedentary families may be similar to those in the population at large, which includes both sedentary and active families. Whether the gene(s) responsible for the high levels of AVF area is the same as that which influences total body fat content remains to be further investigated.

  1. Association of enjoyable leisure activities with psychological and physical well-being.

    PubMed

    Pressman, Sarah D; Matthews, Karen A; Cohen, Sheldon; Martire, Lynn M; Scheier, Michael; Baum, Andrew; Schulz, Richard

    2009-09-01

    To examine whether engaging in multiple enjoyable activities was associated with better psychological and physiological functioning. Few studies have examined the health benefits of the enjoyable activities that individuals participate in voluntarily in their free time. Participants from four different studies (n = 1399 total, 74% female, age = 19-89 years) completed a self-report measure (Pittsburgh Enjoyable Activities Test (PEAT)) assessing their participation in ten different types of leisure activities as well as measures assessing positive and negative psychosocial states. Resting blood pressure, cortisol (over 2 days), body mass index, waist circumference, and perceived physiological functioning were assessed. Higher PEAT scores were associated with lower blood pressure, total cortisol, waist circumference, and body mass index, and perceptions of better physical function. These associations withstood controlling for demographic measures. The PEAT was correlated with higher levels of positive psychosocial states and lower levels of depression and negative affect. Enjoyable leisure activities, taken in the aggregate, are associated with psychosocial and physical measures relevant for health and well-being. Future studies should determine the extent that these behaviors in the aggregate are useful predictors of disease and other health outcomes.

  2. Simultaneous quantification of 25 active constituents in the total flavonoids extract from Herba Desmodii Styracifolii by high-performance liquid chromatography with electrospray ionization tandem mass spectrometry.

    PubMed

    Guo, Panpan; Yan, Wenying; Han, Qingjie; Wang, Chunying; Zhang, Zijian

    2015-04-01

    A sensitive and selective high-performance liquid chromatography coupled with electrospray ionization tandem mass spectrometry method has been developed and validated for the simultaneous determination of 25 active constituents, including 21 flavonoids and four phenolic acids in the total flavonoids extract from Herba Desmodii Styracifolii for the first time. Among the 25 compounds, seven compounds including caffeic acid, acacetin, genistein, genistin, diosmetin, diosmin and hesperidin were identified and quantified for the first time in Herba Desmodii Styracifolii. Chromatographic separation was accomplished on a ZORBAX SB-C18 (250 mm×4.6 mm, 5.0 μm) column using gradient elution of methanol and 0.1‰ acetic acid v/v at a flow rate of 1.0 mL/min. The identification and quantification of the analytes were achieved using negative electrospray ionization mass spectrometry in multiple-reaction monitoring mode. The method was fully validated in terms of limits of detection and quantification, linearity, precision and accuracy. The results indicated that the developed method is simple, rapid, specific and reliable. Furthermore, the developed method was successfully applied to quantify the 25 active components in six batches of total flavonoids extract from Herba Desmodii Styracifolii. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. The beneficial effects of aerobic and concurrent training on metabolic profile and body composition after detraining: a 1-year follow-up in postmenopausal women.

    PubMed

    Rossi, F E; Diniz, T A; Neves, L M; Fortaleza, A C S; Gerosa-Neto, J; Inoue, D S; Buonani, C; Cholewa, J M; Lira, F S; Freitas, I F

    2017-05-01

    Aerobic and concurrent training (CT, aerobic and strength training) improves body composition and metabolic profile; however, it is not known whether these positive outcomes acquired after aerobic or CT are maintained long term (⩾6 months) after program interruption in postmenopausal women. This study investigated the changes in total and appendicular body composition, bone mineral density and metabolic profile following 16 weeks of aerobic or CT, and through 6 months and 1 year of detraining in postmenopausal women. In total, 60 postmenopausal women were divided into the following groups: aerobic (AT), aerobic plus strength training (CT) and control group (CG), and 31 participants were assessed for the 1 year follow-up. Body composition and bone mineral density were evaluated by dual-energy X-ray absorptiometry (DXA), and total cholesterol, high-density lipoprotein cholesterol, low-density lipoprotein cholesterol, triacylglycerol, glucose, insulin, leptin, adiponectin and plasminogen activator inhibitor-1 (PAI-1) were assessed. There were main effects of time for arm fat mass, arm lean mass and trunk lean mass (P<0.05). There was a statistical difference between AT and CG for leg fat mass and percentage of fat (P<0.05). After 6 months of detraining, leg lean mass decreased in relation to post-intervention, and there was a statistically significant interaction for total and appendicular lean mass (P<0.05). There were differences between CT and CG in glucose and between AT and CG in glucose and triacylglycerol (P<0.05). A duration of 16 weeks of aerobic or CT improved total and appendicular body composition and metabolic profile but after 6 months of detraining, leg lean mass returned to the values obtained pre-training in CT.

  4. Berries grown in Brazil: anthocyanin profiles and biological properties.

    PubMed

    Chaves, Vitor C; Boff, Laurita; Vizzotto, Márcia; Calvete, Eunice; Reginatto, Flávio H; Simões, Cláudia Mo

    2018-02-11

    Phytochemical profiles of two Brazilian native fruits - pitanga (red and purple) and araçá (yellow and red) - as well as strawberry cultivars Albion, Aromas and Camarosa, blackberry cultivar Tupy and blueberry cultivar Bluegen cultivated in Brazil were characterized for total phenolic content and total anthocyanin content by liquid chromatography coupled to a photodiode array and a quadrupole time-of-flight mass spectrometer. Radical scavenging, antiherpes and cytotoxic activities of these berry extracts were also evaluated. Blueberry presented the highest total anthocyanin content (1202 mg cyanidin-O-glucoside equivalents kg -1 fresh fruit), while strawberry cultivar Aromas presented the highest total phenolic content (13 550 mg gallic acid equivalents kg -1 fresh fruit). Liquid chromatographic-mass spectrometric analysis resulted in the identification of 21 anthocyanins. To the best of our knowledge this is the first report of cyanidin-O-glucoside in yellow and red Araçá fruit and the first time eight anthocyanins have been reported in pitanga fruits. DPPH and ABTS assays showed that blueberry cultivar Bluegen, blackberry cultivar Tupy and pitanga (red and purple) showed the most promising antiradical activities, respectively. No relevant cytotoxicity against three cancer cell lines or antiherpes activity was detected under the experimental conditions tested. Total anthocyanin content of all fruits had a strong positive correlation with their free radical scavenging activity, suggesting anthocyanins contribute to the antioxidant potential of these fruits. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  5. Activity energy expenditure and change in body composition in late life123

    PubMed Central

    Everhart, James E; Anton, Stephen D; Schoeller, Dale A; Cummings, Steve R; Mackey, Dawn C; Delmonico, Matthew J; Bauer, Douglas C; Simonsick, Eleanor M; Colbert, Lisa H; Visser, Marjolein; Tylavsky, Frances; Newman, Anne B; Harris, Tamara B

    2009-01-01

    Background: Change in body composition, specifically loss of fat-free mass and gain in fat mass, in older adults is a major pathway leading to the onset of functional decline and physical disability. Objective: The objective was to determine the association of activity-related energy expenditure with change in body mass and composition among older men and women. Design: Total energy expenditure (TEE) was assessed over 2 wk by using the doubly labeled water method in 302 community-dwelling older adults aged 70–82 y. Resting metabolic rate (RMR) was measured by using indirect calorimetry, and the thermic effect of meals was estimated at 10% of TEE. Activity energy expenditure (AEE) was calculated as [TEE(0.9) − RMR]. Total body mass, fat-free mass (FFM), and fat mass (FM) were assessed by dual-energy X-ray absorptiometry annually over a mean (±SD) of 4.9 ± 1.3 y. Results: In multivariate models adjusted for baseline age, smoking status, and race, men and women had a decline (in kg/y) in body mass (men: −0.34, 95% CI: −0.71, 0.02; women: −0.45, 95% CI: −0.71, −0.19) and FFM (men: −0.48, 95% CI: −0.67, −0.29; women: −0.14, 95% CI: −0.026, −0.03). No changes (in kg/y) were observed in FM (men: 0.14, 95% CI: −0.10, 0.38; women: −0.28, 95% CI: −0.49, −0.07). In men and women, higher AEE at baseline was associated with greater FFM. The average change in these outcomes (ie, slope), however, was similar across tertiles of AEE. Conclusions: These data suggest that accumulated energy expenditure from all physical activities is associated with greater FFM, but the effect does not alter the trajectory of FFM change in late life. PMID:19740971

  6. Effects of Hypergravity and Adrenalectomy on Total Body Bone Mineral Content in Male Rats

    NASA Technical Reports Server (NTRS)

    Girten, Beverly; Moran, Megan; Baer, Lisa; Pruitt, Sean; O'Brien, Cheryl; Arnaud, Sara; Wade, Charles; Bowley, Susan M. (Technical Monitor)

    2000-01-01

    The effects of 14 days of increased gravitational load, and the absence of adrenal stress hormones on total body bone mineral content (BMC) were examined in male Sprague-Dawley rats. Centrifugation at 2 Gs (2G) was used to increase the gravitational load, and bilateral adrenalectomy (ADX) was used to eliminate the production of adrenal stress hormones. Stationary groups at 1 G (1G) and sham operated (SHAM) animals served as controls. Thirty rats (n=6 or 8) made up the four experimental groups (1G SHAM, 1G ADX, 2G SHAM and 2G ADX). BMC was assessed by dual energy X-ray absorptiometry (DXA) and activity was determined through biotelemetry. Body mass and food intake were also measured. Multi-factorial analysis of variance (MANCOVA) and Newman Keuls post hoc tests were used to analyze significant effects (p less than 0.05) for the primary variables. Results indicated that BMC decreased significantly with increased G for both the SHAM and ADX groups. The BMC for the 1 G ADX group was also significantly lower than the 1G SHAM group, however the 2G SHAM and ADX groups were not significantly different. There was a significant decrease in body mass with increased G and there was no ADX effect on body mass. When BMC was normalized for body mass changes, there were no significant group differences. Activity level decreased with body mass, and food intake data showed there was significant hypophagia during the first few days of centrifugation. These results suggest that the decrease in total body BMC seen with hypergravity may be based to a large extent on the differences in body mass induced by the 2 G load.

  7. Relationship between fundamental motor skills and physical activity in 4-year-old preschool children.

    PubMed

    Iivonen, K S; Sääkslahti, A K; Mehtälä, A; Villberg, J J; Tammelin, T H; Kulmala, J S; Poskiparta, M

    2013-10-01

    This study evaluated the relationships between objectively measured physical activity and fundamental motor skills in 4-year-old children. Physical activity was monitored in 20 girls and 17 boys over 5 consecutive days (3 days at preschool and 2 days at home) and their fundamental motor skills measured. Multiple linear regressions controlled for sex, age, and body mass index indicated that the total skill score was significantly associated with physical activity, explaining 13%, 16%, and 16% of the variance in total, moderate-to-vigorous, and light-to-vigorous physical activity, respectively. Sliding and galloping were significantly associated with moderate-to-vigorous physical activity, and throwing and catching combination was significantly associated with total, moderate-to-vigorous, and light-to-vigorous physical activity. The findings warrant future investigations with larger samples to examine the relationship between locomotor, manipulative skills, and physical activity behaviors.

  8. Physical Activity and BMI: Evidence from the Panel Study of Income Dynamics Child Development Supplement

    ERIC Educational Resources Information Center

    Hohensee, Caroline W.; Nies, Mary A.

    2012-01-01

    Background: This study assessed the association between amount of physical activity and body mass index (BMI) percentile among middle and high school children. Total daily physical activity needs to include both in and out of school physical activity. Methods: A secondary data analysis was performed on 1306 children drawn from the Panel Study of…

  9. Factors associated with objectively measured total sedentary time and screen time in children aged 9-11 years.

    PubMed

    Ferrari, Gerson Luis de Moraes; Pires, Carlos; Solé, Dirceu; Matsudo, Victor; Katzmarzyk, Peter T; Fisberg, Mauro

    2018-01-04

    To identify factors associated with total sedentary time and screen time in children aged 9-11 years. For seven consecutive days, 328 children (51.5% boys) used accelerometers to monitor total sedentary time. Screen time was calculated by the self-reporting method. Individual, family, family environment, and school environment questionnaires were filled out. Body composition was measured using a Tanita scale. The mean sedentary time was 500min/day (boys: 489, girls: 511, p=0.005), and mean screen time was 234min/day (boys: 246, girls: 222, p=0.053). In both genders, factors associated with sedentary time were healthy dietary pattern and moderate-to-vigorous physical activity. In boys, only moderate-to-vigorous physical activity was significant; in girls, the healthy dietary pattern, moderate-to-vigorous physical activity, and transportation to school were significant. As for the screen time, the associated factors were body mass index and healthy dietary pattern (both genders). In boys, the associated factors were body mass index, healthy dietary pattern, and television in the bedroom. In girls, the associated factors were healthy dietary pattern, transportation to school, and physical activity policies or practice at school. Several associated factors were identified in the association between total sedentary time and screen time in children; however, only the healthy dietary pattern was common between sedentary time and screen time. Copyright © 2017. Published by Elsevier Editora Ltda.

  10. Increasing weight-bearing physical activity and calcium-rich foods to promote bone mass gains among 9–11 year old girls: outcomes of the Cal-Girls study

    PubMed Central

    French, Simone A; Story, Mary; Fulkerson, Jayne A; Himes, John H; Hannan, Peter; Neumark-Sztainer, Dianne; Ensrud, Kristine

    2005-01-01

    Background A two-year, community-based, group-randomized trial to promote bone mass gains among 9–11 year-old girls through increased intake of calcium-rich foods and weight-bearing physical activity was evaluated. Methods Following baseline data collection, 30 5th-grade Girl Scout troops were randomized to a two-year behavioral intervention program or to a no-treatment control group. Evaluations were conducted at baseline, one year, and two years. Measures included bone mineral content, density, and area (measured by DXA), dietary calcium intake (24-hour recall), and weight-bearing physical activity (physical activity checklist interview). Mixed-model regression was used to evaluate treatment-related changes in bone mineral content (g) for the total body, lumbar spine (L1-L4), proximal femur, one-third distal radius, and femoral neck. Changes in eating and physical activity behavioral outcomes were examined. Results Although the intervention was implemented with high fidelity, no significant intervention effects were observed for total bone mineral content or any specific bone sites. Significant intervention effects were observed for increases in dietary calcium. No significant intervention effects were observed for increases in weight-bearing physical activity. Conclusion Future research needs to identify the optimal dosage of weight-bearing physical activity and calcium-rich dietary behavior change required to maximize bone mass gains in pre-adolescent and adolescent girls. PMID:16029507

  11. Dietary supplementation with a specific combination of high protein, leucine, and fish oil improves muscle function and daily activity in tumour-bearing cachectic mice

    PubMed Central

    van Norren, K; Kegler, D; Argilés, J M; Luiking, Y; Gorselink, M; Laviano, A; Arts, K; Faber, J; Jansen, H; van der Beek, E M; van Helvoort, A

    2009-01-01

    Cancer cachexia is characterised by metabolic alterations leading to loss of adipose tissue and lean body mass and directly compromises physical performance and the quality of life of cancer patients. In a murine cancer cachectic model, the effects of dietary supplementation with a specific combination of high protein, leucine and fish oil on weight loss, muscle function and physical activity were investigated. Male CD2F1 mice, 6–7 weeks old, were divided into body weight-matched groups: (1) control, (2) tumour-bearing, and (3) tumour-bearing receiving experimental diets. Tumours were induced by s.c. inoculation with murine colon adenocarcinoma (C26) cells. Food intake, body mass, tumour size and 24 h-activity were monitored. Then, 20 days after tumour/vehicle inoculation, the animals were killed and muscle function was tested ex vivo. Tumour-bearing mice showed reduced carcass, muscle and fat mass compared with controls. EDL muscle performance and total daily activity were impaired in the tumour-bearing mice. Addition of single nutrients resulted in no or modest effects. However, supplementation of the diet with the all-in combination of high protein, leucine and fish oil significantly reduced loss of carcass, muscle and fat mass (loss in mass 45, 52 and 65% of TB-con, respectively (P<0.02)) and improved muscle performance (loss of max force reduced to 55–64% of TB-con (P<0.05)). Moreover, total daily activity normalised after intervention with the specific nutritional combination (50% of the reduction in activity of TB-con (P<0.05)). In conclusion, a nutritional combination of high protein, leucine and fish oil reduced cachectic symptoms and improved functional performance in cancer cachectic mice. Comparison of the nutritional combination with its individual modules revealed additive effects of the single components provided. PMID:19259092

  12. Musculoskeletal profile of middle-aged Ving Tsun Chinese martial art practitioners

    PubMed Central

    Fong, Shirley S.M.; Chan, Jessie S.M.; Bae, Young-Hyeon; Yam, Timothy T.T.; Chung, Louisa M.Y.; Ma, Ada W.W.; Kuisma, Raija

    2017-01-01

    Abstract This cross-sectional exploratory study aimed to quantify and compare the axial and appendicular bone mineral density (BMD), muscle mass, and muscle strength of middle-aged practitioners of Ving Tsun (VT; a hard-style Chinese martial art) with those of nonpractitioners. Eighteen VT practitioners (mean age ± standard deviation = 51.8 ± 17.7 years; 12 men and six women) and 36 active controls (mean age ± standard deviation = 58.7 ± 11.0 years; 18 men and 18 women) participated in the study. All participants underwent a 1-day battery of musculoskeletal examinations. The BMD of the total radius, total hip, femoral neck, and lumbar spine was measured using dual-energy X-ray absorptiometry, as was the lean mass of the arm, leg, and trunk. Muscle strength of the upper and lower limbs was assessed using a Jamar dynamometer and an isokinetic dynamometer at 60°/second, respectively. VT-trained participants had a 11.5% higher total radius BMD (P = 0.023), a 17.8% higher leg lean mass (P = 0.014), a 56.4% higher isokinetic body weight-adjusted peak torque of the knee extensors (P < 0.001), a 60.8% higher isokinetic body weight-adjusted peak torque of knee flexors (P < 0.001), and a 31.4% shorter time to reach peak torque in the knee flexors (P = 0.001) than the active controls. No significant differences were found in any of the other musculoskeletal outcomes between the 2 groups (P > 0.05). Middle-aged VT practitioners displayed a higher total radius BMD and leg lean mass and better knee extensor and flexor muscular performances than their healthy active counterparts. Healthcare professionals may consider using this alternative method of training to improve the musculoskeletal health of middle-aged adults. PMID:28121945

  13. Musculoskeletal profile of middle-aged Ving Tsun Chinese martial art practitioners: A cross-sectional study.

    PubMed

    Fong, Shirley S M; Chan, Jessie S M; Bae, Young-Hyeon; Yam, Timothy T T; Chung, Louisa M Y; Ma, Ada W W; Kuisma, Raija

    2017-01-01

    This cross-sectional exploratory study aimed to quantify and compare the axial and appendicular bone mineral density (BMD), muscle mass, and muscle strength of middle-aged practitioners of Ving Tsun (VT; a hard-style Chinese martial art) with those of nonpractitioners.Eighteen VT practitioners (mean age ± standard deviation = 51.8 ± 17.7 years; 12 men and six women) and 36 active controls (mean age ± standard deviation = 58.7 ± 11.0 years; 18 men and 18 women) participated in the study. All participants underwent a 1-day battery of musculoskeletal examinations. The BMD of the total radius, total hip, femoral neck, and lumbar spine was measured using dual-energy X-ray absorptiometry, as was the lean mass of the arm, leg, and trunk. Muscle strength of the upper and lower limbs was assessed using a Jamar dynamometer and an isokinetic dynamometer at 60°/second, respectively.VT-trained participants had a 11.5% higher total radius BMD (P = 0.023), a 17.8% higher leg lean mass (P = 0.014), a 56.4% higher isokinetic body weight-adjusted peak torque of the knee extensors (P < 0.001), a 60.8% higher isokinetic body weight-adjusted peak torque of knee flexors (P < 0.001), and a 31.4% shorter time to reach peak torque in the knee flexors (P = 0.001) than the active controls. No significant differences were found in any of the other musculoskeletal outcomes between the 2 groups (P > 0.05).Middle-aged VT practitioners displayed a higher total radius BMD and leg lean mass and better knee extensor and flexor muscular performances than their healthy active counterparts. Healthcare professionals may consider using this alternative method of training to improve the musculoskeletal health of middle-aged adults.

  14. Correlation between species-specific metabolite profiles and bioactivities of blueberries (Vaccinium spp.).

    PubMed

    Lee, Sarah; Jung, Eun Sung; Do, Seon-Gil; Jung, Ga-Young; Song, Gwanpil; Song, Jung-Min; Lee, Choong Hwan

    2014-03-05

    Metabolite profiling of three blueberry species (Vaccinium bracteatum Thunb., V. oldhamii Miquel., and V. corymbosum L.) was performed using gas chromatography-time-of-flight-mass spectrometry (GC-TOF-MS) and ultraperformance liquid chromatography-quadrupole-time-of-flight-mass spectrometry (UPLC-Q-TOF-MS) combined multivariate analysis. Partial least-squares discriminant analysis clearly showed metabolic differences among species. GC-TOF-MS analysis revealed significant differences in amino acids, organic acids, fatty acids, sugars, and phenolic acids among the three blueberry species. UPLC-Q-TOF-MS analysis indicated that anthocyanins were the major metabolites distinguishing V. bracteatum from V. oldhamii. The contents of anthocyanins such as glycosides of cyanidin were high in V. bracteatum, while glycosides of delphinidin, petunidin, and malvidin were high in V. oldhamii. Antioxidant activities assessed using ABTS and DPPH assays showed the greatest activity in V. oldhamii and revealed the highest correlation with total phenolic, total flavonoid, and total anthocyanin contents and their metabolites.

  15. Phenolic content and antioxidant activity of raspberry and blackberry cultivars.

    PubMed

    Sariburun, Esra; Sahin, Saliha; Demir, Cevdet; Türkben, Cihat; Uylaşer, Vildan

    2010-05-01

    Raspberry (Aksu Kirmizisi, Rubin, Newburgh, Hollanda Boduru, Heritage) and blackberry (Bursa 1, Bursa 2, Jumbo, Chester) cultivars were assayed for antioxidant activity (determined as 2,2-azino-di-[3-ethylbenzothialozine-sulphonic acid][ABTS], 2,2-diphenyl-1-picrylhydrazyl radical [DPPH], and cupric ion reducing antioxidant capacity [CUPRAC]), total phenol, total flavonoid, and total anthocyanin contents. In addition, 10 anthocyanins and anthocyanidins were determined in raspberry and blackberry by liquid chromatography-mass spectrometry (LC-MS/MS). Raspberry and blackberry had the highest ABTS, DPPH, CUPRAC, total phenol, and total flavonoid contents in methanol extracts, whereas total anthocyanin contents were the highest in water extracts. The antioxidant activity of the raspberry and blackberry was directly related to the total amount of phenolic compounds detected in the raspberry and blackberry. All antioxidant activity values were highly correlated with anthocyanin content in blackberry (0.93 < or = r < or = 0.99, P = 0.05). On the other hand, high correlation between total flavonoid content and antioxidant activity was recorded in water extract of blackberry (0.91 < or = r < or = 0.93, P = 0.05). ABTS value was highly correlated with total flavonoid content in methanol extract (r = 0.90), whereas total flavonoid content was relatively less correlated with DPPH (r = 0.85) and CUPRAC (r = 0.89).

  16. Magnetic Causes of Solar Coronal Mass Ejections: Dominance of the Free Magnetic Energy Over the Magnetic Twist Alone

    NASA Technical Reports Server (NTRS)

    Falconer, D. A.; Moore, R. L.; Gary, g. A.

    2006-01-01

    We examine the magnetic causes of coronal mass ejections (CMEs) by examining, along with the correlations of active-region magnetic measures with each other, the correlations of these measures with active-region CME productivity observed in time windows of a few days, either centered on or extending forward from the day of the magnetic measurement. The measures are from 36 vector magnetograms of bipolar active regions observed within -30" of disk center by the Marshal Space Flight Center (MSFC) vector magnetograph. From each magnetogram, we extract six whole-active-region measures twice, once from the original plane-of-the-sky magnetogram and again a h r deprojection of the magnetogram to disk center. Three of the measures are alternative measures of the total nonpotentiality of the active region, two are alternative measures of the overall twist in the active-region's magnetic field, and one is a measure of the magnetic size of the active region (the active region's magnetic flux content). From the deprojected magnetograms, we find evidence that (1) magnetic twist and magnetic size are separate but comparably strong causes of active-region CME Productivity, and (2) the total free magnetic energy in an active region's magnetic field is a stronger determinant of the active region's CME productivity than is the field's overall twist (or helicity) alone. From comparison of results from the non-deprojected magnetograms with corresponding results from the deprojected magnetograms, we find evidence that (for prediction of active-region CME productivity and for further studies of active-region magnetic size as a cause of CMEs), for active regions within approx.30deg of disk center, active-region total nonpotentiality and flux content can be adequately measured from line-of-sight magnetograms, such as from SOH0 MDI.

  17. Prediction equation for estimating total daily energy requirements of special operations personnel.

    PubMed

    Barringer, N D; Pasiakos, S M; McClung, H L; Crombie, A P; Margolis, L M

    2018-01-01

    Special Operations Forces (SOF) engage in a variety of military tasks with many producing high energy expenditures, leading to undesired energy deficits and loss of body mass. Therefore, the ability to accurately estimate daily energy requirements would be useful for accurate logistical planning. Generate a predictive equation estimating energy requirements of SOF. Retrospective analysis of data collected from SOF personnel engaged in 12 different SOF training scenarios. Energy expenditure and total body water were determined using the doubly-labeled water technique. Physical activity level was determined as daily energy expenditure divided by resting metabolic rate. Physical activity level was broken into quartiles (0 = mission prep, 1 = common warrior tasks, 2 = battle drills, 3 = specialized intense activity) to generate a physical activity factor (PAF). Regression analysis was used to construct two predictive equations (Model A; body mass and PAF, Model B; fat-free mass and PAF) estimating daily energy expenditures. Average measured energy expenditure during SOF training was 4468 (range: 3700 to 6300) Kcal·d- 1 . Regression analysis revealed that physical activity level ( r  = 0.91; P  < 0.05) and body mass ( r  = 0.28; P  < 0.05; Model A), or fat-free mass (FFM; r  = 0.32; P  < 0.05; Model B) were the factors that most highly predicted energy expenditures. Predictive equations coupling PAF with body mass (Model A) and FFM (Model B), were correlated ( r  = 0.74 and r  = 0.76, respectively) and did not differ [mean ± SEM: Model A; 4463 ± 65 Kcal·d - 1 , Model B; 4462 ± 61 Kcal·d - 1 ] from DLW measured energy expenditures. By quantifying and grouping SOF training exercises into activity factors, SOF energy requirements can be predicted with reasonable accuracy and these equations used by dietetic/logistical personnel to plan appropriate feeding regimens to meet SOF nutritional requirements across their mission profile.

  18. Familial resemblance of body composition, physical activity, and resting metabolic rate in pre-school children

    PubMed Central

    Djafarian, Kurosh; Speakman, John R; Stewart, Joanne; M Jackson, Diane

    2013-01-01

    Background: Although parental obesity is a well-established predisposing factor for the development of obesity, associations between regional body compositions, resting metabolic rates (RMR), and physical activity (PA) of parents and their pre-school children remain unknown. The objective of this study was to investigate parent-child correlations for total and regional body compositions, resting energy expenditures, and physical activity. Methods: Participants were 89 children aged 2-6 years and their parents, consisting of 61 families. Resting metabolic rate was assessed using indirect calorimetry. Total and regional body compositions were measured by both dual energy X-ray absorptiometry (DXA) and deuterium dilution. Physical activity was assessed by an accelerometer. Results: There was a significant parent-offspring regression for total fat free mass (FFM) between children and their mothers (P=0.02), fathers (P=0.02), and mid-parent (average of father and mother value) (P=0.002) when measured by DXA. The same was true for fat mass (FM) between children and mothers (P<0.01), fathers (P=0.02), and mid-parent (P=0.001). There was no significant association between children and parents for physical activity during the entire week, weekend, weekdays, and different parts of days, except for morning activity, which was positively related to the mothers’ morning activities (P<0.01) and mid-parent (P=0.009). No association was found between RMR of children and parents before and after correction for FFM and FM. Conclusion: These data suggest a familial resemblance for total body composition between children and their parents. Our data showed no familial resemblance for PA and RMR between children and their parents. PMID:26989715

  19. An Environmental Intervention to Prevent Excess Weight Gain in African American Students: A Pilot Study

    PubMed Central

    Newton, Robert L.; Han, Hongmei; Anton, Stephen D.; Martin, Corby K.; Stewart, Tiffany M.; Lewis, Leslie; Champagne, Catherine M.; Sothern, Melinda; Ryan, Donna; Williamson, Donald A.

    2009-01-01

    Purpose Examine the influence of an environmental intervention to prevent excess weight gain in African American children. Design Single-group repeated measures. Setting The intervention was delivered to a school composed of African American children. Subjects Approximately 45% (N = 77) of enrolled second through sixth grade students. Intervention The 18-month intervention was designed to alter the school environment to prevent excess weight gain by making healthier eating choices and physical activity opportunities more available. Measures Body Mass Index Percentile was the primary outcome variable. Body mass index Z-score was also calculated, and percent body fat, using bioelectrical impedance, was also measured. Total caloric intake (kcal), and percent kcal from fat, carbohydrate, and protein were measured by digital photography. Minutes of physical activity and sedentary behavior were self-reported. Analysis Mixed models analysis was used, covarying baseline values. Results Boys maintained while girls increased percent body fat over 18-months (p = .027). All children decreased percent of kcal consumed from total and saturated fat, and increased carbohydrate intake and self-reported physical activity during the intervention (p values < .025). body mass index Z-score, sedentary behavior, and total caloric intake were unchanged. Conclusion The program may have resulted in maintenance of percent body fat in boys. Girl's percent body fat steadily increased, despite similar behavioral changes as boys. School-based interventions targeting African American children should investigate strategies that can be effective across gender. PMID:20465148

  20. Health of the Force

    DTIC Science & Technology

    2015-11-01

    health readiness by ensuring the Total Force has the required physical , emotional, and cog- nitive health and fitness to win in environments that are...overall installation score for optimal physical activity as assessed by Body Mass Index (BMI), moderate or vigorous activity levels, resistance...activity and nutrition (SAN) are critical for achieving optimal physical , mental, and emotion-al health and wellbeing. They are integral to max

  1. Association of Enjoyable Leisure Activities With Psychological and Physical Well-Being

    PubMed Central

    Pressman, Sarah D.; Matthews, Karen A.; Cohen, Sheldon; Martire, Lynn M.; Scheier, Michael; Baum, Andrew; Schulz, Richard

    2010-01-01

    Objective To examine whether engaging in multiple enjoyable activities was associated with better psychological and physiological functioning. Few studies have examined the health benefits of the enjoyable activities that individuals participate in voluntarily in their free time. Method Participants from four different studies (n = 1399 total, 74% female, age = 19–89 years) completed a self-report measure (Pittsburgh Enjoyable Activities Test (PEAT)) assessing their participation in ten different types of leisure activities as well as measures assessing positive and negative psychosocial states. Resting blood pressure, cortisol (over 2 days), body mass index, waist circumference, and perceived physiological functioning were assessed. Results Higher PEAT scores were associated with lower blood pressure, total cortisol, waist circumference, and body mass index, and perceptions of better physical function. These associations withstood controlling for demographic measures. The PEAT was correlated with higher levels of positive psychosocial states and lower levels of depression and negative affect. Conclusion Enjoyable leisure activities, taken in the aggregate, are associated with psychosocial and physical measures relevant for health and well-being. Future studies should determine the extent that these behaviors in the aggregate are useful predictors of disease and other health outcomes. PMID:19592515

  2. Return to Function, Complication, and Reoperation Rates Following Primary Pectoralis Major Tendon Repair in Military Service Members.

    PubMed

    Nute, Drew W; Kusnezov, Nicholas; Dunn, John C; Waterman, Brian R

    2017-01-04

    Pectoralis major tendon ruptures have become increasingly common injuries among young, active individuals over the past 30 years; however, there is presently a paucity of reported outcome data. We investigated the ability to return to full preoperative level of function, complications, reoperation rates, and risk factors for failure following surgical repair of the pectoralis major tendon in a cohort of young, highly active individuals. All U.S. active-duty military patients undergoing pectoralis major tendon repair between 2008 and 2013 were identified from the Military Health System using the Management Analysis and Reporting Tool (M2). Demographic characteristics, injury characteristics, and trends in preoperative and postoperative self-reported pain scale (0 to 10) and strength were extracted. The ability to return to the full preoperative level of function and rates of rerupture and reoperation were the primary outcome measures. Univariate analysis followed by multivariate analysis identified significant variables. A total of 257 patients with pectoralis major tendon repair were identified with a mean follow-up (and standard deviation) of 47.8 ± 17 months (range, 24 to 90 months). At the time of the latest follow-up, 242 patients (94%) were able to return to the full preoperative level of military function. Fifteen patients (5.8%) were unable to return to duty because of persistent upper-extremity disability. A total of 15 reruptures occurred in 14 patients (5.4%). Increasing body mass index and active psychiatric conditions were significant predictors of inability to return to function (odds ratio, 1.56 [p = 0.0001] for increasing body mass index; and odds ratio, 6.59 [p = 0.00165] for active psychiatric conditions) and total failure (odds ratio, 1.26 [p = 0.0012] for increasing body mass index; and odds ratio, 2.73 [p = 0.0486] for active psychiatric conditions). We demonstrate that 94% of patients were able to return to the full preoperative level of function within active military duty following surgical repair of pectoralis major tendon rupture and 5.4% of patients experienced rerupture after primary repair. Increasing body mass index and active psychiatric diagnoses are significant risk factors for an inability to return to function and postoperative failures. Therapeutic Level IV. See Instructions for Authors for a complete description of levels of evidence.

  3. Does neighbourhood walkability moderate the effects of mass media communication strategies to promote regular physical activity?

    PubMed

    Barnes, R; Giles-Corti, B; Bauman, A; Rosenberg, M; Bull, F C; Leavy, J E

    2013-02-01

    Mass media campaigns are widely used in Australia and elsewhere to promote physical activity among adults. Neighbourhood walkability is consistently shown to be associated with walking and total activity. Campaigns may have different effects on individuals living in high and low walkable neighbourhoods. The purpose of this study is to compare pre- and post-campaign cognitive and behavioural impacts of the Heart Foundation's Find Thirty every day® campaign, in respondents living in high and lower walkable neighbourhoods. Pre- and post-campaign cross-sectional survey data were linked with objectively measured neighbourhood walkability. Cognitive and behavioural impacts were assessed using logistic regression stratified by walkability. Cognitive impacts were significantly higher post-campaign and consistently higher in respondents in high compared with lower walkable neighbourhoods. Post campaign sufficient activity was significantly higher and transport walking significantly lower, but only in residents of lower walkable areas. Cognitive impacts of mass media physical activity campaigns may be enhanced by living in a more walkable neighbourhood.

  4. Does a novel school-based physical activity model benefit femoral neck bone strength in pre- and early pubertal children?

    PubMed

    Macdonald, H M; Kontulainen, S A; Petit, M A; Beck, T J; Khan, K M; McKay, H A

    2008-10-01

    The effects of physical activity on bone strength acquisition during growth are not well understood. In our cluster randomized trial, we found that participation in a novel school-based physical activity program enhanced bone strength acquisition and bone mass accrual by 2-5% at the femoral neck in girls; however, these benefits depended on teacher compliance with intervention delivery. Our intervention also enhanced bone mass accrual by 2-4% at the lumbar spine and total body in boys. We investigated the effects of a novel school-based physical activity program on femoral neck (FN) bone strength and mass in children aged 9-11 yrs. We used hip structure analysis to compare 16-month changes in FN bone strength, geometry and bone mineral content (BMC) between 293 children who participated in Action Schools! BC (AS! BC) and 117 controls. We assessed proximal femur (PF), lumbar spine (LS) and total body (TB) BMC using DXA. We compared change in bone outcomes between groups using linear regression accounting for the random school effect and select covariates. Change in FN strength (section modulus, Z), cross-sectional area (CSA), subperiosteal width and BMC was similar between control and intervention boys, but intervention boys had greater gains in BMC at the LS (+2.7%, p = 0.05) and TB (+1.7%, p = 0.03) than controls. For girls, change in FN-Z tended to be greater (+3.5%, p = 0.1) for intervention girls than controls. The difference in change increased to 5.4% (p = 0.05) in a per-protocol analysis that included girls whose teachers reported 80% compliance. AS! BC benefits bone strength and mass in school-aged children; however, our findings highlight the importance of accounting for teacher compliance in classroom-based physical activity interventions.

  5. Gas Chromatography-Mass Spectrometry-Olfactometry To Control the Aroma Fingerprint of Extra Virgin Olive Oil from Three Tunisian Cultivars at Three Harvest Times.

    PubMed

    Ben Brahim, Samia; Amanpour, Asghar; Chtourou, Fatma; Kelebek, Hasim; Selli, Serkan; Bouaziz, Mohamed

    2018-03-21

    Gas chromatography-mass spectrometry-olfactometry was used for the analysis of volatile compounds and key odorants of three less studied Tunisian olive oil cultivars for the first time. A total of 42 aroma compounds were identified and quantified in extra virgin olive oils. The present study revealed that the most dominant volatiles in olive oil samples qualitatively and quantitatively were aldehydes and alcohols, followed by terpenes and esters. Indeed, chemometric analysis has shown a correlation between chemical compounds and sensory properties. The determination of aroma-active compounds of olive oil samples was carried out using aroma extract dilution analysis. A total of 15 aroma-active compounds were detected in the aromatic extract of extra virgin olive oil, of which 14 were identified. On the basis of the flavor dilution (FD) factor, the most potent aromatic active compound was hexanal (FD = 512) in Fakhari olive oil, (FD = 256) in Touffehi oils, and (FD = 128) in Jemri olive oil.

  6. Size-induced axial band structure and directional flow of a ternary-size granular material in a 3-D horizontal rotating drum

    NASA Astrophysics Data System (ADS)

    Yang, Shiliang; Sun, Yuhao; Ma, Honghe; Chew, Jia Wei

    2018-05-01

    Differences in the material property of the granular material induce segregation which inevitably influences both natural and industrial processes. To understand the dynamical segregation behavior, the band structure, and also the spatial redistribution of particles induced by the size differences of the particles, a ternary-size granular mixture in a three-dimensional rotating drum operating in the rolling flow regime is numerically simulated using the discrete element method. The results demonstrate that (i) the axial bands of the medium particles are spatially sandwiched in between those of the large and small ones; (ii) the total mass in the active and passive regions is a global parameter independent of segregation; (iii) nearly one-third of all the particles are in the active region, with the small particles having the highest mass fraction; (iv) the axial bands initially appear near the end wall, then become wider and purer in the particular species with time as more axial bands form toward the axial center; and (v) the medium particle type exhibits segregation later and has the narrowest axial bandwidth and least purity in the bands. Compared to the binary-size system, the presence of the medium particle type slightly increases the total mass in the active region, leads to larger mass fractions of the small and large particle types in the active region, and enhances the axial segregation in the system. The results obtained in the current work provide valuable insights regarding size segregation, and band structure and formation in the rotating drum with polydisperse particles.

  7. The effect of hydration status on the measurement of lean tissue mass by dual-energy X-ray absorptiometry.

    PubMed

    Toomey, Clodagh M; McCormack, William G; Jakeman, Phil

    2017-03-01

    Athletes cycle between exercise and recovery. Exercise invokes changes in total body water from thermal sweating, muscle and hepatic glycogen depletion and metabolic water loss. Recovery from exercise results in rehydration, substrate repletion, and possible glycogen supercompensation. Such changes may corrupt the measurement of hydrated tissues, such as lean tissue mass (LTM), by dual-energy X-ray absorptiometry (DXA). The purpose of this study was to determine the effect of exercise and thermal dehydration and subsequent glycogen supercompensation on DXA-based measurement of body composition. Twelve active adult (18-29 years) males exercised at 70% VO 2max on a cycle ergometer in a thermal environment (30 °C) to induce a 2.5% reduction in body mass. Participants subsequently underwent a glycogen supercompensation phase, whereby a high carbohydrate diet (8-12 g/kg body mass/day) was consumed for a 48-h period. Whole-body DXA measurement was performed at baseline, following exercise and supercompensation. Following exercise, mean body mass decreased by -1.93 kg (95% CI -2.3, -1.5), while total LTM decreased by -1.69 kg (-2.4, -1.0). Supercompensation induced a mean body mass increase of 2.53 kg (2.0, 3.1) and a total LTM increase of 2.36 kg (1.8, 2.9). No change in total fat mass or bone mineral content was observed at any timepoint. Training regimens that typically induce dehydration and nutrition regimens that involve carbohydrate loading can result in apparent changes to LTM measurement by DXA. Accurate measurement of LTM in athletes requires strict observation of hydration and glycogen status to prevent manipulation of results.

  8. A numerical study of the segregation phenomenon of lognormal particle size distributions in the rotating drum

    NASA Astrophysics Data System (ADS)

    Yang, Shiliang; Sun, Yuhao; Zhao, Ya; Chew, Jia Wei

    2018-05-01

    Granular materials are mostly polydisperse, which gives rise to phenomena such as segregation that has no monodisperse counterpart. The discrete element method is applied to simulate lognormal particle size distributions (PSDs) with the same arithmetic mean particle diameter but different PSD widths in a three-dimensional rotating drum operating in the rolling regime. Despite having the same mean particle diameter, as the PSD width of the lognormal PSDs increases, (i) the steady-state mixing index, the total kinetic energy, the ratio of the active region depth to the total bed depth, the mass fraction in the active region, the steady-state active-passive mass-based exchanging rate, and the mean solid residence time (SRT) of the particles in the active region increase, while (ii) the steady-state gyration radius, the streamwise velocity, and the SRT in the passive region decrease. Collectively, these highlight the need for more understanding of the effect of PSD width on the granular flow behavior in the rotating drum operating in the rolling flow regime.

  9. Decomposition rate of peat-forming plants in the oligotrophic peatland at the first stages of destruction

    NASA Astrophysics Data System (ADS)

    Nikonova, L. G.; Golovatskaya, E. A.; Terechshenko, N. N.

    2018-03-01

    The research presents quantitative estimates of the decomposition rate of plant residues at the initial stages of the decay of two plant species (Eriophorum vaginatum and Sphagnum fuscum) in a peat deposit of the oligotrophic bog in the southern taiga subzone of Western Siberia. We also studied a change in the content of total carbon and nitrogen in plant residues and the activity of microflora in the initial stages of decomposition. At the initial stage of the transformation process of peat-forming plants the losses of mass of Sph. fuscum is 2.5 times lower then E. vaginatum. The most active mass losses, as well as a decrease in the total carbon content, is observed after four months of the experiment. The most active carbon removal is characteristic for E. vaginatum. During the decomposition of plant residues, the nitrogen content decreases, and the most intense nitrogen losses were characteristic for Sph. fuscum. The microorganisms assimilating organic and mineral nitrogen are more active in August, the oligotrophic and cellulolytic microorganisms – in July.

  10. Mapping of human brown adipose tissue in lean and obese young men

    PubMed Central

    Leitner, Brooks P.; Huang, Shan; Brychta, Robert J.; Duckworth, Courtney J.; Baskin, Alison S.; McGehee, Suzanne; Tal, Ilan; Dieckmann, William; Gupta, Garima; Kolodny, Gerald M.; Pacak, Karel; Herscovitch, Peter

    2017-01-01

    Human brown adipose tissue (BAT) can be activated to increase glucose uptake and energy expenditure, making it a potential target for treating obesity and metabolic disease. Data on the functional and anatomic characteristics of BAT are limited, however. In 20 healthy young men [12 lean, mean body mass index (BMI) 23.2 ± 1.9 kg/m2; 8 obese, BMI 34.8 ± 3.3 kg/m2] after 5 h of tolerable cold exposure, we measured BAT volume and activity by 18F-labeled fluorodeoxyglucose positron emission tomography/computerized tomography (PET/CT). Obese men had less activated BAT than lean men (mean, 130 vs. 334 mL) but more fat in BAT-containing depots (mean, 1,646 vs. 855 mL) with a wide range (0.1–71%) in the ratio of activated BAT to inactive fat between individuals. Six anatomic regions had activated BAT—cervical, supraclavicular, axillary, mediastinal, paraspinal, and abdominal—with 67 ± 20% of all activated BAT concentrated in a continuous fascial layer comprising the first three depots in the upper torso. These nonsubcutaneous fat depots amounted to 1.5% of total body mass (4.3% of total fat mass), and up to 90% of each depot could be activated BAT. The amount and activity of BAT was significantly influenced by region of interest selection methods, PET threshold criteria, and PET resolutions. The present study suggests that active BAT can be found in specific adipose depots in adult humans, but less than one-half of the fat in these depots is stimulated by acute cold exposure, demonstrating a previously underappreciated thermogenic potential. PMID:28739898

  11. Validity and reproducibility of self-reported total physical activity--differences by relative weight.

    PubMed

    Norman, A; Bellocco, R; Bergström, A; Wolk, A

    2001-05-01

    Physical activity is hypothesized to reduce the risk of obesity and several other chronic diseases and enhance longevity. However, most of the questionnaires used measure only part of total physical activity, occupational and/or leisure-time activity, which might lead to misclassification of total physical activity level and to dilution of risk estimates. We evaluated the validity and reproducibility of a short self-administered physical activity questionnaire, intended to measure long-term total daily 24 h physical activity. The questionnaire included questions on level of physical activity at work, hours per day of walking/bicycling, home/household work, leisure-time activity/inactivity and sleeping and was sent twice during one year (winter/spring and late summer). Two 7-day activity records, performed 6 months apart, were used as the reference method. One-hundred and eleven men, aged 44-78, completed the questionnaire and one or two activity records. The physical activity levels were measured as metabolic equivalents (MET)xh/day. Spearman correlation coefficient between total daily activity score estimated from the first questionnaire and the records (validity) was 0.56 (deattenuated) and between the first and the second questionnaire (reproducibility) 0.65. Significantly higher validity correlations were observed in men with self-reported body mass index below 26 kg/m(2) than in heavier men (r=0.73 vs r=0.39). This study indicates that the average total daily physical activity scores can be estimated satisfactorily in men using this simple self-administered questionnaire.

  12. Evaluating a filtering and recirculating system to reduce dust drift in simulated sowing of dressed seed and abraded dust particle characteristics.

    PubMed

    Biocca, Marcello; Pochi, Daniele; Fanigliulo, Roberto; Gallo, Pietro; Pulcini, Patrizio; Marcovecchio, Francesca; Perrino, Cinzia

    2017-06-01

    The pneumatic precision drills used in maize sowing can release dust owing to abrasion of dressed seed; the drift of dust containing insecticide active ingredients is harmful to honey bees. Therefore, we developed a device for drills that uses partial recirculation and filtration of the air by means of an antipollen and an electrostatic filter. Tests were carried out by simulating the sowing of seed treated with imidacloprid, thiamethoxam, clothianidin and fipronil. Dust released by the drill in different configurations was analysed to assess its mass and active ingredient concentration, size distribution and particle number concentration. In general, particles with a diameter smaller than 2.5 and 10 µm represent about 40 and 75% of the total dust mass respectively. The finest size fraction (<1 µm) contains a higher content of active ingredient. The prototype equipped with both antipollen and electrostatic filters always showed a reduction in dust emission greater than 90% in terms of both total mass and active ingredient amount, with a greater efficiency in the reduction in particles below 4 µm. This study presents an engineering solution addressing dust losses during sowing, contributes to the description of abrasion dust fractions and provides suggestions for further development of the prototype. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  13. Maternal exposure to Western diet affects adult body composition and voluntary wheel running in a genotype-specific manner in mice.

    PubMed

    Hiramatsu, Layla; Kay, Jarren C; Thompson, Zoe; Singleton, Jennifer M; Claghorn, Gerald C; Albuquerque, Ralph L; Ho, Brittany; Ho, Brett; Sanchez, Gabriela; Garland, Theodore

    2017-10-01

    Some human diseases, including obesity, Type II diabetes, and numerous cancers, are thought to be influenced by environments experienced in early life, including in utero. Maternal diet during the perinatal period may be especially important for adult offspring energy balance, potentially affecting both body composition and physical activity. This effect may be mediated by the genetic background of individuals, including, for example, potential "protective" mechanisms for individuals with inherently high levels of physical activity or high basal metabolic rates. To examine some of the genetic and environmental factors that influence adult activity levels, we used an ongoing selection experiment with 4 replicate lines of mice bred for high voluntary wheel running (HR) and 4 replicate, non-selected control lines (C). Dams (half HR and half C) were fed a "Western" diet (WD, high in fat and sucrose) or a standard diet (SD) from 2weeks prior to mating until their pups could feed on solid food (14days of age). We analyzed dam and litter characteristics from birth to weaning, and offspring mass and physical activity into adulthood. One male offspring from each litter received additional metabolic and behavioral tests. Maternal WD caused pups to eat solid food significantly earlier for C litters, but not for HR litters (interaction of maternal environment and genotype). With dam mass as a covariate, mean pup mass was increased by maternal WD but litter size was unaffected. HR dams had larger litters and tended to have smaller pups than C dams. Home-cage activity of juvenile focal males was increased by maternal WD. Juvenile lean mass, fat mass, and fat percent were also increased by maternal WD, but food consumption (with body mass as a covariate) was unaffected (measured only for focal males). Behavior in an elevated plus maze, often used to indicate anxiety, was unaffected by maternal WD. Maximal aerobic capacity (VO 2 max) was also unaffected by maternal WD, but HR had higher VO 2 max than C mice. Adult lean, fat, and total body masses were significantly increased by maternal WD, with greater increase for fat than for lean mass. Overall, no aspect of adult wheel running (total distance, duration, average running speed, maximum speed) or home-cage activity was statistically affected by maternal WD. However, analysis of the 8 individual lines revealed that maternal WD significantly increased wheel running in one of the 4 HR lines. On average, all groups lost fat mass after 6days of voluntary wheel running, but the absolute amount lost was greater for mice with maternal WD resulting in no effect of maternal WD on absolute or % body fat after wheel access. All groups gained lean and total body mass during wheel access, regardless of maternal WD or linetype. Measured after wheel access, circulating leptin, adiponectin, and corticosterone concentrations were unaffected by maternal WD and did not differ between HR and C mice. With body mass as a covariate, heart ventricle mass was increased by maternal WD in both HR and C mice, but fat pads, liver, spleen, and brain masses were unaffected. As found previously, HR mice had larger brains than C mice. Body mass of grand-offspring was unaffected by grand-maternal WD, but grand-offspring wheel running was significantly increased for one HR line and decreased for another HR line by grand-maternal WD. In summary, maternal Western diet had long-lasting and general effects on offspring adult morphology, but effects on adult behavior were limited and contingent on sex and genetic background. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Rapid analysis of controlled substances using desorption electrospray ionization mass spectrometry.

    PubMed

    Rodriguez-Cruz, Sandra E

    2006-01-01

    The recently developed technique of desorption electrospray ionization (DESI) has been applied to the rapid analysis of controlled substances. Experiments have been performed using a commercial ThermoFinnigan LCQ Advantage MAX ion-trap mass spectrometer with limited modifications. Results from the ambient sampling of licit and illicit tablets demonstrate the ability of the DESI technique to detect the main active ingredient(s) or controlled substance(s), even in the presence of other higher-concentration components. Full-scan mass spectrometry data provide preliminary identification by molecular weight determination, while rapid analysis using the tandem mass spectrometry (MS/MS) mode provides fragmentation data which, when compared to the laboratory-generated ESI-MS/MS spectral library, provide structural information and final identification of the active ingredient(s). The consecutive analysis of tablets containing different active components indicates there is no cross-contamination or interference from tablet to tablet, demonstrating the reliability of the DESI technique for rapid sampling (one tablet/min or better). Active ingredients have been detected for tablets in which the active component represents less than 1% of the total tablet weight, demonstrating the sensitivity of the technique. The real-time sampling of cannabis plant material is also presented.

  15. Comparison of Different Physical Activity Measurement Methods in Adults Aged 45 to 64 Years Under Free-Living Conditions.

    PubMed

    Lipert, Anna; Jegier, Anna

    2017-07-01

    To compare physical activity (PA) measured by 4 methods in adults under free-living conditions in relation to selected demographic and anthropometric variables. Cohort study. Department of Sports Medicine. Clinically healthy men (81) and women (69) aged 45 to 64 years. Physical activity monitoring for 7 consecutive days under free-living conditions by pedometer (P) and accelerometer (A) simultaneously and PA questionnaires: International Physical Activity Questionnaire (IPAQ) and Seven-Day Physical Activity Questionnaire Recall (SDPAR) completed after the 7-day PA. Comparison of PA measured by pedometer, IPAQ, and SDPAR with accelerometer with regard to age, body mass, gender, and obesity type. Total energy expenditure (EE) by IPAQ was higher than A (P < 0.001) in both groups regardless of age, body mass, or obesity type. Mean EE value by P was greater than A (P < 0.001) in central-obesity males and lower than A (P < 0.001) in central-obesity females. There were differences in step counts in women, unnoticed in men. SDPAR overestimated total EE in gynoid-obesity males and in central-obesity females compared with A. Ninety-five percent CI was the largest around IPAQ compared with P and SDPAR, with SDPAR showing the best agreement with A. Body mass and obesity type influenced PA measurements. To monitor PA, it is recommended to use pedometer in normal bodyweight and overweight groups while accelerometer is advisable in obese subjects. A combined approach of objective and subjective PA monitoring tools is preferable.

  16. Comparison of total-body calcium with radiographic and photon absorptiometry measurement of appendicular bone mineral content. [Comparison of findings in patients with primary osteoporosis and healthy marathon runners

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Zanzi, I; Colbert, C; Bachtell, R

    1978-01-01

    Two groups of investigators utilized three techniques for evaluating bone mineral mass. In one institution, total-body calcium by total body neutron activation analysis, and bone mineral content of the radius by photon absorptiometry were measured concomitantly. In the other institution, the mean bone mineral content of the three inner phalanges of the left hand was measured by radiographic absorptiometry. These techniques were applied to two groups of subjects: 16 patients with primary osteoporosis and 14 healthy marathon runners. The higher correlation found in osteoporotic patients may be related to the diffuse nature of this condition and to differences in themore » distribution of skeletal mass in the marathon runners.« less

  17. Changes in gut hormones and leptin in military personnel during operational deployment in Afghanistan.

    PubMed

    Hill, Neil E; Fallowfield, Joanne L; Delves, Simon K; Ardley, Christian; Stacey, Michael; Ghatei, Mohammad; Bloom, Stephen R; Frost, Gary; Brett, Stephen J; Wilson, Duncan R; Murphy, Kevin G

    2015-03-01

    Understanding the mechanisms that drive weight loss in a lean population may elucidate systems that regulate normal energy homeostasis. This prospective study of British military volunteers investigated the effects of a 6-month deployment to Afghanistan on energy balance and circulating concentrations of specific appetite-regulating hormones. Measurements were obtained twice in the UK (during the Pre-deployment period) and once in Afghanistan, at Mid-deployment. Body mass, body composition, food intake, and appetite-regulatory hormones (leptin, active and total ghrelin, PYY, PP, GLP-1) were measured. Repeated measures analysis of 105 volunteers showed body mass decreased by 4.9% ± 3.7% (P < 0.0001) during the first half of the deployment. Leptin concentrations were significantly correlated with percentage body fat at each time point. The reduction in percentage body fat between Pre-deployment and Mid-deployment was 8.6%, with a corresponding 48% decrease in mean circulating leptin. Pre-deployment leptin and total and active ghrelin levels correlated with subsequent change in body mass; however. no changes were observed in the anorectic gut hormones GLP-1, PP, or PYY. These data suggest that changes in appetite-regulating hormones in front line military personnel occur in response to, but do not drive, reductions in body mass. © 2015 The Obesity Society.

  18. Total body nitrogen analysis. [neutron activation analysis

    NASA Technical Reports Server (NTRS)

    Palmer, H. E.

    1975-01-01

    Studies of two potential in vivo neutron activation methods for determining total and partial body nitrogen in animals and humans are described. A method using the CO-11 in the expired air as a measure of nitrogen content was found to be adequate for small animals such as rats, but inadequate for human measurements due to a slow excretion rate. Studies on the method of measuring the induced N-13 in the body show that with further development, this method should be adequate for measuring muscle mass changes occurring in animals or humans during space flight.

  19. Simultaneous gas chromatographic-mass spectrometric quantitation of the alkylbenzene inert components, pesticide manufacturing by-products and active ingredient in two malathion formulations.

    PubMed

    Lin, Y W; Hee, S S

    1998-07-24

    A rapid, reliable and effective method for direct determination of the inert components, manufacturing by-products of the pesticide, and active ingredient in two malathion formulations has been established using capillary gas chromatography-mass spectrometry (GC-MS) with the internal standard method. The C2-, C3-, and C4-alkylbenzenes, the major pesticide manufacturing by-products (O,O,S-trimethylthionophosphate, diethyl maleate and O,O,O-trimethylthionophosphate), and malathion were resolved, and quantified in the same chromatogram. Structural identification was based on MS total ion current data, comparison of GC retention times with those of authentic standards, and retention indices. O,O,S-Trimethylthionophosphate was quantified at 3.57 +/- 0.31% (w/w) in one malathion formulation. While the malathion contents were within specifications for both formulations, the total alkylbenzene contents were not.

  20. Associations Between Sedentary Time, Physical Activity, and Dual-Energy X-ray Absorptiometry Measures of Total Body, Android, and Gynoid Fat Mass in Children.

    PubMed

    McCormack, Lacey; Meendering, Jessica; Specker, Bonny; Binkley, Teresa

    2016-01-01

    Negative health outcomes are associated with excess body fat, low levels of physical activity (PA), and high sedentary time (ST). Relationships between PA, ST, and body fat distribution, including android and gynoid fat, assessed using dual-energy X-ray absorptiometry (DXA) have not been measured in children. The purpose of this study was to test associations between levels of activity and body composition in children and to evaluate if levels of activity predict body composition by DXA and by body mass index percentile in a similar manner. PA, ST, and body composition from 87 children (8.8-11.8 yr, grades 3-5, 44 boys) were used to test the association among study variables. Accelerometers measured PA and ST. Body composition measured by DXA included bone mineral content (BMC) and fat and lean mass of the total body (TB, less head), android, and gynoid regions. ST (range: 409-685 min/wk) was positively associated with TB percent fat (0.03, 95% confidence interval [CI]: 0.00-0.05) and android fat mass (1.5 g, 95% CI: 0.4-3.0), and inversely associated with the lean mass of the TB (-10.7 g, 95% CI: -20.8 to -0.63) and gynoid regions (-2.2 g, 95% CI: -4.3 to -0.2), and with BMC (-0.43 g, 95% CI: 0.77-0.09). Moderate-to-vigorous PA was associated with lower TB (-53 g, 95% CI: -87 to -18), android (-5 g, 95% CI: -8 to -2]), and gynoid fat (-6 g, 95% CI: -11 to -0.5). Vigorous activity results were similar. Light PA was associated with increased TB (17.1 g, 95% CI: 3.0-31.3) and gynoid lean mass (3.9 g, 95% CI: 1.0-6.8) and BMC (0.59 g, 95% CI: 0.10-1.07). In boys, there were significant associations between activity and DXA percent body fat measures that were not found with the body mass index percentile. Objective measures of PA were inversely associated with TB, android, and gynoid fat, whereas ST was directly associated with TB percent fat and, in particular, android fat. Activity levels predict body composition measures by DXA and, in particular, android fat distribution. Copyright © 2016 International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.

  1. Stationary swarming motion of active Brownian particles in parabolic external potential

    NASA Astrophysics Data System (ADS)

    Zhu, Wei Qiu; Deng, Mao Lin

    2005-08-01

    We investigate the stationary swarming motion of active Brownian particles in parabolic external potential and coupled to its mass center. Using Monte Carlo simulation we first show that the mass center approaches to rest after a sufficient long period of time. Thus, all the particles of a swarm have identical stationary motion relative to the mass center. Then the stationary probability density obtained by using the stochastic averaging method for quasi integrable Hamiltonian systems in our previous paper for the motion in 4-dimensional phase space of single active Brownian particle with Rayleigh friction model in parabolic potential is used to describe the relative stationary motion of each particle of the swarm and to obtain more probability densities including that for the total energy of the swarm. The analytical results are confirmed by comparing with those from simulation and also shown to be consistent with the existing deterministic exact steady-state solution.

  2. Energy metabolism, body composition, and urea generation rate in hemodialysis patients.

    PubMed

    Sridharan, Sivakumar; Vilar, Enric; Berdeprado, Jocelyn; Farrington, Ken

    2013-10-01

    Hemodialysis (HD) adequacy is currently assessed using normalized urea clearance (Kt/V), although scaling based on Watson volume (V) may disadvantage women and men with low body weight. Alternative scaling factors such as resting energy expenditure and high metabolic rate organ mass have been suggested. The relationship between such factors and uremic toxin generation has not been established. We aimed to study the relationship between body size, energy metabolism, and urea generation rate. A cross-sectional cohort of 166 HD patients was studied. Anthropometric measurements were carried on all. Resting energy expenditure was measured by indirect calorimetry, fat-free mass by bio-impedance and total energy expenditure by combining resting energy expenditure with a questionnaire-derived physical activity data. High metabolic rate organ mass was calculated using a published equation and urea generation rate using formal urea kinetic modeling. Metabolic factors including resting energy expenditure, total energy expenditure and fat-free mass correlated better with urea generation rate than did Watson volume. Total energy expenditure and fat-free mass (but not Watson Volume) were independent predictors of urea generation rate, the model explaining 42% of its variation. Small women (

  3. The prospective association between different types of exercise and body composition

    PubMed Central

    Drenowatz, Clemens; Hand, Gregory A.; Sagner, Michael; Shook, Robin P.; Burgess, Stephanie; Blair, Steven N.

    2015-01-01

    Purpose Despite the widely accepted benefits of exercise on chronic disease risk, there remains controversy on the role of exercise in weight loss. This study examined the effect of different exercise types on measures of adiposity across different fat categories. Methods A total of 348 young adults (49% male; 28±4 years), participating in an ongoing observational study, provided valid data over a period of 12 months. Fat mass (FM) and lean mass (LM) were measured via dual x-ray absorptiometry every 3 months. Percent body fat (BF) was calculated and used to differentiate between normal fat, over fat and obese participants. At each measurement time point participants reported engagement (min/week) in aerobic exercise, resistance exercise and other exercise. Results Most participants (93%) reported some exercise participation during the observation period. Total exercise or specific exercise types did not significantly affect subsequent BMI after adjusting for sex, ethnicity, age and baseline values of adiposity and exercise. Resistance exercise affected lean mass (p<0.01) and fat mass (p<0.01), while aerobic exercise only affected fat mass (p<0.01). Any exercise type positively affected lean mass in normal fat participants (p<0.04). In overfat and obese participants fat mass was reduced with increasing resistance exercise (p≤0.02) but not with aerobic exercise (p≥0.09). Additionally adjusting for objectively assessed total physical activity level did not change these results. Conclusion Despite the limited effects on BMI, exercise was associated with beneficial changes in body composition. Exercise increased lean mass in normal fat participants and reduced fat mass in overfat and obese adults. Adults with excess body fat may benefit particularly from resistance exercise. PMID:25970664

  4. Influence of biological factors on lipid and fibrinogen measurements in young men. An epidemiological study in 2009 recruits.

    PubMed

    Pitsavos, C; Skoumas, J; Dernellis, J; Toutouza, M; Doulalas, A; Stefanadis, C; Toutouzas, P

    1998-11-01

    The aim of the present study was to detect significant relationships between lipid and fibrinogen measurements and several biological factors in young men. Medical history was obtained, and plasma lipids, lipoprotein (a) and fibrinogen levels were measured in 2009 male Greek army recruits (mean age 22.37+/-3.03 years) not taking any drugs. Plasma levels were as follows: total cholesterol, 171+/-34 mg x dl(-1), low density lipoprotein (LDL) cholesterol, 111+/-34 mg x dl(-1), high density lipoprotein (HDL) cholesterol, 45+/-10 mg x dl(1), and triglycerides, 74+/-32 mg x dl(-1). Lipoprotein (a) and fibrinogen were 18+/-13 and 278+/-67 mg x dl(-1). The atherosclerotic index, calculated as the ratio of total cholesterol/HDL, was 4+/-1. Analysis of multivariate models that included potentially confounding factors revealed the following: body mass index, season of year during which blood examinations were performed, alcohol consumption, and place of residence were found to be significantly associated with plasma levels of total cholesterol, LDL-cholesterol, fibrinogen and the atherosclerotic index in the pooled population. Season and physical activity were significantly associated with HDL-cholesterol, whereas season and family history of acute myocardial infarction were associated with triglycerides levels. Body mass index, family history of myocardial infarction and physical activity were associated with lipoprotein (a). Body mass index, season, alcohol consumption and place of residence are markers of plasma lipid profile and fibrinogen in young men. A family history of acute myocardial infarction and physical activity are related to lipoprotein (a).

  5. Influence of unsprung weight on vehicle ride quality

    NASA Astrophysics Data System (ADS)

    Hrovat, D.

    1988-08-01

    In the first part of this paper, a simple quarter-car, two-degree-of-freedom (2 DOF) vehicle model is used to investigate potential benefits and adaptive control capabilities of active suspensions. The results of this study indicate that, with an active suspension, it is possible to trade each 1% increase in tire deflection with a circa 1% decrease in r.m.s. sprung mass acceleration. This can be used for adaptive suspension tuning based on varying road/speed conditions. The second part of this paper is concerned with the influence of unsprung mass on optimal vibration isolation for the case of a linear 2 DOF, quarter-car model. In the study, it is assumed that the tire stiffness and geometry remain the same while unsprung mass is changed. The comprehensive computer analysis shows that, for active suspensions, both ride and handling can be improved by reducing the unsprung mass. In particular, when the total vehicle mass is kept constant, every 10% reduction in unsprung mass contributes to a circa 6% reduction in r.m.s. sprung mass acceleration for the same level of wheel-hop. For active suspension vehicles, this gives an added incentive for reducing the unsprung weight through the usage of, for example, aluminum wheels and lightweight composite materials. Although used primarily in the context of automotive applications, the results of this study are generic to similar 2 DOF structures in other areas of vibration isolation, ranging from computer peripherals to off-road vehicles.

  6. Bone mineral accrual across growth in a mixed-ethnic group of children: are Asian children disadvantaged from an early age?

    PubMed

    Burrows, Melonie; Baxter-Jones, Adam; Mirwald, Robert; Macdonald, Heather; McKay, Heather

    2009-05-01

    We investigated the contribution of ethnicity, physical activity, body composition, and calcium intake to bone accrual across 7 years of growth. We assessed 80 Caucasian and 74 Asian boys and 81 Caucasian and 64 Asian girls at baseline and retained 155 children across all 7 years. Ethnicity, physical activity, and calcium intake were assessed by questionnaire; fat mass, lean mass, and bone mineral content (BMC) of the whole body (WB), lumbar spine (LS), total proximal femur (PF(TOT)), and femoral neck (FN) were measured using DXA (Hologic QDR 4500). We aligned children on peak height velocity and utilized multilevel modeling to assess bone mineral accrual. Height and lean mass accounted for 51.8% and 44.1% of BMC accrual in children. There was a significant difference in physical activity, calcium intake, and lean mass between Asians and Caucasian boys and girls at baseline and conclusion (p < 0.05). In boys, physical activity and ethnicity significantly predicted BMC accrual at the FN. In girls, Asians had significantly lower PF(TOT) and FN BMC. Calcium was a significant predictor of WB BMC accrual in boys and girls. In conclusion, our findings highlight the importance of accounting for ethnicity in pediatric studies. Physical activity, dietary calcium, and lean mass positively influence bone accrual and are lower in Asian compared to Caucasian children from a very young age.

  7. Evaluation of antioxidant activity, total phenolics, total flavonoids and LC-MS/MS characterisation of phenolic constituents in Stachys lavandulifolia.

    PubMed

    Rahimi Khoigani, Soroush; Rajaei, Ahmad; Goli, Sayed Amir Hossein

    2017-02-01

    The aim of this study was to evaluate phenolics profile and antioxidant activity of Stachys lavandulifolia. Total phenolics (TP), total flavonoids (TF), DPPH• assay (IC50), ferric ion reducing antioxidant power (FRAP) and total antioxidant capacity (TAC) of the methanolic extract were measured. The content of TP, TF, IC50, FRAP and TAC, were obtained as 16.59 gallic acid equiv./g dry matter (DM), 4.48 mg quercetin equiv./g DM, 2.07 (μg/mL), 0.014 (absorbance/mg phenolic) and 14.61 (mg BHT equiv./g DM), respectively. The results showed that S. lavandulifolia, compared to other species of Stachys, had moderate TP content with desirable antioxidant activity. Subsequently, 59 various phenolic compounds were identified and confirmed in the methanolic extract of S. lavandulifolia using high mass accuracy by MS2 experiments. The compounds consisted of 6 hydroxybenzoic acids and hydroxybenzoic aldehydes, 9 hydroxycinnamic acids, 1 coumarin, 32 flavonoids, 3 lignans, 2 stilbenes, 3 tannins and 3 other phenolics.

  8. THE MOST MASSIVE GALAXIES AT 3.0 {<=} z < 4.0 IN THE NEWFIRM MEDIUM-BAND SURVEY: PROPERTIES AND IMPROVED CONSTRAINTS ON THE STELLAR MASS FUNCTION

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Marchesini, Danilo; Whitaker, Katherine E.; Brammer, Gabriel

    2010-12-10

    We use the optical to mid-infrared coverage of the NEWFIRM Medium-Band Survey (NMBS) to characterize, for the first time, the properties of a mass-complete sample of 14 galaxies at 3.0 {<=} z < 4.0 with M{sub star}>2.5 x 10{sup 11} M{sub sun}, and to derive significantly more accurate measurements of the high-mass end of the stellar mass function (SMF) of galaxies at 3.0 {<=} z < 4.0. The accurate photometric redshifts and well-sampled spectral energy distributions (SEDs) provided by the NMBS combined with the large surveyed area result in significantly reduced contributions from photometric redshift errors and cosmic variance tomore » the total error budget of the SMF. The typical very massive galaxy at 3.0 {<=} z < 4.0 is red and faint in the observer's optical, with a median r-band magnitude of (r{sub tot}) = 26.1, and median rest-frame U - V colors of (U - V) = 1.6. About 60% of the mass-complete sample has optical colors satisfying either the U- or the B-dropout color criteria, although {approx}50% of these galaxies has r>25.5. We find that {approx}30% of the sample has star formation rates (SFRs) from SED modeling consistent with zero, although SFRs of up to {approx}1-18 M{sub sun} yr{sup -1} are also allowed within 1{sigma}. However, >80% of the sample is detected at 24 {mu}m, resulting in total infrared luminosities in the range (0.5-4.0) x 10{sup 13} L{sub sun}. This implies the presence of either dust-enshrouded starburst activity (with SFRs of 600-4300 M{sub sun} yr{sup -1}) and/or highly obscured active galactic nuclei (AGNs). The contribution of galaxies with M{sub star}>2.5 x 10{sup 11} M{sub sun} to the total stellar mass budget at 3.0 {<=} z < 4.0 is {approx}8{sup +13}{sub -3}%. Compared to recent estimates of the stellar mass density in galaxies with M{sub star} {approx} 10{sup 9}-10{sup 11} M{sub sun} at z {approx} 5 and z {approx} 6, we find an evolution by a factor of 2-7 and 3-22 from z {approx} 5 and z {approx} 6, respectively, to z = 3.5. The previously found disagreement at the high-mass end between observed and model-predicted SMFs is now significant at the 3{sigma} level when only random uncertainties are considered. However, systematic uncertainties dominate the total error budget, with errors up to a factor of {approx}8 in the densities at the high-mass end, bringing the observed SMF in marginal agreement with the predicted SMF. Additional systematic uncertainties on the high-mass end could be potentially introduced by either (1) the intense star formation and/or the very common AGN activities as inferred from the MIPS 24 {mu}m detections, and/or (2) contamination by a significant population of massive, old, and dusty galaxies at z {approx} 2.6.« less

  9. Study of Chromium Oxide Activities in EAF Slags

    NASA Astrophysics Data System (ADS)

    Yan, Baijun; Li, Fan; Wang, Hui; Sichen, Du

    2016-02-01

    The activity coefficients of chromium in Cu-Cr melts were determined by equilibrating liquid copper with solid Cr2O3 in CO-CO2 atmosphere. The temperature dependence of the activity coefficients of chromium in Cu-Cr melts could be expressed as lg γ_{Cr}(s)^{0} = { 3 2 5 9( ± 1 8 6} )/T - 0. 5 9( { ± 0. 1} ). Based on the above results, the activities of bivalent and trivalent chromium oxide in some slags at 1873 K (1600 °C) were measured. The slags were equilibrated with Cu-Cr melts under two oxygen partial pressures ( {p_{O}_{ 2} }} } = 6.9 × 10-4 and 1.8 × 10-6 Pa, respectively). The morphology of the quenched slags and the solubility of chromium oxide in the melts were investigated by EPMA, SEM, and XRD. Under both oxygen partial pressures, the slags were saturated by the solid solution MgAl2- x Cr x O4- δ . At the low oxygen partial pressure (1.8 × 10-6 Pa), the content of Cr in the liquid phase varied from 0.4 to 1.6 mass pct with the total Cr content in the slags increasing from 1.3 to 10.8 mass pct. At the high oxygen partial pressure (6.9 × 10-4 Pa), the content of Cr in the liquid phase decreased to the level of 0.2 to 0.6 mass pct. Both the activities of CrO and Cr2O3 in slag were found to increase approximately linearly with the increase of the total Cr content in slag. While the oxygen partial pressure had minor effect on the activity of Cr2O3 in the slag, it had significant effect on the activity of CrO.

  10. Long-Term Kinetics of Serum and Xanthoma Cholesterol Radioactivity in Patients with Hypercholesterolemia

    PubMed Central

    Samuel, Paul; Perl, William; Holtzman, Charles M.; Rochman, Norman D.; Lieberman, Sidney

    1972-01-01

    In four patients with hypercholesterolemia (type II hyperlipoproteinemia) and xanthomatosis the decay of serum cholesterol specific activity was followed for 53-63 wk after pulse labeling. Specific activity of biopsied xanthoma cholesterol was measured four times in the course of the study. The xanthoma specific activity curve crossed and thereafter remained above the serum specific activity curve. The average ratio of xanthoma to serum specific activity was 4.7 at the end of the study. The final half-time of the xanthoma decay curves was significantly greater (average: 200 days) than the slowest half-time of serum specific activity decay (average: 93 days). The data were analyzed by input-output analysis and yielded the following results. The average value for the total input rate of body cholesterol (IT) (sum of dietary and biosynthesized cholesterol) was 1.29 g/day. The average size of the rapidly miscible pool of cholesterol (Ma) was 55.7 g. and of the total exchangeable body mass of cholesterol (M) 116.5 g. The average value of M - Ma (remaining exchangeable mass of cholesterol) was 60.8 g. The derived values for exchangeable masses of cholesterol, in the present patients with marked hypercholesterolemia, were significantly larger than in a group of patients with normal serum lipids in previous studies. One of the four patients died of a sudden acute myocardial infarction 53 wk after pulse labeling. Specific activity of aortic wall and atheroma cholesterol was 3.12 times that of serum. The ratio was close to 2 for adipose tissue and spleen, and was slightly above 1 or was close to unity in most other organs studied, with the exception of brain which showed a ratio of 0.19. PMID:5009114

  11. [Sedentary lifestyle is associated with metabolic and cardiovascular risk factors independent of physical activity].

    PubMed

    Leiva, Ana María; Martínez, María Adela; Cristi-Montero, Carlos; Salas, Carlos; Ramírez-Campillo, Rodrigo; Díaz Martínez, Ximena; Aguilar-Farías, Nicolás; Celis-Morales, Carlos

    2017-04-01

    Sedentary behavior is a main risk factor for cardiovascular disease and mortality. To investigate the association between sedentary behavior and metabolic and cardiovascular risk factors. We assessed 322 participants aged between 18 to 65 years. Physical activity and sedentary behavior were measured with accelerometers (Actigraph®). Body mass index (BMI), waist circumference, percentage of body fat, diet and blood markers (glucose, lipid profile, insulin and HOMA-IR) were measured with standardized protocols. Thirty four percent of participants were physically inactive and spent on average 8.7 h/day on sedentary activities. Per one hour increase in sedentary behavior there were significant adverse changes in glucose (4.79 mg/dl), insulin (2.73 pmol/l), HOMA-IR (0.75), BMI (0.69 kg/m²), waist circumference (1.95 cm), fat mass (1.03%), total cholesterol (9.73 mg/dl), HDL-cholesterol (-3.50 mg/dl), LDL-cholesterol (10.7 mg/dl) and triglycerides (12.4 mg/dl). These findings were independent of main confounding factors including total physical activity, dietary factors, BMI and socio-demographics. The detrimental effect of sedentary behaviors on cardiometabolic and obesity-related traits is independent of physical activity levels. Therefore, reducing sedentary time should be targeted in the population apart from increasing their physical activity levels.

  12. Activation of Aspen Wood with Carbon Dioxide and Phosphoric Acid for Removal of Total Organic Carbon from Oil Sands Produced Water: Increasing the Yield with Bio-Oil Recycling

    PubMed Central

    Veksha, Andrei; Bhuiyan, Tazul I.; Hill, Josephine M.

    2016-01-01

    Several samples of activated carbon were prepared by physical (CO2) and chemical (H3PO4) activation of aspen wood and tested for the adsorption of organic compounds from water generated during the recovery of bitumen using steam assisted gravity drainage. Total organic carbon removal by the carbon samples increased proportionally with total pore volume as determined from N2 adsorption isotherms at −196 °C. The activated carbon produced by CO2 activation had similar removal levels for total organic carbon from the water (up to 70%) to those samples activated with H3PO4, but lower yields, due to losses during pyrolysis and activation. A method to increase the yield when using CO2 activation was proposed and consisted of recycling bio-oil produced from previous runs to the aspen wood feed, followed by either KOH addition (0.48%) or air pretreatment (220 °C for 3 h) before pyrolysis and activation. By recycling the bio-oil, the yield of CO2 activated carbon (after air pretreatment of the mixture) was increased by a factor of 1.3. Due to the higher carbon yield, the corresponding total organic carbon removal, per mass of wood feed, increased by a factor of 1.2 thus improving the overall process efficiency. PMID:28787817

  13. Effects of Find Thirty every day(R): cross-sectional findings from a Western Australian population-wide mass media campaign, 2008-2010.

    PubMed

    Leavy, Justine E; Rosenberg, Michael; Bauman, Adrian E; Bull, Fiona C; Giles-Corti, Billie; Shilton, Trevor; Maitland, Clover; Barnes, Rosanne

    2013-08-01

    Internationally, over the last four decades large-scale mass media campaigns have been delivered to promote physical activity and its associated health benefits. In 2002-2005, the first Western Australian statewide adult physical activity campaign Find Thirty. It's Not a Big Exercise was launched. In 2007, a new iteration of the campaign was proposed with new objectives, executions, and tag line Find Thirty every day(®). This article reports on the population-level effects of the Find Thirty every day (®) campaign from 2008 to 2010, with a focus on changes in awareness, intention, and physical activity. Evaluation of the campaign involved pre- and posttest serial cross-sectional surveys. Baseline data were collected in May 2008, and subsequent surveys in 2009 and 2010. Samples sizes were as follows: baseline (n = 972), first follow-up (n = 938), and second follow-up (n = 937). Data were derived from self-reported responses to a random-sample computer-assisted telephone interview. Total awareness increased from 30.4% at baseline to 48.5% at second follow-up. Total awareness was higher in women and low socioeconomic status adults. Intention was 21.0%, double that reported at baseline. There were positive significant changes from baseline to first follow-up across all four categories: walking, moderate, vigorous, and total physical activity. There also were positive significant changes for self-reported walking from baseline to second follow-up. Find Thirty every day (®) resulted in an increase in awareness, intention, walking, vigorous intensity, and total level of physical activity in priority target groups. Campaign effects should be further examined by subgroups to identify the most receptive population segments.

  14. The impact of body mass index on the prevalence of low back pain: the HUNT study.

    PubMed

    Heuch, Ingrid; Hagen, Knut; Heuch, Ivar; Nygaard, Øystein; Zwart, John-Anker

    2010-04-01

    A cross-sectional population-based study. To examine the association between body mass index and chronic low back pain, with adjustment for potential confounders. Although many studies have investigated this association, it is still unclear whether there is a general relationship between body mass index and low back pain which applies to all populations. This study is based on data collected in the HUNT 2 study in the county of Nord-Trøndelag in Norway between 1995 and 1997. Among a total of 92,936 persons eligible for participation, 30,102 men and 33,866 women gave information on body mass index and indicated whether they suffered from chronic low back pain (69% participation rate). A total of 6293 men (20.9%) and 8923 women (26.3%) experienced chronic low back pain. Relations were assessed by logistic regression of low back pain with respect to body mass index and other variables. In both sexes, a high body mass index was significantly associated with an increased prevalence of low back pain. In men the estimated OR per 5 kg/m increase in body mass index was 1.07 (95% CI: 1.03-1.12) and in women 1.17 (95% CI: 1.14-1.21), after adjustment for age, with a significantly stronger association in women. Additional adjustment for education, smoking status, leisure time physical activity, employment status, and activity at work hardly affected these associations. No interactions were found with most other factors. This large population-based study indicates that obesity is associated with a high prevalence of low back pain. Further studies are needed to determine if the association is causal.

  15. Controlled longitudinal study of bone mass accrual in children and adolescents with cystic fibrosis

    PubMed Central

    Buntain, H M; Schluter, P J; Bell, S C; Greer, R M; Wong, J C H; Batch, J; Lewindon, P; Wainwright, C E

    2006-01-01

    Background A study was undertaken to observe the gains in bone mass in children and adolescents with cystic fibrosis (CF) over 24 months and to examine the relationship between areal bone mineral density (aBMD) and associated clinical parameters including physical activity, nutrition, and 25‐hydroxyvitamin D (25OHD). Methods Areal BMD of the total body (TB), lumbar spine (LS), and total femoral neck (FNt) were repeatedly measured in 85 subjects aged 5–18 years with CF and 100 age and sex matched controls over 2 years. At each visit anthropometric variables, nutritional parameters, pubertal status, disease severity, physical activity, dietary calcium, caloric intake, and serum 25OHD were assessed and related to aBMD. Results After adjusting for age, sex, and height Z‐score, gains in LS aBMD in children (5–10 years) and TB and FNt aBMD in adolescents (11–18 years) with CF were significantly less than in controls. Lean tissue mass was significantly associated with TB and LS aBMD gains in children and adolescents and explained a significant proportion of the aBMD deficit observed. Lung function parameters were significantly associated with aBMD gains in adolescents with CF. Conclusions Inadequate bone mass accrual during childhood and adolescence contributes to the low bone mass observed in adults with CF. Accounting for the height discrepancy which is frequently observed in those with CF, in addition to age and sex, is important when assessing low bone mass in children and adolescents with CF. To optimise an individual's potential to acquire maximal bone mass, it is necessary to maximise nutritional status and limit the progression of chronic suppurative lung disease. PMID:16384878

  16. Controlled longitudinal study of bone mass accrual in children and adolescents with cystic fibrosis.

    PubMed

    Buntain, H M; Schluter, P J; Bell, S C; Greer, R M; Wong, J C H; Batch, J; Lewindon, P; Wainwright, C E

    2006-02-01

    A study was undertaken to observe the gains in bone mass in children and adolescents with cystic fibrosis (CF) over 24 months and to examine the relationship between areal bone mineral density (aBMD) and associated clinical parameters including physical activity, nutrition, and 25-hydroxyvitamin D (25OHD). Areal BMD of the total body (TB), lumbar spine (LS), and total femoral neck (FNt) were repeatedly measured in 85 subjects aged 5-18 years with CF and 100 age and sex matched controls over 2 years. At each visit anthropometric variables, nutritional parameters, pubertal status, disease severity, physical activity, dietary calcium, caloric intake, and serum 25OHD were assessed and related to aBMD. After adjusting for age, sex, and height Z-score, gains in LS aBMD in children (5-10 years) and TB and FNt aBMD in adolescents (11-18 years) with CF were significantly less than in controls. Lean tissue mass was significantly associated with TB and LS aBMD gains in children and adolescents and explained a significant proportion of the aBMD deficit observed. Lung function parameters were significantly associated with aBMD gains in adolescents with CF. Inadequate bone mass accrual during childhood and adolescence contributes to the low bone mass observed in adults with CF. Accounting for the height discrepancy which is frequently observed in those with CF, in addition to age and sex, is important when assessing low bone mass in children and adolescents with CF. To optimise an individual's potential to acquire maximal bone mass, it is necessary to maximise nutritional status and limit the progression of chronic suppurative lung disease.

  17. Impact of aerosol size representation on modeling aerosol-cloud interactions

    DOE PAGES

    Zhang, Y.; Easter, R. C.; Ghan, S. J.; ...

    2002-11-07

    In this study, we use a 1-D version of a climate-aerosol-chemistry model with both modal and sectional aerosol size representations to evaluate the impact of aerosol size representation on modeling aerosol-cloud interactions in shallow stratiform clouds observed during the 2nd Aerosol Characterization Experiment. Both the modal (with prognostic aerosol number and mass or prognostic aerosol number, surface area and mass, referred to as the Modal-NM and Modal-NSM) and the sectional approaches (with 12 and 36 sections) predict total number and mass for interstitial and activated particles that are generally within several percent of references from a high resolution 108-section approach.more » The modal approach with prognostic aerosol mass but diagnostic number (referred to as the Modal-M) cannot accurately predict the total particle number and surface areas, with deviations from the references ranging from 7-161%. The particle size distributions are sensitive to size representations, with normalized absolute differences of up to 12% and 37% for the 36- and 12-section approaches, and 30%, 39%, and 179% for the Modal-NSM, Modal-NM, and Modal-M, respectively. For the Modal-NSM and Modal-NM, differences from the references are primarily due to the inherent assumptions and limitations of the modal approach. In particular, they cannot resolve the abrupt size transition between the interstitial and activated aerosol fractions. For the 12- and 36-section approaches, differences are largely due to limitations of the parameterized activation for non-log-normal size distributions, plus the coarse resolution for the 12-section case. Differences are larger both with higher aerosol (i.e., less complete activation) and higher SO2 concentrations (i.e., greater modification of the initial aerosol distribution).« less

  18. Dynamics of volcanic ash remobilisation by wind through the Patagonian steppe after the eruption of Cordón Caulle, 2011

    PubMed Central

    Panebianco, Juan E.; Mendez, Mariano J.; Buschiazzo, Daniel E.; Bran, Donaldo; Gaitán, Juan J.

    2017-01-01

    Wind erosion of freshly-deposited volcanic ash causes persistent storms, strongly affecting ecosystems and human activity. Wind erosion of the volcanic ash was measured up to 17 months after the ash deposition, at 7 sites located within the ash-deposition area. The mass flux was measured up to 1.5 m above ground level. Mass transport rates were over 125 times the soil wind-erosion rates observed before the ash deposition, reaching up to 6.3 kg m−1 day−1. Total mass transport of ash during the 17 months ranged between 113.6 and 969.9 kg m−1 depending on topographic location and wind exposure. The vertical distribution of the mass flux at sites with higher vegetation cover was generally inverted as compared to sites with lower vegetation cover. This situation lasted 7 months and then a shift towards a more uniform vertical distribution was observed, in coincidence with the beginning of the decline of the mass transport rates. Decay rates differed between sites. Despite changes over time, an inverse linear correlation between the mass transports and the mass-flux gradients was found. Both the mass-flux gradients and the average mass-transport rates were not linked with shear-stress partition parameters, but with the ratio: ash-fall thickness to total vegetation cover. PMID:28349929

  19. Dynamics of volcanic ash remobilisation by wind through the Patagonian steppe after the eruption of Cordón Caulle, 2011.

    PubMed

    Panebianco, Juan E; Mendez, Mariano J; Buschiazzo, Daniel E; Bran, Donaldo; Gaitán, Juan J

    2017-03-28

    Wind erosion of freshly-deposited volcanic ash causes persistent storms, strongly affecting ecosystems and human activity. Wind erosion of the volcanic ash was measured up to 17 months after the ash deposition, at 7 sites located within the ash-deposition area. The mass flux was measured up to 1.5 m above ground level. Mass transport rates were over 125 times the soil wind-erosion rates observed before the ash deposition, reaching up to 6.3 kg m -1 day -1 . Total mass transport of ash during the 17 months ranged between 113.6 and 969.9 kg m -1 depending on topographic location and wind exposure. The vertical distribution of the mass flux at sites with higher vegetation cover was generally inverted as compared to sites with lower vegetation cover. This situation lasted 7 months and then a shift towards a more uniform vertical distribution was observed, in coincidence with the beginning of the decline of the mass transport rates. Decay rates differed between sites. Despite changes over time, an inverse linear correlation between the mass transports and the mass-flux gradients was found. Both the mass-flux gradients and the average mass-transport rates were not linked with shear-stress partition parameters, but with the ratio: ash-fall thickness to total vegetation cover.

  20. Air emissions assessment from offshore oil activities in Sonda de Campeche, Mexico.

    PubMed

    Schifter, I; González-Macías, C; Miranda, A; López-Salinas, E

    2005-10-01

    Air emission data from offshore oil platforms, gas and oil processing installations and contribution of marine activities at the Sonda de Campeche, located at the Gulf of Mexico, were compiled and integrated to facilitate the study of long range transport of pollutants into the region. From this important region, roughly 76% of the total Mexican oil and gas production is obtained. It was estimated that the total air emissions of all contaminants are approximately 821,000 tons per year. Hydrocarbons are the largest pollutant emissions with 277,590 tons per year, generated during flaring activities, and SOx in second place with 185,907 tons per year. Marine and aviation activities contribute with less than 2% of total emissions. Mass of pollutants emitted per barrel of petroleum produced calculated in this work, are in the range reported by similar oil companies.

  1. Networks of connected Pt nanoparticles supported on carbon nanotubes as superior catalysts for methanol electrooxidation

    NASA Astrophysics Data System (ADS)

    Huang, Meihua; Zhang, Jianshuo; Wu, Chuxin; Guan, Lunhui

    2017-02-01

    The high cost and short lifetime of the Pt-based anode catalyst for methanol oxidation reaction (MOR) hamper the widespread commercialization of direct methanol fuel cell (DMFC). Therefore, improving the activity of Pt-based catalysts is necessary for their practical application. For the first time, we prepared networks of connected Pt nanoparticles supported on multi-walled carbon nanotubes with loading ratio as high as 91 wt% (Pt/MWCNTs). Thanks for the unique connected structure, the Pt mass activity of Pt/MWCNTs for methanol oxidation reaction is 4.4 times as active as that of the commercial Pt/C (20 wt%). When carbon support is considered, the total mass activity of Pt/MWCNTs is 20 times as active as that of the commercial Pt/C. The durability and anti-poisoning ability are also improved greatly.

  2. Negative correlation between body mass index category and physical activity perceptions in children.

    PubMed

    Van Zant, R Scott; Toney, Julie

    2012-10-01

    Children's physical activity (PA) choices are influenced by their perceived ability (adequacy) and inclination toward (predilection) PA. The study's purpose was to determine the association of body mass index (BMI) category with PA perceptions in sixth-grade children. A total of 267 children (119 boys, 148 girls; age 11+ y; ht 1.53 SD 0.08 m; wt 49.0 SD 13.5 kg; BMI 20.7 SD 4.8) provided informed consent and completed the study. All were measured for body weight and height and completed the Children's Self-perceptions of Adequacy in and Predilection for Physical Activity (CSAPPA) scale. Spearman rank-order correlation analysis was conducted between total CSAPPA score (and three factor scores of adequacy, predilection, and enjoyment) and BMI category relative to gender, body weight classification and for all children. A significant negative correlation was identified between BMI category (p<0.01) and CSAPPA total, adequacy, and predilection score for all children. Girls (but not boys) showed significant negative correlation between BMI category and all CSAPPA scores. A significant negative correlation in BMI category and PA perceptions exists in children, with the relationship being stronger in girls. Children with increased BMI may have adverse perceptions of PA and risks for sedentary behavior.

  3. A biorefinery for efficient processing and utilization of spent pulp of Colombian Andes Berry (Rubus glaucus Benth.): Experimental, techno-economic and environmental assessment.

    PubMed

    Dávila, Javier A; Rosenberg, Moshe; Cardona, Carlos A

    2017-01-01

    This work investigated a model biorefinery for producing phenolic compounds extract, ethanol and xylitol from spent blackberry pulp (SBP). The biorefinery was investigated according to four potential scenarios including mass and heat integrations as well as cogeneration system for supplying part of the energy requirements in the biorefinery. The investigated SBP had 61.54% holocellulose; its total phenolic compounds was equivalent to 2700mg of gallic acid/100g SBP, its anthocyanins content was 126.41mg/kg of SBP and its total antioxidant activity was 174.8μmol TE/g of SBP. The economic analysis revealed that the level of integration in the biorefinery significantly affected the total production cost. The sale-to-total-production-cost ratio indicated that both, mass and heat integrations are of importance relevance. The cost of supplies (enzymes and reagents) had the most significant impact on the total production cost and accounted between 46.72 and 58.95% of the total cost of the biorefinery. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Mercury mass measurement in fluorescent lamps via neutron activation analysis

    NASA Astrophysics Data System (ADS)

    Viererbl, L.; Vinš, M.; Lahodová, Z.; Fuksa, A.; Kučera, J.; Koleška, M.; Voljanskij, A.

    2015-11-01

    Mercury is an essential component of fluorescent lamps. Not all fluorescent lamps are recycled, resulting in contamination of the environment with toxic mercury, making measurement of the mercury mass used in fluorescent lamps important. Mercury mass measurement of lamps via instrumental neutron activation analysis (NAA) was tested under various conditions in the LVR-15 research reactor. Fluorescent lamps were irradiated in different positions in vertical irradiation channels and a horizontal channel in neutron fields with total fluence rates from 3×108 cm-2 s-1 to 1014 cm-2 s-1. The 202Hg(n,γ)203Hg nuclear reaction was used for mercury mass evaluation. Activities of 203Hg and others induced radionuclides were measured via gamma spectrometry with an HPGe detector at various times after irradiation. Standards containing an Hg2Cl2 compound were used to determine mercury mass. Problems arise from the presence of elements with a large effective cross section in luminescent material (europium, antimony and gadolinium) and glass (boron). The paper describes optimization of the NAA procedure in the LVR-15 research reactor with particular attention to influence of neutron self-absorption in fluorescent lamps.

  5. Improvement of carotenoid-synthesizing yeast Rhodotorula rubra by chemical mutagenesis.

    PubMed

    Frengova, Ginka I; Simova, Emilina D; Beshkova, Dora M

    2004-01-01

    A mutant Rhodotorula rubra with enhanced carotenoid-synthesizing activity for synthesizing total carotenoids and beta-carotene was obtained by N-methyl-N'-nitro-N-nitrosoguanidine mutagenesis. When co-cultivated with yogurt starter bacteria (Lactobacillus bulgaricus + Streptococcus thermophilus) in whey ultrafiltrate it produced 15.7 mg total carotenoids l(-1) culture fluid or 946 microg total carotenoids g(-1) dry cells of which 71% was beta-carotene. Grown as a monoculture in glucose substrate, the mutant shown 1.4 times lower carotenoid-synthesizing activity, and the relative share of beta-carotene in the total carotenoids was lower (63%). The individual pigments torulene and torularhodin were identified, whose mass fractions were (29% and 7%) and (24% and 4%), respectively, for the mutant grown as a monoculture and as a mixed culture with the yogurt bacteria.

  6. Association between Adult Stature and Energy Expenditure in Low-Income Women from Northeastern Brazil.

    PubMed

    Albuquerque, Fabiana Cristina Alves; Bueno, Nassib Bezerra; Clemente, Ana Paula Grotti; Ferriolli, Eduardo; Florêncio, Telma Maria Menezes Toledo; Hoffman, Daniel; Sawaya, Ana Lydia

    2015-01-01

    Perinatal undernutrition may lead to important metabolic adaptations in adult life, short stature being the most visible. The present study aimed to evaluate the association between stature and total energy expenditure of low-income women. Women aged 19-45 years from low-income communities in Maceió-AL were recruited. A sample of 67 volunteers was selected and divided into either short stature (≤ 152.4 cm; n = 34) or non-short stature (≥ 158.7 cm; n = 33) group. Data on socioeconomic status, anthropometric variables, and hormonal profiles was collected. Total energy expenditure and body composition were assessed by the doubly labeled water technique with multiple points over 14 days. In addition, physical activity levels were measured with triaxial accelerometers and dietary intake data were collected using three 24-hour food records. The mean subject age was 30.94 years. Women of short stature had lower body weight and lean body mass compared to non-short women, but there were no differences in thyroid hormone concentrations or daily energy intake between the two groups. Short-stature women showed lower total energy expenditure (P = 0.01) and a significantly higher physical activity level (P = 0.01) compared to non-short women. However, the difference in total energy expenditure was no longer significant after statistical adjustment for age, lean body mass, and triiodothyronine concentrations. Women with short stature present the same energy intake, but lower total energy expenditure than non-short women, even with a higher physical activity level, which suggests that they are more prone to weight gain.

  7. Tight control of disease activity fails to improve body composition or physical function in rheumatoid arthritis patients.

    PubMed

    Lemmey, Andrew B; Wilkinson, Thomas J; Clayton, Rebecca J; Sheikh, Fazal; Whale, John; Jones, Hope S J; Ahmad, Yasmeen A; Chitale, Sarang; Jones, Jeremy G; Maddison, Peter J; O'Brien, Thomas D

    2016-10-01

    RA typically features rheumatoid cachexia [loss of muscle mass (MM) and excessive total fat mass (TFM), especially trunk FM], which contributes to physical disability. Since rheumatoid cachexia is driven by inflammation, it would be anticipated that the success of tight control of disease activity, such as treat-to-target (T2T), in attenuating inflammation would benefit body composition and physical function. This aim of this cross-sectional study was to assess the impact of T2T on body composition and objectively assessed function in RA patients. A total of 82 RA patients exclusively treated by T2T, were compared with 85 matched sedentary healthy controls (HCs). Body composition was estimated by DXA, with appendicular lean mass the surrogate measure of total MM. Physical function was assessed by knee extensor strength, handgrip strength, 30 s sit-to-stands, 8' up and go, and 50' walk (tests which reflect the ability to perform activities of daily living). Although generally well treated (mean DAS28 = 2.8, with 49% in remission), RA patients had ∼10% proportionally less appendicular lean mass and were considerably fatter (by ∼27%), particularly in the trunk (∼32%), than HCs. All measures of function were 24-34% poorer in the RA patients relative to HC. Despite marked improvements in disease control (most patients achieving or approaching remission), the relative loss of MM and increased adiposity in RA patients compared with matched HCs was similar to that observed pre-T2T. Additionally, performance of objective function tests was unchanged from that reported by our group for pre-T2T RA patients. Thus T2T, even in responsive RA patients, did not attenuate rheumatoid cachexia or improve objectively assessed function. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Radiocarbon determination of fossil and contemporary carbon contribution to aerosol in the Pacific Islands.

    PubMed

    Isley, C F; Nelson, P F; Taylor, M P; Williams, A A; Jacobsen, G E

    2018-06-21

    Combustion emissions are of growing concern across all Pacific Island Countries, which account for >10,000 km 2 of the earth's surface area; as for many other small island states globally. Apportioning emissions inputs for Suva, the largest Pacific Island city, will aid in development of emission reduction strategies. Total suspended particulate (TSP) and fine particulate (PM 2.5 ) samples were collected for Suva City, a residential area (Kinoya, TSP) and a mainly ocean-influenced site (Suva Point, TSP) from 2014 to 2015. Percentages of contemporary and fossil carbon were determined by radiocarbon analysis (accelerator mass spectrometry); for non‑carbonate carbon (NCC), elemental carbon (EC) and organic carbon (OC). Source contributions to particulate matter were identified and the accuracy of previous emissions inventory and source apportionment studies was evaluated. Suva Point NCC concentrations (2.7 ± 0.4 μg/m 3 ) were four times lower than for City (13 ± 2 μg/m 3 in TSP) and Kinoya (13 ± 1 μg/m 3 in TSP); demonstrating the contribution of land-based emissions activities in city and residential areas. In Suva City, total NCC in air was 81% (79%-83%) fossil carbon, from vehicles, shipping, power generation and industry; whilst in the residential area, 48% (46%-50%) of total NCC was contemporary carbon; reflecting the higher incidence of biomass and waste burning and of cooking activities. Secondary organic fossil carbon sources contributed >36% of NCC mass at the city and >29% at Kinoya; with biogenic carbon being Kinoya's most significant source (approx. 30% of NCC mass). These results support the previous source apportionment studies for the city area; yet show that, in line with emissions inventory studies, biomass combustion contributes more PM 2.5 mass in residential areas. Hence air quality management strategies need to target open burning activities as well as fossil fuel combustion. Copyright © 2018 Elsevier B.V. All rights reserved.

  9. Particulate matter oxidative potential from waste transfer station activity.

    PubMed

    Godri, Krystal J; Duggan, Sean T; Fuller, Gary W; Baker, Tim; Green, David; Kelly, Frank J; Mudway, Ian S

    2010-04-01

    Adverse cardiorespiratory health is associated with exposure to ambient particulate matter (PM). The highest PM concentrations in London occur in proximity to waste transfer stations (WTS), sites that experience high numbers of dust-laden, heavy-duty diesel vehicles transporting industrial and household waste. Our goal was to quantify the contribution of WTS emissions to ambient PM mass concentrations and oxidative potential. PM with a diameter < 10 microm (PM10) samples were collected daily close to a WTS. PM10 mass concentrations measurements were source apportioned to estimate local versus background sources. PM oxidative potential was assessed using the extent of antioxidant depletion from a respiratory tract lining fluid model. Total trace metal and bioavailable iron concentrations were measured to determine their contribution to PM oxidative potential. Elevated diurnal PM10 mass concentrations were observed on all days with WTS activity (Monday-Saturday). Variable PM oxidative potential, bioavailable iron, and total metal concentrations were observed on these days. The contribution of WTS emissions to PM at the sampling site, as predicted by microscale wind direction measurements, was correlated with ascorbate (r = 0.80; p = 0.030) and glutathione depletion (r = 0.76; p = 0.046). Increased PM oxidative potential was associated with aluminum, lead, and iron content. PM arising from WTS activity has elevated trace metal concentrations and, as a consequence, increased oxidative potential. PM released by WTS activity should be considered a potential health risk to the nearby residential community.

  10. (238)U and total radioactivity in drinking waters in Van province, Turkey.

    PubMed

    Selçuk Zorer, Özlem; Dağ, Beşir

    2014-06-01

    As part of the national survey to evaluate natural radioactivity in the environment, concentration levels of total radioactivity and natural uranium have been analysed in drinking water samples. A survey to study natural radioactivity in drinking waters was carried out in the Van province, East Turkey. Twenty-three samples of drinking water were collected in the Van province and analysed for total α, total β and (238)U activity. The total α and total β activities were counted by using the α/β counter of the multi-detector low background system (PIC MPC-9604), and the (238)U concentrations were determined by inductively coupled plasma-mass spectrometry (Thermo Scientific Element 2). The samples were categorised according to origin: tap, spring or mineral supply. The activity concentrations for total α were found to range from 0.002 to 0.030 Bq L(-1) and for total β from 0.023 to 1.351 Bq L(-1). Uranium concentrations ranging from 0.562 to 14.710 μg L(-1) were observed in drinking waters. Following the World Health Organisation rules, all investigated waters can be used as drinking water.

  11. Nonexercise movement in elderly compared with young people.

    PubMed

    Harris, Ann M; Lanningham-Foster, Lorraine M; McCrady, Shelly K; Levine, James A

    2007-04-01

    The association between free-living daily activity and aging is unclear because nonexercise movement and its energetic equivalent, nonexercise activity thermogenesis, have not been exhaustively studied in the elderly. We wanted to address the hypothesis that free-living nonexercise movement is lower in older individuals compared with younger controls matched for lean body mass. Ten lean, healthy, sedentary elderly and 10 young subjects matched for lean body mass underwent measurements of nonexercise movement and body posture over 10 days using sensitive, validated technology. In addition, energy expenditure was assessed using doubly labeled water and indirect calorimetry. Total nonexercise movement (acceleration arbitrary units), standing time, and standing acceleration were significantly lower in the elderly subjects; this was specifically because the elderly walked less distance per day despite having a similar number of walking bouts per day compared with the young individuals. The energetic cost of basal metabolic rate, thermic effect of food, total daily energy expenditure, and nonexercise activity thermogenesis were not different between the elderly and young groups. Thus, the energetic cost of walking in the elderly may be greater than in the young. Lean, healthy elderly individuals may have a biological drive to be less active than the young.

  12. Multimeric species in equilibrium in detergent-solubilized Na,K-ATPase.

    PubMed

    Yoneda, Juliana Sakamoto; Scanavachi, Gustavo; Sebinelli, Heitor Gobbi; Borges, Júlio Cesar; Barbosa, Leandro R S; Ciancaglini, Pietro; Itri, Rosangela

    2016-08-01

    In this work, we find an equilibrium between different Na,K-ATPase (NKA) oligomeric species solubilized in a non-ionic detergent C12E8 by means of Dynamic Light Scattering (DLS), Analytical Ultracentrifugation (AUC), Small Angle X-ray Scattering (SAXS), Spectrophotometry (absorption at 280/350nm) and enzymatic activity assay. The NKA sample after chromatography purification presented seven different populations as identified by AUC, with monomers and tetramers amounting to ∼55% of the total protein mass in solution. These two species constituted less than 40% of the total protein mass after increasing the NKA concentration. Removal of higher-order oligomer/aggregate species from the NKA solution using 220nm-pore filter resulted in an increase of the specific enzymatic activity. Nevertheless, the enzyme forms new large aggregates over an elapsed time of 20h. The results thus point out that C12E8-solubilized NKA is in a dynamic equilibrium of monomers, tetramers and high-order oligomers/subunit aggregates. These latter have low or null activity. High amount of detergent leads to the dissociation of NKA into smaller aggregates with no enzymatic activity. Copyright © 2016. Published by Elsevier B.V.

  13. Large areal mass, flexible and free-standing reduced graphene oxide/manganese dioxide paper for asymmetric supercapacitor device.

    PubMed

    Sumboja, Afriyanti; Foo, Ce Yao; Wang, Xu; Lee, Pooi See

    2013-05-28

    Well-separated RGO sheets decorated with MnO2 nanoparticles facilitate easy access of the electrolyte ions to the high surface area of the paper electrode, enabling the fabrication of a thicker electrode with heavier areal mass and higher areal capacitance (up to 897 mF cm(-2) ). The electrochemical performance of the bent asymmetric device with a total active mass of 15 mg remains similar to the one in the flat configuration, demonstrating good mechanical robustness of the device. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Exposures to Transit and Other Sources of Noise among New York City Residents

    PubMed Central

    Neitzel, Richard L.; Gershon, Robyn R. M.; McAlexander, Tara P.; Magda, Lori A.; Pearson, Julie M.

    2015-01-01

    To evaluate the contributions of common noise sources to total annual noise exposures among urban residents and workers, we estimated exposures associated with five common sources (use of mass transit, occupational and non-occupational activities, MP3 player and stereo use, and time at home and doing other miscellaneous activities) among a sample of over 4500 individuals in New York City (NYC). We then evaluated the contributions of each source to total noise exposure and also compared our estimated exposures to the recommended 70 dBA annual exposure limit. We found that one in ten transit users had noise exposures in excess of the recommended exposure limit from their transit use alone. When we estimated total annual exposures, 90% of NYC transit users and 87% of nonusers exceeded the recommended limit. MP3 player and stereo use, which represented a small fraction of the total annual hours for each subject on average, was the primary source of exposure among the majority of urban dwellers we evaluated. Our results suggest that the vast majority of urban mass transit riders may be at risk of permanent, irreversible noise-induced hearing loss and that, for many individuals, this risk is driven primarily by exposures other than occupational noise. PMID:22088203

  15. ATriple Iron triathlon leads to a decrease in total body mass but not to dehydration.

    PubMed

    Knechtle, Beat; Knechtle, Patrizia; Rosemann, Thomas; Oliver, Senn

    2010-09-01

    A loss in total body mass during an ultraendurance performance is usually attributed to dehydration. We identified the changes in total body mass, fat mass, skeletal muscle mass, and selected markers of hydration status in 31 male nonprofessional ultratriathletes participating in a Triple Iron triathlon involving 11.4 km swimming, 540 km cycling and 126.6 km running. Measurements were taken prior to starting the race and after arrival at the finish line. Total body mass decreased by 1.66 kg (SD = 1.92; -5.3 kg to +1.2 kg; p < .001), skeletal muscle mass by 1.00 kg (SD = 0.90; -2.54 kg to +2.07 kg; p < .001), and fat mass by 0.58 kg (SD = 0.78; -1.74 kg to +0.87 kg; p < .001). The decrease in total body mass was associated with the decrease in skeletal muscle mass (r = .44; p < .05) and fat mass (r = .51; p < .05). Total body water and urinary specific gravity did not significantly change. Plasma urea increased significantly (p < .001); the decrease in skeletal muscle mass and the increase in plasma urea were associated (r = .39; p < .05). We conclude that completing a Triple Iron triathlon leads to decreased total body mass due to reduced fat mass and skeletal muscle mass but not to dehydration. The association of decrease in skeletal muscle mass and increased plasma urea suggests a loss in skeletal muscle mass.

  16. Preparation of fly ash-granulated blast furnace slag-carbide slag binder and application in total tailings paste backfill

    NASA Astrophysics Data System (ADS)

    Li, Chao; Hao, Ya-fei; Zhao, Feng-qing

    2018-03-01

    Based on activation and synergistic effect among various materials, a low-cost mine backfill cementing material, FGC binder, was prepared by using fly ash, granulated blast-furnace slag (GBFS), carbide slag and composite activator. The proper proportioning of FGC binder is obtained by response surface experiment optimization method: fly ash 62 %, GBFS 20 %, carbide slag 8 % and compound activators 10 %. Adjusting the material ratio obtains different cementing material which could satisfy requirements of different mined-out areas. With the mass ratio of cementing material and tailings 1:4∼1:8, the concentration of total solid 70 %, the compressive strength values of total tailings filling body at 28 d reaches 1.64∼4.14 MPa, and the backfilling cost is 20 % lower than using OPC cement.

  17. Electromyography analysis of natural mastication behavior using varying mouthful quantities of two types of gels.

    PubMed

    Kohyama, Kaoru; Gao, Zhihong; Ishihara, Sayaka; Funami, Takahiro; Nishinari, Katsuyoshi

    2016-07-01

    The objectives of this study were to examine the effects of mouthful quantities and mechanical properties of gels on natural mastication behaviors using electromyography (EMG). Two types of hydrocolloid gels (A and K) with similar fracture loads but different moduli and fracture strains were served to eleven normal women in 3-, 6-, 12-, and 24-g masses in a randomized order. EMG activities from both masseter muscles were recorded during natural mastication. Because of the similar fracture loads, the numbers of chews, total muscle activities, and entire oral processing times were similar for similar masses of both gel types. Prior to the first swallow, the more elastic K gel with a higher fracture strain required higher muscle activities than the brittle A gel, which had higher modulus. Majority of subjects had preferred sides of chewing, but all subjects with or without preferred sides used both masseters during the consumption of gels. Similar effects of masses and types of gels were observed in EMG activities of both sides of masseters. Contributions of the dominant side of chewing were diminished with increasing masses of gels, and the mass dependency on ratio of the dominant side was more pronounced with K gel. More repetitions of smaller masses required greater muscle activities and longer periods for the consumption of 24-g gel portions. Reduction in the masses with an increased number of repetitions necessitated slower eating and more mastication to consume the gel portions. These observations suggest that chewing using both sides is more effective and unconsciously reduces mastication times during the consumption of gels. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Physical activity benefits bone density and bone-related hormones in adult men with cervical spinal cord injury.

    PubMed

    Chain, Amina; Koury, Josely C; Bezerra, Flávia Fioruci

    2012-09-01

    Severe bone loss is a recognized complication of chronic spinal cord injury (SCI). Physical exercise contributes to bone health; however, its influence on bone mass of cervical SCI individuals has not been investigated. The aim of this study was to investigate the influence of physical activity on bone mass, bone metabolism, and vitamin D status in quadriplegics. Total, lumbar spine (L1-L4), femur and radius bone mineral density (BMD) were assessed in active (n = 15) and sedentary (n = 10) quadriplegic men by dual energy X-ray absorptiometry. Concentrations of 25-hydroxyvitamin D [25(OH)D], PTH, IGF1, osteocalcin and NTx were measured in serum. After adjustments for duration of injury, total body mass, and habitual calcium intake, bone indices were similar between groups, except for L1-L4 BMD Z score that was higher in the sedentary group (P < 0.05). Hours of physical exercise per week correlated positively with 25(OH)D (r = 0.59; P < 0.05) and negatively with PTH (r = -0.50; P < 0.05). Femur BMD was negatively associated with the number of months elapsed between the injury and the onset of physical activity (r = -0.60; P < 0.05). Moreover, in the active subjects, both L1-L4 BMD Z score (r = 0.72; P < 0.01) and radius BMD (r = 0.59; P < 0.05) were positively associated with calcium intake. In this cross-sectional study, both the onset of physical activity after injury and the number of hours dedicated to exercise were able to influence bone density and bone-related hormones in quadriplegic men. Our results also suggest a positive combined effect of exercise and calcium intake on bone health of quadriplegic individuals.

  19. Physical activity and body mass index among women who have experienced infertility

    PubMed Central

    Esmaeilzadeh, Seddigheh; Basirat, Zahra; Shafi, Hamid

    2013-01-01

    Introduction The experience of infertility is a common medical condition in the developing countries. The aim of this retrospective epidemiologic study was to determine fertility status and parity in Babol, Iran and then identify physical activity and body mass index (BMI) among women who have experienced infertility. Material and methods A total of 1,081 women aged 20-45 years were selected using cluster sampling. The current physical activity was measured using the original International Physical Activity Questionnaire short form. Lifestyle factors were compared between those who had experienced infertility (n = 168) and the rest of the women. A face-to-face household interview was conducted using a specially designed interview questionnaire. Results After adjusting for suspected confounding factors, women with infertility experience had a 4.8-fold increased risk of obesity (OR = 2.02, CI = 0.70, 5.84) and almost a 3.8-fold increased risk of being overweight (OR = 2.11, CI = 0.72, 6.17) compared to women without infertility. No significant differences were found in Met-minutes of sedentary activity, intensity of walking, moderate, vigorous, and total physical activity, self-reported dietary intake, exercise, and level of physical activity between women with and without experience of infertility. Conclusions Since both obesity and infertility are increasing public health issues in Iranian women, more attention should be paid to lifestyle behaviors, especially gaining weight in women who have experienced infertility. PMID:23847673

  20. Interplanetary Coronal Mass Ejection effects on thermospheric density as inferred from International Space Station orbital data

    NASA Astrophysics Data System (ADS)

    Mendaza, T.; Blanco-Ávalos, J. J.; Martín-Torres, J.

    2017-11-01

    The solar activity induces long term and short term periodical variations in the dynamics and composition of Earth's atmosphere. The Sun also shows non periodical (i.e., impulsive) activity that reaches the planets orbiting around it. In particular, Interplanetary Coronal Mass Ejections (ICMEs) reach Earth and interact with its magnetosphere and upper neutral atmosphere. Nevertheless, the interaction with the upper atmosphere is not well characterized because of the absence of regular and dedicated in situ measurements at high altitudes; thus, current descriptions of the thermosphere are based on semi empirical models. In this paper, we present the total neutral mass densities of the thermosphere retrieved from the orbital data of the International Space Station (ISS) using the General Perturbation Method, and we applied these densities to routinely compiled trajectories of the ISS in low Earth orbit (LEO). These data are explicitly independent of any atmospheric model. Our density values are consistent with atmospheric models, which demonstrates that our method is reliable for the inference of thermospheric density. We have inferred the thermospheric total neutral density response to impulsive solar activity forcing from 2001 to the end of 2006 and determined how solar events affect this response. Our results reveal that the ISS orbital parameters can be used to infer the thermospheric density and analyze solar effects on the thermosphere.

  1. Characterization of active and total fungal communities in the atmosphere over the Amazon rainforest

    NASA Astrophysics Data System (ADS)

    Womack, A. M.; Artaxo, P. E.; Ishida, F. Y.; Mueller, R. C.; Saleska, S. R.; Wiedemann, K. T.; Bohannan, B. J. M.; Green, J. L.

    2015-11-01

    Fungi are ubiquitous in the atmosphere and may play an important role in atmospheric processes. We investigated the composition and diversity of fungal communities over the Amazon rainforest canopy and compared these communities to fungal communities found in terrestrial environments. We characterized the total fungal community and the metabolically active portion of the community using high-throughput DNA and RNA sequencing and compared these data to predictions generated by a mass-balance model. We found that the total community was primarily comprised of fungi from the phylum Basidiomycota. In contrast, the active community was primarily composed of members of the phylum Ascomycota and included a high relative abundance of lichen fungi, which were not detected in the total community. The relative abundance of Basidiomycota and Ascomycota in the total and active communities was consistent with our model predictions, suggesting that this result was driven by the relative size and number of spores produced by these groups. When compared to other environments, fungal communities in the atmosphere were most similar to communities found in tropical soils and leaf surfaces. Our results demonstrate that there are significant differences in the composition of the total and active fungal communities in the atmosphere, and that lichen fungi, which have been shown to be efficient ice nucleators, may be abundant members of active atmospheric fungal communities over the forest canopy.

  2. Gender-specific association between dietary acid load and total lean body mass and its dependency on protein intake in seniors.

    PubMed

    Faure, A M; Fischer, K; Dawson-Hughes, B; Egli, A; Bischoff-Ferrari, H A

    2017-12-01

    Diet-related mild metabolic acidosis may play a role in the development of sarcopenia. We investigated the relationship between dietary acid load and total lean body mass in male and female seniors age ≥ 60 years. We found that a more alkaline diet was associated with a higher %TLM only among senior women. The aim of this study was to determine if dietary acid load is associated with total lean body mass in male and female seniors age ≥ 60 years. We investigated 243 seniors (mean age 70.3 ± 6.3; 53% women) age ≥ 60 years who participated in the baseline assessment of a clinical trial on vitamin D treatment and rehabilitation after unilateral knee replacement due to severe knee osteoarthritis. The potential renal acid load (PRAL) was assessed based on individual nutrient intakes derived from a food frequency questionnaire. Body composition including percentage of total lean body mass (%TLM) was determined using dual-energy X-ray absorptiometry. Cross-sectional analyses were performed for men and women separately using multivariable regression models controlling for age, physical activity, smoking status, protein intake (g/kg BW per day), energy intake (kcal), and serum 25-hydroxyvitamin D concentration. We included a pre-defined subgroup analysis by protein intake (< 1 g/kg BW day, > 1 g/kg BW day) and by age group (< 70 years, ≥ 70 years). Adjusted %TLM decreased significantly across PRAL quartiles only among women (P trend  = 0.004). Moreover, in subgroup analysis, the negative association between the PRAL and %TLM was most pronounced among women with low protein intake (< 1 g/kg BW per day) and age below 70 years (P = 0.002). Among men, there was no association between the PRAL and %TLM. The association between dietary acid load and %TLM seems to be gender-specific, with a negative impact on total lean mass only among senior women. Therefore, an alkaline diet may be beneficial for preserving total lean mass in senior women, especially in those with low protein intake.

  3. 40 CFR 63.1413 - Compliance demonstration procedures.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... HAP concentration. (iii) For a carbon adsorption system that regenerates the carbon bed directly... organic compound concentration level, adsorption cycle time, number and capacity of carbon beds, type and working capacity of activated carbon used for carbon beds, design total regeneration stream mass or...

  4. Diet quality as measured by the Diet Quality Index-International is associated with prospective changes in body fat among Canadian children.

    PubMed

    Setayeshgar, Solmaz; Maximova, Katerina; Ekwaru, John Paul; Gray-Donald, Katherine; Henderson, Mélanie; Paradis, Gilles; Tremblay, Angelo; Veugelers, Paul

    2017-02-01

    To quantify the association of dietary quality with prospective changes in adiposity. Children participating in the QUALITY (QUebec Adipose and Lifestyle InvesTigation in Youth) study underwent examination at baseline and at 2-year follow-up. Dietary quality was assessed by the Diet Quality Index-International (DQII) using three non-consecutive 24 h diet recalls at baseline. The DQII has four main categories: dietary adequacy, variety, moderation and overall balance. Fat mass index (FMI; [fat mass (kg)]/[height (m)]2), central FMI (CFMI; [trunk fat mass (kg)]/[height (m)]2), percentage body fat (%BF; [total fat mass (kg)]/[total mass (kg)]) and percentage central BF (%CBF; [trunk fat mass (kg)]/[total mass (kg)]) were assessed through dual-energy X-ray absorptiometry. Children were selected from schools in the greater Montreal, Sherbrooke and Quebec City metropolitan areas between 2005 and 2008, Quebec, Canada. A total of 546 children aged 8-10 years, including 244 girls and 302 boys. Regression analysis adjusting for age, sex, energy intake, physical activity and Tanner stage revealed that every 10-unit improvement in overall DQII score was associated with lower gain in CFMI (β=-0·08; 95 % CI -0·17, -0·003) and %BF (β=-0·55; 95 % CI -1·08, -0·02). Each unit improvement in dietary adequacy score was associated with lower gain in FMI (β=-0·05; 95 % CI -0·08, -0·008), CFMI (β=-0·03; 95 % CI -0·05, -0·007), %BF (β=-0·15; 95 % CI -0·28, -0·03) and %CBF (β=-0·09; 95 % CI -0·15, -0·02). Promotion of dietary quality and adequacy may reduce weight gain in childhood and prevent chronic diseases later in life.

  5. Projecting the environmental profile of Singapore's landfill activities: Comparisons of present and future scenarios based on LCA.

    PubMed

    Khoo, Hsien H; Tan, Lester L Z; Tan, Reginald B H

    2012-05-01

    This article aims to generate the environmental profile of Singapore's Semakau landfill by comparing three different operational options associated with the life cycle stages of landfilling activities, against a 'business as usual' scenario. Before life cycle assessment or LCA is used to quantify the potential impacts from landfilling activities, an attempt to incorporate localized and empirical information into the amounts of ash and MSW sent to the landfill was made. A linear regression representation of the relationship between the mass of waste disposed and the mass of incineration ash generated was modeled from waste statistics between years 2004 and 2009. Next, the mass of individual MSW components was projected from 2010 to 2030. The LCA results highlighted that in a 'business as usual' scenario the normalized total impacts of global warming, acidification and human toxicity increased by about 2% annually from 2011 to 2030. By replacing the 8000-tonne barge with a 10000-tonne coastal bulk carrier or freighter (in scenario 2) a grand total reduction of 48% of both global warming potential and acidification can be realized by year 2030. Scenario 3 explored the importance of having a Waste Water Treatment Plant in place to reduce human toxicity levels - however, the overall long-term benefits were not as significant as scenario 2. It is shown in scenario 4 that the option of increased recycling championed over all other three scenarios in the long run, resulting in a total 58% reduction in year 2030 for the total normalized results. A separate comparison of scenarios 1-4 is also carried out for energy utilization and land use in terms of volume of waste occupied. Along with the predicted reductions in environmental burdens, an additional bonus is found in the expanded lifespan of Semakau landfill from year 2032 (base case) to year 2039. Model limitations and suggestions for improvements were also discussed. Copyright © 2011 Elsevier Ltd. All rights reserved.

  6. Weight loss after therapy of hypothyroidism is mainly caused by excretion of excess body water associated with myxoedema.

    PubMed

    Karmisholt, Jesper; Andersen, Stig; Laurberg, Peter

    2011-01-01

    In hypothyroidism, resting energy expenditure (REE) is reduced and weight gain is common. Physical activity contributes to the total daily energy expenditure, and changes in physical activity might contribute to hypothyroid-associated weight changes. The objective of the present study was to evaluate mechanisms involved in body weight changes associated with hypothyroidism. We conducted a 1-yr controlled follow-up study on outpatients newly diagnosed with hypothyroidism (n = 12) and a euthyroid measurement control group (n = 10). MAIN OUTCOME AND INTERVENTIONS: Changes in body mass and composition (dual-energy x-ray analysis scan), REE (indirect calorimetry), and spontaneous physical activity (pedometers and two different questionnaires) were studied before and after 12 months of L-T(4) therapy or observation (control group). TSH changed from 102 (85) to 2.2 (2.1) mU/liter mean (SD) and free T(4) from 4.5 (2.1) to 18 (3.3) pmol/liter after 1 yr of treatment. Body weight decreased from 83.7 (16.4) to 79.4 (16.0) kg (P = 0.002) due to change in the lean mass subcompartment only (P = 0.001) because fat and bone mass was virtually unchanged. Significant increase was observed in REE and in physical activity measured with questionnaires but not measured as daily steps. No significant changes were observed in the control group. L-T(4) therapy of hypothyroidism associated with significant decrease in body weight and increase in REE. Physical activity measured with questionnaires increased significantly, but not number of daily steps. Despite changes in REE and body weight, fat mass was unchanged during the study. We propose that total body energy equilibrium is maintained during treatment of hypothyroidism and that weight loss observed during such treatment is caused by excretion of excess body water associated with untreated myxoedema.

  7. Mapping Greenland’s mass loss in space and time

    PubMed Central

    Harig, Christopher; Simons, Frederik J.

    2012-01-01

    The melting of polar ice sheets is a major contributor to global sea-level rise. Early estimates of the mass lost from the Greenland ice cap, based on satellite gravity data collected by the Gravity Recovery and Climate Experiment, have widely varied. Although the continentally and decadally averaged estimated trends have now more or less converged, to this date, there has been little clarity on the detailed spatial distribution of Greenland’s mass loss and how the geographical pattern has varied on relatively shorter time scales. Here, we present a spatially and temporally resolved estimation of the ice mass change over Greenland between April of 2002 and August of 2011. Although the total mass loss trend has remained linear, actively changing areas of mass loss were concentrated on the southeastern and northwestern coasts, with ice mass in the center of Greenland steadily increasing over the decade. PMID:23169646

  8. The increase in physical performance and gain in lean and fat mass occur in prepubertal children independent of mode of school transportation. One year data from the prospective controlled Pediatric Osteoporosis Prevention (POP) Study

    PubMed Central

    2009-01-01

    Background The aim of this 12-month study in pre-pubertal children was to evaluate the effect of school transportation on gain in lean and fat mass, muscle strength and physical performance. Methods Ninety-seven girls and 133 boys aged 7-9 years from the Malmö Pediatric Osteoporosis Prevention Study were included. Regional lean and fat mass were assessed by dual energy X-ray absorptiometry, isokinetic peak torque of knee extensors and flexors by a computerised dynamometer and physical performance by vertical jump height. Level of physical activity was assessed by accelerometers. The 12-month changes in children who walked or cycled to school were compared with changes in those who travelled by bus or car. Results There were no differences in baseline or annual changes in lean or fat mass gain, muscle strength or physical performance between the two groups. All children reached the internationally recommended level of 60 minutes per day of moderate or high physical activity by accelerometers. Conclusion The choice of school transportation in pre-pubertal children seems not to influence the gain in lean and fat mass, muscle strength or functional ability, probably as the everyday physical activity is so high that the mode of school transportation contributes little to the total level of activity.

  9. A randomised placebo-exercise controlled trial of Kung Fu training for improvements in body composition in overweight/obese adolescents: the “Martial Fitness” study

    PubMed Central

    Tsang, Tracey W.; Kohn, Michael; Chow, Chin Moi; Singh, M Fiatarone

    2009-01-01

    The purpose of the study was to investigate if Chinese martial arts (Kung Fu, KF) might be effective for improving body composition, as well as being an appealing form of physical activity for inexperienced, sedentary, overweight/obese adolescents. Twenty subjects (age: 13.3 ± 1.8 y; BMI percentile: 98.6(86.5 - 99.8); 60% girls) were randomly-assigned to the supervised KF or placebo (Tai Chi, TC) control group 3 d.wk-1 for 6 months. We assessed body composition, including total and regional fat and lean mass, total and regional bone mineral density (BMD), percent lean and fat mass, body mass index and waist circumference, at baseline and after 6 months of training using anthropometry and dual-energy X-ray absorptiometry (DXA). Habitual physical activity and dietary intake were recorded as covariates via self-report at each time-point. As expected due to natural growth, significant increases in height, weight, total and lumbar BMD, and lean mass were seen in the cohort over time, with a trend for increased whole body fat mass, with no difference between groups. By contrast, percent fat and android fat mass via DXA did not increase in either group over time. The absence of a similar expected increase in central adiposity over 6 months could indicate a positive effect of participation in both programs on the metabolically critical abdominal adiposity in this cohort. Further research in this area is warranted to determine ways to increase uptake and compliance, and to see if longer-term martial arts training not only maintains, but improves abdominal fat mass and related metabolic health indices in overweight/ obese adolescents. Key points Participation in our martial arts trial attenuated the increases in body fat mass expected due to growth in our overweight/obese adolescent group. All subjects allocated to the Kung Fu intervention were satisfied with their Kung Fu training, in contrast to our placebo-exercise (Tai Chi) subjects, suggesting that this form of exercise is worth investigating further for adherence and efficacy. This was the first randomized, placebo-exercise controlled trial to be conducted, examining the effects of martial arts training alone on body composition in sedentary overweight/obese adolescents. Larger, longer-term trials are required to confirm our findings. PMID:24150562

  10. Reproducibility of lung tumor position and reduction of lung mass within the planning target volume using active breathing control (ABC).

    PubMed

    Cheung, Patrick C F; Sixel, Katharina E; Tirona, Romeo; Ung, Yee C

    2003-12-01

    The active breathing control (ABC) device allows for temporary immobilization of respiratory motion by implementing a breath hold at a predefined relative lung volume and air flow direction. The purpose of this study was to quantitatively evaluate the ability of the ABC device to immobilize peripheral lung tumors at a reproducible position, increase total lung volume, and thereby reduce lung mass within the planning target volume (PTV). Ten patients with peripheral non-small-cell lung cancer tumors undergoing radiotherapy had CT scans of their thorax with and without ABC inspiration breath hold during the first 5 days of treatment. Total lung volumes were determined from the CT data sets. Each peripheral lung tumor was contoured by one physician on all CT scans to generate gross tumor volumes (GTVs). The lung density and mass contained within a 1.5-cm PTV margin around each peripheral tumor was calculated using CT numbers. Using the center of the GTV from the Day 1 ABC scan as the reference, the displacement of subsequent GTV centers on Days 2 to 5 for each patient with ABC applied was calculated in three dimensions. With the use of ABC inspiration breath hold, total lung volumes increased by an average of 42%. This resulted in an average decrease in lung mass of 18% within a standard 1.5-cm PTV margin around the GTV. The average (+/- standard deviation) displacement of GTV centers with ABC breath hold applied was 0.3 mm (+/- 1.8 mm), 1.2 mm (+/- 2.3 mm), and 1.1 mm (+/- 3.5 mm) in the lateral direction, anterior-posterior direction, and superior-inferior direction, respectively. Results from this study indicate that there remains some inter-breath hold variability in peripheral lung tumor position with the use of ABC inspiration breath hold, which prevents significant PTV margin reduction. However, lung volumes can significantly increase, thereby decreasing the mass of lung within a standard PTV.

  11. ALOX12 polymorphisms are associated with fat mass but not peak bone mineral density in Chinese nuclear families.

    PubMed

    Xiao, W-J; He, J-W; Zhang, H; Hu, W-W; Gu, J-M; Yue, H; Gao, G; Yu, J-B; Wang, C; Ke, Y-H; Fu, W-Z; Zhang, Z-L

    2011-03-01

    Arachidonate 12-lipoxygenase (ALOX12) is a member of the lipoxygenase superfamily, which catalyzes the incorporation of molecular oxygen into polyunsaturated fatty acids. The products of ALOX12 reactions serve as endogenous ligands for peroxisome proliferator-activated receptor γ (PPARG). The activation of the PPARG pathway in marrow-derived mesenchymal progenitors stimulates adipogenesis and inhibits osteoblastogenesis. Our objective was to determine whether polymorphisms in the ALOX12 gene were associated with variations in peak bone mineral density (BMD) and obesity phenotypes in young Chinese men. All six tagging single-nucleotide polymorphisms (SNPs) in the ALOX12 gene were genotyped in a total of 1215 subjects from 400 Chinese nuclear families by allele-specific polymerase chain reaction. The BMD at the lumbar spine and hip, total fat mass (TFM) and total lean mass (TLM) were measured using dual-energy X-ray absorptiometry. The pairwise linkage disequilibrium among SNPs was measured, and the haplotype blocks were inferred. Both the individual SNP markers and the haplotypes were tested for an association with the peak BMD, body mass index, TFM, TLM and percentage fat mass (PFM) using the quantitative transmission disequilibrium test (QTDT). Using the QTDT, significant within-family association was found between the rs2073438 polymorphism in the ALOX12 gene and the TFM and PFM (P=0.007 and 0.012, respectively). Haplotype analyses were combined with our individual SNP results and remained significant even after correction for multiple testing. However, we failed to find significant within-family associations between ALOX12 SNPs and the BMD at any bone site in young Chinese men. Our present results suggest that the rs2073438 polymorphism of ALOX12 contributes to the variation of obesity phenotypes in young Chinese men, although we failed to replicate the association with the peak BMD variation in this sample. Further independent studies are needed to confirm our findings.

  12. Microphysical processing of aerosol particles in orographic clouds

    NASA Astrophysics Data System (ADS)

    Pousse-Nottelmann, S.; Zubler, E. M.; Lohmann, U.

    2015-01-01

    An explicit and detailed treatment of cloud-borne particles allowing for the consideration of aerosol cycling in clouds has been implemented in the regional weather forecast and climate model COSMO. The effects of aerosol scavenging, cloud microphysical processing and regeneration upon cloud evaporation on the aerosol population and on subsequent cloud formation are investigated. For this, two-dimensional idealized simulations of moist flow over two bell-shaped mountains were carried out varying the treatment of aerosol scavenging and regeneration processes for a warm-phase and a mixed-phase orographic cloud. The results allowed to identify different aerosol cycling mechanisms. In the simulated non-precipitating warm-phase cloud, aerosol mass is incorporated into cloud droplets by activation scavenging and released back to the atmosphere upon cloud droplet evaporation. In the mixed-phase cloud, a first cycle comprises cloud droplet activation and evaporation via the Wegener-Bergeron-Findeisen process. A second cycle includes below-cloud scavenging by precipitating snow particles and snow sublimation and is connected to the first cycle via the riming process which transfers aerosol mass from cloud droplets to snow flakes. In the simulated mixed-phase cloud, only a negligible part of the total aerosol mass is incorporated into ice crystals. Sedimenting snow flakes reaching the surface remove aerosol mass from the atmosphere. The results show that aerosol processing and regeneration lead to a vertical redistribution of aerosol mass and number. However, the processes not only impact the total aerosol number and mass, but also the shape of the aerosol size distributions by enhancing the internally mixed/soluble accumulation mode and generating coarse mode particles. Concerning subsequent cloud formation at the second mountain, accounting for aerosol processing and regeneration increases the cloud droplet number concentration with possible implications for the ice crystal number concentration.

  13. Influence of biomass burning from South Asia at a high-altitude mountain receptor site in China

    NASA Astrophysics Data System (ADS)

    Zheng, Jing; Hu, Min; Du, Zhuofei; Shang, Dongjie; Gong, Zhaoheng; Qin, Yanhong; Fang, Jingyao; Gu, Fangting; Li, Mengren; Peng, Jianfei; Li, Jie; Zhang, Yuqia; Huang, Xiaofeng; He, Lingyan; Wu, Yusheng; Guo, Song

    2017-06-01

    Highly time-resolved in situ measurements of airborne particles were conducted at Mt. Yulong (3410 m above sea level) on the southeastern edge of the Tibetan Plateau in China from 22 March to 14 April 2015. The detailed chemical composition was measured by a high-resolution time-of-flight aerosol mass spectrometer together with other online instruments. The average mass concentration of the submicron particles (PM1) was 5.7 ± 5.4 µg m-3 during the field campaign, ranging from 0.1 up to 33.3 µg m-3. Organic aerosol (OA) was the dominant component in PM1, with a fraction of 68 %. Three OA factors, i.e., biomass burning organic aerosol (BBOA), biomass-burning-influenced oxygenated organic aerosol (OOA-BB) and oxygenated organic aerosol (OOA), were resolved using positive matrix factorization analysis. The two oxygenated OA factors accounted for 87 % of the total OA mass. Three biomass burning events were identified by examining the enhancement of black carbon concentrations and the f60 (the ratio of the signal at m/z 60 from the mass spectrum to the total signal of OA). Back trajectories of air masses and satellite fire map data were integrated to identify the biomass burning locations and pollutant transport. The western air masses from South Asia with active biomass burning activities transported large amounts of air pollutants, resulting in elevated organic concentrations up to 4-fold higher than those of the background conditions. This study at Mt. Yulong characterizes the tropospheric background aerosols of the Tibetan Plateau during pre-monsoon season and provides clear evidence that the southeastern edge of the Tibetan Plateau was affected by the transport of anthropogenic aerosols from South Asia.

  14. Supervised exercise versus non-supervised exercise for reducing weight in obese adults.

    PubMed

    Nicolaï, S P A; Kruidenier, L M; Leffers, P; Hardeman, R; Hidding, A; Teijink, J A W

    2009-03-01

    The prevalence of obesity is rising. Because obesity is positively associated with many health related risks and negatively associated with life expectancy this is a threat to public health. Physical exercise is a well known method to lose fat mass. Due to shame of their appearance, bad general condition and social isolation, starting and continuing physical exercise tends to be problematic for obese adults. A supervised training program could be useful to overcome such negative factors. In this study we hypothesized that offering a supervised exercise program for obese adults would lead to greater benefits in body fat and total body mass reduction than a non-specific oral advice to increase their physical activity. Thirty-four participants were randomised to a supervised exercise program group (N.=17) and a control group (N.=17). Fifteen candidates in the intervention group and 12 in the control group appeared for baseline measurements and bought an all inclusive sports pass to a health club for Euro 10, per month. The control group just received the oral advice to increase their physical activity at their convenience. The supervised exercise group received biweekly exercise sessions of 2 hours with an estimated energy expenditure of 2 500 kJ per hour. Both groups received no dietary advice. After 4 months the overall decrease in body mass in the intervention group was 8.0 kg (SD 6.2) and the decrease in body fat was 6.2 kg (SD 4.5). The control group lost 2.8 kg overall (SD 4.2) and the decrease in body fat was 1.7 kg (SD 3.1). Correction for differences between groups in gender and age by multiple linear regression analysis showed significantly greater loss of total body mass (P = 0.001) and fat mass (P =0.002) in the intervention group compared with the control group. Stimulation of physical activity alone seems to result in a slight short term body mass and fat mass reduction in obese adults who are eager to lose weight. Supervised exercise under supervision of a qualified fitness instructor leads to a larger decrease.

  15. A low arm and leg muscle mass to total body weight ratio is associated with an increased prevalence of metabolic syndrome: The Korea National Health and Nutrition Examination Survey 2010-2011.

    PubMed

    Kim, Yong Hwan; So, Wi-Young

    2016-09-14

    The aim of this study was to investigate the association between metabolic syndrome (MetS) and arm and leg muscle mass to total weight ratios in Korean adults. This was a randomized, controlled, cross-sectional study. Data from 2,383 adults (1,030 men and 1,353 women) were collected from the Korea National Health and Nutrition Examination Survey 2010-2011. Blood lipid profiles, blood pressure, and anthropometric characteristics, including weight, height, waist circumference, and muscle mass on dual energy X-ray absorptiometry (DXA), were evaluated in the participants. MetS was defined according to the criteria of the National Cholesterol Education Program Adult Treatment Panel III. The average mass of both arms and legs was determined using regional muscle analysis by DXA. Afterwards, the arm and leg muscle mass to total body weight ratio was determined and classified into 4 quartiles (i.e., quartile 1 [highest muscle ratio] to quartile 4 [lowest muscle ratio]). According to the arm muscle and leg muscle ratios, there was a higher prevalence of MetS in quartile 4 than in quartile 1 in both men and women. A low arm and leg muscle mass to body weight ratio was associated with a higher prevalence of MetS after adjusting for age, physical activity, frequency of smoking, and frequency of alcohol consumption. In conclusion, MetS patients demonstrated a lower arm and leg muscle mass to body weight ratio. Strength training for the lower and upper extremities is recommended because it can have a positive effect on MetS prevention.

  16. Skeletal mass in rheumatoid arthritis: a comparison with forearm bone mineral content. [Photon transmission scanning of bone tissues

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Zanzi, I.; Roginsky, M.S.; Ellis, K.J.

    1976-01-01

    The evaluation of diffuse osteoporosis in patients with rheumatoid arthritis (RA) remains controversial. An important associated problem is the compounded effect of osteopenia secondary to chronic corticosteroid treatment. Photon-absorptiometric techniques have been utilized for measurements of selected sites of the skeleton, such as the distal femur and the distal radius. The development of the technique of in-vivo total body neutron activation analysis (TBNAA) along with whole body counting, has made possible the direct measurement of skeletal mass (total body calcium, TBCa). The TBCa and radial bone mineral content (BMC) were evaluated in 19 Caucassian women with R.A., with and withoutmore » a history of corticosteroid treatment. (auth)« less

  17. 40 CFR 60.1795 - May I conduct stack testing less often?

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter... meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter (total mass) for... 15 nanograms per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry...

  18. 40 CFR 60.1795 - May I conduct stack testing less often?

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter... meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter (total mass) for... 15 nanograms per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry...

  19. 40 CFR 60.1795 - May I conduct stack testing less often?

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter... meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter (total mass) for... 15 nanograms per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry...

  20. Physicochemical characteristics and occupational exposure to coarse, fine and ultrafine particles during building refurbishment activities

    NASA Astrophysics Data System (ADS)

    Azarmi, Farhad; Kumar, Prashant; Mulheron, Mike; Colaux, Julien L.; Jeynes, Chris; Adhami, Siavash; Watts, John F.

    2015-08-01

    Understanding of the emissions of coarse (PM10 ≤10 μm), fine (PM2.5 ≤2.5 μm) and ultrafine particles (UFP <100 nm) from refurbishment activities and their dispersion into the nearby environment is of primary importance for developing efficient risk assessment and management strategies in the construction and demolition industry. This study investigates the release, occupational exposure and physicochemical properties of particulate matter, including UFPs, from over 20 different refurbishment activities occurring at an operational building site. Particles were measured in the 5-10,000-nm-size range using a fast response differential mobility spectrometer and a GRIMM particle spectrometer for 55 h over 8 days. The UFPs were found to account for >90 % of the total particle number concentrations and <10 % of the total mass concentrations released during the recorded activities. The highest UFP concentrations were 4860, 740, 650 and 500 times above the background value during wall-chasing, drilling, cementing and general demolition activities, respectively. Scanning electron microscopy, X-ray photoelectron spectroscopy and ion beam analysis were used to identify physicochemical characteristics of particles and attribute them to probable sources considering the size and the nature of the particles. The results confirm that refurbishment activities produce significant levels (both number and mass) of airborne particles, indicating a need to develop appropriate regulations for the control of occupational exposure of operatives undertaking building refurbishment.

  1. Electric-current Neutralization, Magnetic Shear, and Eruptive Activity in Solar Active Regions

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Liu, Yang; Sun, Xudong; Török, Tibor

    The physical conditions that determine whether or not solar active regions (ARs) produce strong flares and coronal mass ejections (CMEs) are not yet well understood. Here, we investigate the association between electric-current neutralization, magnetic shear along polarity inversion lines (PILs), and eruptive activity in four ARs: two emerging and two well-developed ones. We find that the CME-producing ARs are characterized by a strongly non-neutralized total current, while the total current in the ARs that did not produce CMEs is almost perfectly neutralized. The difference in the PIL shear between these two groups is much less pronounced, which suggests that themore » degree of current neutralization may serve as a better proxy for assessing the ability of ARs to produce CMEs.« less

  2. Kinetics of mass transfer during deep fat frying of yellow fleshed cassava root slices

    NASA Astrophysics Data System (ADS)

    Oyedeji, A. B.; Sobukola, O. P.; Henshaw, F. O.; Adegunwa, M. O.; Sanni, L. O.; Tomlins, K. I.

    2016-05-01

    Kinetics of mass transfer [moisture content, oil uptake, total carotenoid (TC) and shrinkage] during frying of yellow fleshed cassava roots (TMS 01/1371) was investigated. Slices were divided into (i) fresh and (ii) pre-dried to 75 % moisture content before atmospheric frying and (iii) vacuum fried. Percentage TC and activation energies of vacuum, fresh and pre-dried fried samples were 76, 63 and 61 %; and 82, 469.7, 213.7 kJ/mol, respectively.

  3. Hazards by meteoroid Impacts onto operational spacecraft

    NASA Astrophysics Data System (ADS)

    Landgraf, M.; Jehn, R.; Flury, W.

    Operational spacecraft in Earth orbit or on interplanetary trajectories are exposed to high-velocity particles that can cause damage to sensitive on-board instrumentation. In general there are two types of hazard: direct destruction of functional elements by impacts, and indirect disturbance of instruments by the generated impact plasma. The latter poses a threat especially for high-voltage instrumentation and electronics. While most meteoroids have sizes in the order of a few micrometre, and typical masses of 10-15 kg, the most dangerous population with sizes in the millimetre and masses in the milligramme range exhibits still substantial impact fluxes in the order of 2 × 10-11 m-2 s-1 . This level of activity can by significantly elevated during passages of the spacecraft through cometary trails, which on Earth cause events like the well-known Leonid and Perseid meteor streams. The total mass flux of micrometeoroids onto Earth is about 107 kg yr-1 , which is about one order of magnitude less than the estimated mass flux of large objects like comets and asteroids with individual masses above 105 kg. In order to protect spacecraft from the advert effects of meteoroid impacts, ESA performs safety operations on its spacecraft during meteor streams, supported by real-time measurements of the meteor activity. A summary of past and future activities is given.

  4. Physical activity during life course and bone mass: a systematic review of methods and findings from cohort studies with young adults

    PubMed Central

    2013-01-01

    Background The purpose of this paper was to review the literature of the cohort studies which evaluated the association between physical activity during the life course and bone mineral content or density in young adults. Methods Prospective cohort studies with bone mineral density or content measured in the whole body, lumbar spine and femoral neck by dual energy x-ray absorptiometry as outcome and physical activity as exposure were searched. Two independent reviewers selected studies retrieved from electronic databases (Medline, Lilacs, Web of Science and Scielo) and reviewed references of all selected full text articles. Downs & Black criterion was used in the quality assessment of these studies. Results Nineteen manuscripts met inclusion criteria. Lumbar spine was the skeletal site most studied (n = 15). Different questionnaires were used for physical activity evaluation. Peak strain score was also used to evaluate physical activity in 5 manuscripts. Lack of statistical power calculation was the main problem found in the quality assessment. Positive associations between physical activity and bone mass were found more in males than in females; in weight bearing anatomical sites (lumbar spine and femoral neck) than in total body and when physical activity measurements were done from adolescence to adulthood – than when evaluated in only one period. Physical activity during growth period was associated with greater bone mass in males. It was not possible to conduct pooled analyses due to the heterogeneity of the studies, considering mainly the different instruments used for physical activity measurements. Conclusions Physical activity seems to be important for bone mass in all periods of life, but especially the growth period should be taking into account due to its important direct effect on bone mass and its influence in physical activity practice in later life. Low participation in peak strain activities may also explain the lower number of associations found in females. PMID:23497066

  5. Is PM(10) mass measurement a reliable index for air quality assessment? An environmental study in a geographical area of north-eastern Italy.

    PubMed

    Cozzi, F; Adami, G; Barbieri, P; Reisenhofer, E; Bovenzi, M

    2008-09-01

    The aim of this study was to measure the concentration of some metals (Cd, Cr, Cu, Fe, Mn, Ni, Pb, and Ti) in PM(10) samples collected in one urban and one industrial site and to assess that PM(10) total mass measurement may be not sufficient as air quality index due to its complex composition. Metals were determined by inductively coupled plasma-atomic emission spectroscopy (ICP-AES) and differential pulsed anodic stripping voltammetry (DPASV). The measured concentrations were used to calculate the content of metals in the PM(10) total mass, and to estimate the enrichment factors and the correlations between PM(10), metal concentrations and meteorological data for the two sites. The mean PM10 concentration during the sampling period in the urban site exceeded the annual European Union (EU) standard (40 microg/m(3)) and, for some sampling days, the daily EU standard (50 microg/m(3)) was also exceeded. In opposite, both EU standards were never exceeded in the industrial site. The overall metal content was nearly double in the industrial site compared to the urban one, and the mean Ni concentration exceeded the EU annual limit value (10 ng/m(3)). The metals with the highest enrichment factor were Cd, Cu, Ni and Pb for both sites, suggesting a dominant anthropogenic source for these metals. Metal concentrations were very low and typical of rural background during Christmas holidays, when factories were closed. PM(10) total mass measurement is not a sufficient air quality index since the metal content of PM(10) is not related to its total mass, especially in sites with industrial activities. This measurement should be associated with the analysis of toxic metals.

  6. Rapid screening, separation, and detection of hydroxyl radical scavengers from total flavonoids of Ginkgo biloba leaves by chromatography combined with molecular devices.

    PubMed

    Wang, Jing; Zheng, Meizhu; Chen, Lina; Liu, Zhiqiang; Zhang, Yuchi; Liu, Chun-Ming; Liu, Shu

    2016-11-01

    Hydroxyl radicals are the most reactive free radical of human body, a strong contributor to tissue damage. In this study, liquid chromatography coupled to electrospray ionization mass spectrometry was applied to screen and identify hydroxyl radical scavengers from the total flavonoids of Ginkgo biloba leaves, and high-performance counter current chromatography was used to separate and isolate the active compounds. Furthermore, molecular devices were used to determine hydroxyl radical scavenging activities of the obtained hydroxyl radical scavengers and other flavonoids from G. biloba leaves. As a result, six compounds were screened as hydroxyl radical scavengers, but only three flavonoids, namely, rutin, cosmos glycosides and apigenin-7-O-Glu-4'-O-Rha, were isolated successfully from total flavonoids by high-performance counter current chromatography. The purities of the three obtained compounds were over 90%, respectively, as determined by liquid chromatography. Molecular devices with 96-well microplates evaluation indicated that the 50% scavenging concentration values of screened compounds were lower than that of other flavonoids, they performed greater hydroxyl radical scavenging activity, and the evaluation effects were consistent with the liquid chromatography with mass spectrometry screening results. Therefore, chromatography combined with molecular devices is a feasible and an efficient method for systematic screening, identification, isolation, and evaluation of bioactive components in mixture of botanical medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. The constituents of essential oil: antimicrobial and antioxidant activity of Micromeria congesta Boiss. & Hausskn. ex Boiss. from East Anatolia.

    PubMed

    Herken, Emine Nur; Celik, Ali; Aslan, Mustafa; Aydınlık, Nilüfer

    2012-09-01

    The chemical composition, antimicrobial activity, total phenol content, total antioxidant activity, and total oxidant status of the essential oil from Micromeria congesta Boiss. & Hausskn. ex Boiss. were investigated. Steam distillation was used to obtain the essential oil, and the chemical analyses were performed by gas chromatography-mass spectrometry. The antimicrobial activity was tested by an agar disc diffusion method against the tested microorganisms: Bacillus subtilis NRRL B-744, Bacillus cereus NRRL B-3711, Staphylococcus aureus ATCC 12598, S. aureus ATCC 25923, S. aureus ATCC 25933, Escherichia coli 0157H7, E. coli ATCC25922, Micrococcus luteus NRLL B-4375, Enterococcus faecalis ATCC 19433, Proteus vulgaris RSKK 96026, and Yersinia enterecolitica RSKK 1501. The major compounds found in volatiles of M. congesta were piperitone oxide, linalool oxide, veratrole, pulegone, dihydro carvone, naphthalene, iso-menthone, para-menthone, and cyclohexanone. Compared to that of reference antibiotics, the antibacterial activity of the essential oil is considered as significant. Results showed that M. congesta has the potential for being used in food and medicine depending on its antioxidant and antibacterial activity.

  8. Lean mass and fat mass predict bone mineral density in middle-aged individuals with noninsulin-requiring type 2 diabetes mellitus.

    PubMed

    Moseley, Kendall F; Dobrosielski, Devon A; Stewart, Kerry J; De Beur, Suzanne M Jan; Sellmeyer, Deborah E

    2011-05-01

    Despite high bone mineral density (BMD), persons with type 2 diabetes are at greater risk of fracture. The relationship between body composition and BMD in noninsulin-requiring diabetes is unclear. The aim was to examine how fat and lean mass independently affect the skeleton in this population. Subjects for this cross-sectional analysis were men (n = 78) and women (n = 56) aged 40-65 years (56 ± 6 years) with uncomplicated, noninsulin-requiring type 2 diabetes. Total body fat and lean mass, total body, hip and lumbar spine BMD were measured with dual energy X-ray absorptiometry. Magnetic resonance imaging measured total abdominal, visceral and subcutaneous (SQ) fat. Subjects had normal all-site BMD and were obese to overweight (body mass index 29-41 kg/m(2)) with controlled diabetes (HbA1c women 6·6 ± 1·2%, men 6·7 ± 1·6%). Lean mass was positively associated with total body, hip, femoral neck and hip BMD in both sexes. Fat mass, abdominal total and SQ fat were associated with total body and hip BMD in women. In multivariate analyses adjusted for sex, lean mass significantly predicted total, hip and femoral neck BMD in men and women. In unadjusted models, lean mass continued to predict BMD at these sites in men; fat mass also predicted total body, femoral and hip BMD in women. In men and women with uncomplicated, noninsulin-requiring diabetes, lean mass significantly predicted BMD at the total body, hip and femoral neck. Further research is needed to determine whether acquisition or maintenance of lean mass in T2DM can prevent hip fracture in this at-risk population. © 2011 Blackwell Publishing Ltd.

  9. Obesity History and Daily Patterns of Physical Activity at Age 60-64 Years: Findings From the MRC National Survey of Health and Development.

    PubMed

    Cooper, Rachel; Huang, Lei; Hardy, Rebecca; Crainiceanu, Adina; Harris, Tamara; Schrack, Jennifer A; Crainiceanu, Ciprian; Kuh, Diana

    2017-10-01

    The aim of this study was to investigate associations of current body mass index (BMI) and obesity history with daily patterns of physical activity. At age 60-64, participants from a British birth cohort study wore accelerometers for 5 days. Accelerometry counts were log-transformed and mean log-counts were used to derive a summary variable indicating total daily log-activity counts. Among those with complete data (n = 1,388) the associations of current BMI and age of first obesity were examined with: (a) total daily log-activity counts and (b) total log-activity counts in four segments of the day. Higher current BMI and younger age at obesity were strongly associated with lower levels of total daily activity at age 60-64 even after adjustment for sex, socioeconomic factors, and health status. The fully-adjusted mean difference in total daily log-activity counts was -581.7 (95% confidence interval: -757.2, -406.3) when comparing BMI ≥35 kg/m2 with <25 kg/m2, representing an 18.4% difference. Participants who had been obese since early adulthood had the lowest levels of activity (mean difference in total daily log-activity counts was -413.1 (-638.1, -188.2) when comparing those who were obese by age 26 or 36 with those who were never obese, representing a 13.1% difference). Obese older adults may require targeted interventions and additional support to improve their daily activity levels. As younger generations with greater lifetime exposure to obesity reach old age the proportion of adults achieving sufficient levels of activity to realize its associated health benefits is likely to decline. © The Author 2017. Published by Oxford University Press on behalf of The Gerontological Society of America.

  10. Obesity History and Daily Patterns of Physical Activity at Age 60–64 Years: Findings From the MRC National Survey of Health and Development

    PubMed Central

    Cooper, Rachel; Huang, Lei; Hardy, Rebecca; Crainiceanu, Adina; Harris, Tamara; Schrack, Jennifer A; Crainiceanu, Ciprian; Kuh, Diana

    2017-01-01

    Abstract Background The aim of this study was to investigate associations of current body mass index (BMI) and obesity history with daily patterns of physical activity. Methods At age 60–64, participants from a British birth cohort study wore accelerometers for 5 days. Accelerometry counts were log-transformed and mean log-counts were used to derive a summary variable indicating total daily log-activity counts. Among those with complete data (n = 1,388) the associations of current BMI and age of first obesity were examined with: (a) total daily log-activity counts and (b) total log-activity counts in four segments of the day. Results Higher current BMI and younger age at obesity were strongly associated with lower levels of total daily activity at age 60–64 even after adjustment for sex, socioeconomic factors, and health status. The fully-adjusted mean difference in total daily log-activity counts was −581.7 (95% confidence interval: −757.2, −406.3) when comparing BMI ≥35 kg/m2 with <25 kg/m2, representing an 18.4% difference. Participants who had been obese since early adulthood had the lowest levels of activity (mean difference in total daily log-activity counts was −413.1 (−638.1, −188.2) when comparing those who were obese by age 26 or 36 with those who were never obese, representing a 13.1% difference). Conclusions Obese older adults may require targeted interventions and additional support to improve their daily activity levels. As younger generations with greater lifetime exposure to obesity reach old age the proportion of adults achieving sufficient levels of activity to realize its associated health benefits is likely to decline. PMID:28329086

  11. Volcanic eruptions on Io - Implications for surface evolution and mass loss

    NASA Technical Reports Server (NTRS)

    Johnson, T. V.; Soderblom, L. A.

    1982-01-01

    Active volcanism on Io results in a continual resurfacing of the satellite. Analysis of required burial rates to erase impact craters, the mass production in the observed plumes, and the energy requirements for the volcanic activity suggest resurfacing rates of 0.001 to 10 cm/yr in recent geologic time. If this rate is typical of the last 4.5 Gyr, then extensive recycling of the upper crust and mantle must have occurred. The currently estimated loss rate of S, O, and Na from Io into the magnetosphere corresponds to only a small fraction of the resurfacing rate and should not have resulted in either extensive erosion or total depletion of any of the escaping species.

  12. Evolution of Cometary Activity at 67P/Churyumov-Gerasimenko as seen by ROSINA/Rosetta

    NASA Astrophysics Data System (ADS)

    Jäckel, A.; Altwegg, K.; Balsiger, H.; Calmonte, U.; Gasc, S.; Le Roy, L.; Rubin, M.; Tzou, C. Y.; Wurz, P.; Bieler, A.; Berthelier, J.-J.; Fiethe, B.; Hässig, M.; deKeyser, J.; Mall, U.; Rème, H.

    2015-10-01

    Since nine months the European Space Agency's spacecraft Rosetta, with the Rosetta Orbiter Spectrometer for Ion and Neutral Analysis (ROSINA) onboard, is in the comet escort phase. ROSINA is a suite of three instruments, consisting of the COmetary Pressure Sensor (COPS), the Double Focusing Mass Spectrometer (DFMS), and the Reflectron-type Time-Of-Flight (RTOF) mass spectrometer [1]. The two mass spectrometers measure in situ the neutral and ionized volatile material in the coma of comet 67P/Churyumov- Gerasimenko (67P/C-G). With COPS we are able to derive the total gas density, bulk velocities and temperatures of the coma.

  13. No association between LRP5 gene polymorphisms and bone and obesity phenotypes in Chinese male-offspring nuclear families.

    PubMed

    Yu, Jin-bo; Ke, Yao-hua; He, Jin-wei; Zhang, Hao; Hu, Wei-wei; Hu, Yun-qiu; Li, Miao; Liu, Yu-juan; Gu, Jie-mei; Fu, Wen-zhen; Gao, Gao; Yue, Hua; Xiao, Wen-jin; Zhang, Zhen-lin

    2010-11-01

    To investigate the effect of low-density lipoprotein receptor-related protein 5 (LRP5) gene polymorphisms on bone and obesity phenotypes in young Chinese men. A total of 1244 subjects from 411 Chinese nuclear families were genotyped by using the polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) technique at the Q89R, N740N, and A1330V sites in the LRP5 gene. Bone mineral density (BMD) in the lumbar spine and the hip, total fat mass and total lean mass were measured using dual-energy X-ray absorptiometry. The association between LRP5 gene polymorphisms and peak BMD, body mass index (BMI), total fat mass, total lean mass and percentage of fat mass was assessed using a quantitative transmission disequilibrium test (QTDT). No significant within-family associations were found between genotypes or haplotypes of the LRP5 gene and peak BMD, BMI, total fat mass, total lean mass and percentage of fat mass. The 1000 permutations that were subsequently simulated were in agreement with these within-family association results. Our results suggest that common polymorphic variations of the LRP5 gene do not influence peak bone mass acquisition and obesity phenotypes in young Chinese men.

  14. Flavonoid profile and antioxidant activities of methanolic extract of Hyparrhenia hirta (L.) Stapf.

    PubMed

    Bouaziz-Ketata, Hanen; Zouari, Nabil; Ben Salah, Hichem; Rafrafi, Moez; Zeghal, Najiba

    2015-04-01

    In this study, we report isolation of flavonoids, viz., 3-O-methylquercetin, tangeritin, luteolin-7-O-glucoside, luteolin, apigenin-7-O-glucoside, apigenin-8-C-glucoside, luteolin-8-C-glucoside, luteolin-6-C-glucoside, diosmetin and catechin from the methanolic extract of Hyparrhenia hirta employing high performance liquid chromatography and liquid chromatography-electrospray ionization-tandem mass spectrometry. The total phenolic content of H. hirta extract was 105.58 ± 0.1 mg gallic acid equivalents/g of plant extract while the total flavonoid content was 45.20 ± 0.2 mg quercetin equivalents/g of plant extract and the total condensed tannin were 72.35 ± 0.7 mg catechin equivalents/g of plant extract by reference to standard curve. The antioxidant activity was assayed through the antioxidant capacity by phosphomolybdenum assay, the reducing power assay and the radical scavenging activity using 2,2-diphenyl-1-picrylhydrazyl method. The extract showed dose dependant activity in all the three assays.

  15. Black hole demographics from the M•-σ relation

    NASA Astrophysics Data System (ADS)

    Merritt, David; Ferrarese, Laura

    2001-01-01

    We analyse a sample of 32 galaxies for which a dynamical estimate of the mass of the hot stellar component, Mbulge, is available. For each of these galaxies, we calculate the mass of the central black hole, M•, using the tight empirical correlation between M• and bulge stellar velocity dispersion. The frequency function N[log(M•Mbulge)] is reasonably well described as a Gaussian with ~-2.90 and standard deviation ~0.45 the implied mean ratio of black hole mass to bulge mass is a factor of ~5 smaller than generally quoted in the literature. We present marginal evidence for a lower, average black hole mass fraction in more massive galaxies. The total mass density in black holes in the local Universe is estimated to be ~ 5×105MsolarMpc-3, consistent with that inferred from high-redshift (z~2) active galactic nuclei.

  16. How Does the Relationship Between Motor Skill Performance and Body Mass Index Impact Physical Activity in Preschool Children?

    PubMed

    Guo, Haixia; Schenkelberg, Michaela A; O'Neill, Jennifer R; Dowda, Marsha; Pate, Russell R

    2018-05-01

    To determine if weight status modifies the relationship between motor skill (MS) performance and physical activity (PA) in preschoolers. Preschoolers (N = 227, age 3-5 y) were recruited from 22 preschools. Preschoolers' MS (locomotor, object control, and total MS) were assessed with the Children's Activity and Movement in Preschool Study MS protocol. PA was measured by accelerometry. Mixed linear models were used to examine the relationship of MS performance and body mass index (BMI) z score to PA. Models were adjusted for age, race, sex, and parent education, with preschool as a random effect. There was a significant correlation between MS performance and PA (r = .14-.17, P < .05). A significant interaction was observed between BMI z score and object control, and between BMI z score and total MS score on PA (P = .03). Preschoolers with higher BMI z scores and high object control scores engaged in significantly (P = .03) more PA than preschoolers with lower BMI z scores and high object control scores (PA = 15.04 min/h and 13.54 min/h, respectively). Similarly, preschoolers with higher BMI z scores and high total MS scores spent significantly (P = .01) more time in PA compared with those with lower BMI z scores and high total MS scores (PA = 15.65 min/h and 13.91 min/h, respectively). Preschool children's MS performance is positively correlated with PA, and BMI z score modified the relationship between MS performance and PA.

  17. Knee joint loading in knee osteoarthritis: influence of abdominal and thigh fat.

    PubMed

    Messier, Stephen P; Beavers, Daniel P; Loeser, Richard F; Carr, J Jeffery; Khajanchi, Shubham; Legault, Claudine; Nicklas, Barbara J; Hunter, David J; Devita, Paul

    2014-09-01

    Using three separate models that included total body mass, total lean and total fat mass, and abdominal and thigh fat as independent measures, we determined their association with knee joint loads in older overweight and obese adults with knee osteoarthritis (OA). Fat depots were quantified using computed tomography, and total lean and fat mass were determined with dual energy x-ray absorptiometry in 176 adults (age, 66.3 yr; body mass index, 33.5 kg·m) with radiographic knee OA. Knee moments and joint bone-on-bone forces were calculated using gait analysis and musculoskeletal modeling. Higher total body mass was significantly associated (P ≤ 0.0001) with greater knee compressive and shear forces, compressive and shear impulses (P < 0.0001), patellofemoral forces (P < 0.006), and knee extensor moments (P = 0.003). Regression analysis with total lean and total fat mass as independent variables revealed significant positive associations of total fat mass with knee compressive (P = 0.0001), shear (P < 0.001), and patellofemoral forces (P = 0.01) and knee extension moment (P = 0.008). Gastrocnemius and quadriceps forces were positively associated with total fat mass. Total lean mass was associated with knee compressive force (P = 0.002). A regression model that included total thigh and total abdominal fat found that both were significantly associated with knee compressive and shear forces (P ≤ 0.04). Thigh fat was associated with knee abduction (P = 0.03) and knee extension moment (P = 0.02). Thigh fat, consisting predominately of subcutaneous fat, had similar significant associations with knee joint forces as abdominal fat despite its much smaller volume and could be an important therapeutic target for people with knee OA.

  18. Hypogonadism associated with muscle atrophy, physical inactivity and ESA hyporesponsiveness in men undergoing haemodialysis.

    PubMed

    Cobo, Gabriela; Gallar, Paloma; Di Gioia, Cristina; García Lacalle, Concepción; Camacho, Rosa; Rodriguez, Isabel; Ortega, Olimpia; Mon, Carmen; Vigil, Ana; Lindholm, Bengt; Carrero, Juan Jesús

    Testosterone deficiency (hypogonadism) is common among men undergoing haemodialysis, but its clinical implications are not well characterized. Testosterone is an anabolic hormone that induces erythrocytosis and muscle synthesis. We hypothesized that testosterone deficiency would be associated with low muscle mass, physical inactivity and higher dosages of erythropoietin-stimulating agents (ESA). Single-center cross-sectional study of 57 male haemodialysis patients. None of the patients was undergoing testosterone replacement therapy. Total testosterone was measured in serum. Body composition (by bioelectrical impedance analysis) and physical activity (by the use of pedometers) were assessed. Patients with testosterone levels below the normal range were considered hypogonadal. Mean testosterone level was 321±146ng/dL; 20 patients (35%) were hypogonadal. Hypogonadal patients were older and had lower mean arterial blood pressure, higher interleukin-6 levels, lower lean body mass and higher fat body mass. A negative association between testosterone and normalized ESA dose was found in uni- and multivariate regression analyses. Testosterone levels directly correlated with lean body mass regardless of confounders. Hypogonadal patients had lower physical activity than their counterparts [2753±1784 vs. 4291±3225steps/day (p=0.04)]. The relationship between testosterone and physical activity was independent of age, comorbidities and inflammatory markers, but dependent on the proportion of muscle mass. Hypogonadism is common in our male haemodialysis population and is associated with higher ESA doses, reduced muscle mass and lower physical activity. The link between low testosterone levels and physical inactivity may conceivably relate to reduced muscle mass due to inadequate muscle protein synthesis. Copyright © 2016 Sociedad Española de Nefrología. Published by Elsevier España, S.L.U. All rights reserved.

  19. Swimming training induces liver adaptations to oxidative stress and insulin sensitivity in rats submitted to high-fat diet.

    PubMed

    Zacarias, Aline Cruz; Barbosa, Maria Andrea; Guerra-Sá, Renata; De Castro, Uberdan Guilherme Mendes; Bezerra, Frank Silva; de Lima, Wanderson Geraldo; Cardoso, Leonardo M; Santos, Robson Augusto Souza Dos; Campagnole-Santos, Maria José; Alzamora, Andréia Carvalho

    2017-11-01

    Oxidative stress, physical inactivity and high-fat (FAT) diets are associated with hepatic disorders such as metabolic syndrome (MS). The therapeutic effects of physical training (PT) were evaluated in rats with MS induced by FAT diet for 13 weeks, on oxidative stress and insulin signaling in the liver, during the last 6 weeks. FAT-sedentary (SED) rats increased body mass, retroperitoneal fat, mean arterial pressure (MAP) and heart rate (HR), and total cholesterol, serum alanine aminotransferase, glucose and insulin. Livers of FAT-SED rats increased superoxide dismutase activity, thiobarbituric acid-reactive substances, protein carbonyl and oxidized glutathione (GSSG); and decreased catalase activity, reduced glutathione/GSSG ratio, and the mRNA expression of insulin receptor substrate 1 (IRS-1) and serine/threonine kinase 2. FAT-PT rats improved in fitness and reduced their body mass, retroperitoneal fat, and glucose, insulin, total cholesterol, MAP and HR; and their livers increased superoxide dismutase and catalase activities, the reduced glutathione/GSSG ratio and the expression of peroxisome proliferator-activated receptor gamma and insulin receptor compared to FAT-SED rats. These findings indicated adaptive responses to PT by restoring the oxidative balance and insulin signaling in the liver and certain biometric and biochemical parameters as well as MAP in MS rats.

  20. A Triple Iron Triathlon Leads to a Decrease in Total Body Mass but Not to Dehydration

    ERIC Educational Resources Information Center

    Knechtle, Beat; Knechtle, Patrizia; Rosemann, Thomas; Oliver, Senn

    2010-01-01

    A loss in total body mass during an ultraendurance performance is usually attributed to dehydration. We identified the changes in total body mass, fat mass, skeletal muscle mass, and selected markers of hydration status in 31 male nonprofessional ultratriathletes participating in a Triple Iron triathlon involving 11.4 km swimming, 540 km cycling…

  1. Determination of bisphenol A, triclosan and their metabolites in human urine using isotope-dilution liquid chromatography-tandem mass spectrometry.

    PubMed

    Provencher, Gilles; Bérubé, René; Dumas, Pierre; Bienvenu, Jean-François; Gaudreau, Eric; Bélanger, Patrick; Ayotte, Pierre

    2014-06-27

    Bisphenol A (BPA) and triclosan (TCS) are ubiquitous environmental phenols exhibiting endocrine disrupting activities that may be involved in various health disorders in humans. There is a need to measure separately free forms and conjugated metabolites because only the former are biologically active. We have developed sensitive methods using isotope-dilution liquid chromatography-tandem mass spectrometry for individual measurements of free BPA and TCS as well as their metabolites, BPA glucuronide (BPAG), BPA monosulfate (BPAS), BPA disulfate (BPADS), TCS glucuronide (TCSG) and TCS sulfate (TCSS) in urine. Comparative analyses of urine samples from 46 volunteers living in the Quebec City area using the new methods and a GC-MS/MS method previously used in our laboratory revealed very strong correlations for total BPA (Spearman's rs=0.862, p<0.0001) and total TCS concentrations (rs=0.942, p<0.0001). Glucuronide metabolites were the most abundant BPA and TCS species in urine samples (>94% of total urinary concentrations). Unconjugated TCS concentrations represented a small proportion of total TCS species (median=1.6%) but its concentration was likely underestimated due to losses by adsorption to the surface of polypropylene tubes used for sample storage. To our knowledge, we are the first to report levels of free, sulfated and glucuronidated TCS levels in human urine. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Improving polio vaccination during supplementary campaigns at areas of mass transit in India

    PubMed Central

    2010-01-01

    Background In India, children who are traveling during mass immunization campaigns for polio represent a substantial component of the total target population. These children are not easily accessible to health workers and may thus not receive vaccine. Vaccination activities at mass transit sites (such as major intersections, bus depots and train stations), can increase the proportion of children vaccinated but the effectiveness of these activities, and factors associated with their success, have not been rigorously evaluated. Methods We assessed data from polio vaccination activities in Jyotiba Phule Nagar district, Uttar Pradesh, India, conducted in June 2006. We used trends in the vaccination results from the June activities to plan the timing, locations, and human resource requirements for transit vaccination activities in two out of the seven blocks in the district for the July 2006 supplementary immunization activity (SIA). In July, similar data was collected and for the first time vaccination teams also recorded the proportion of children encountered each day who were vaccinated (a new monitoring system). Results In June, out of the 360,937 total children vaccinated, 34,643 (9.6%) received vaccinations at mass transit sites. In the July SIA, after implementation of a number of changes based on the June monitoring data, 36,475 children were vaccinated at transit sites (a 5.3% increase). Transit site vaccinations in July increased in the two intervention blocks from 18,194 to 21,588 (18.7%) and decreased from 16,449 to 14,887 (9.5%) in the five other blocks. The new monitoring system showed the proportion of unvaccinated children at street intersection transit sites in the July campaign decreased from 24% (1,784/7,405) at the start of the campaign to 3% (143/5,057) by the end of the SIA, consistent with findings from the more labor-intensive post-vaccination coverage surveys routinely performed by the program. Conclusions Analysis of vaccination data from transit sites can inform program management changes leading to improved outcomes in polio immunization campaigns. The number of vaccinated children encountered should be routinely recorded by transit teams and may provide a useful, inexpensive alternative mechanism to assess program coverage. PMID:20459824

  3. Dietary patterns associated with fat and bone mass in young children123

    PubMed Central

    Khoury, Philip R; Claytor, Randal P; Copeland, Kristen A; Hornung, Richard W; Daniels, Stephen R; Kalkwarf, Heidi J

    2010-01-01

    Background: Obesity and osteoporosis have origins in childhood, and both are affected by dietary intake and physical activity. However, there is little information on what constitutes a diet that simultaneously promotes low fat mass and high bone mass accrual early in life. Objective: Our objective was to identify dietary patterns related to fat and bone mass in children during the age period of 3.8–7.8 y. Design: A total of 325 children contributed data from 13 visits over 4 separate study years (age ranges: 3.8–4.8, >4.8–5.8, >5.8–6.8, and >6.8–7.8 y). We performed reduced-rank regression to identify dietary patterns related to fat mass and bone mass measured by dual-energy X-ray absorptiometry for each study year. Covariables included race, sex, height, weight, energy intake, calcium intake, physical activity measured by accelerometry, and time spent viewing television and playing outdoors. Results: A dietary pattern characterized by a high intake of dark-green and deep-yellow vegetables was related to low fat mass and high bone mass; high processed-meat intake was related to high bone mass; and high fried-food intake was related to high fat mass. Dietary pattern scores remained related to fat mass and bone mass after all covariables were controlled for (P < 0.001–0.03). Conclusion: Beginning at preschool age, diets rich in dark-green and deep-yellow vegetables and low in fried foods may lead to healthy fat and bone mass accrual in young children. PMID:20519562

  4. The association between daily steps and health, and the mediating role of body composition: a pedometer-based, cross-sectional study in an employed South African population.

    PubMed

    Pillay, Julian D; van der Ploeg, Hidde P; Kolbe-Alexander, Tracy L; Proper, Karin I; van Stralen, Maartje; Tomaz, Simone A; van Mechelen, Willem; Lambert, Estelle V

    2015-02-22

    Walking is recognized as an easily accessible mode of physical activity and is therefore supported as a strategy to promote health and well-being. To complement walking, pedometers have been identified as a useful tool for monitoring ambulatory physical activity, typically measuring total steps/day. There is, however, little information concerning dose-response for health outcomes in relation to intensity or duration of sustained steps. We aimed to examine this relationship, along with factors that mediate it, among employed adults. A convenience sample, recruited from work-site health risk screening (N = 312, 37 ± 9 yrs), wore a pedometer for at least three consecutive days. Steps were classified as "aerobic" (≥100 steps/minute and ≥10 consecutive minutes) or "non-aerobic" (<100 steps/minute and/or <10 consecutive minutes). The data were sub-grouped according to intensity-based categories i.e. "no aerobic activity", "low aerobic activity" (1-20 minutes/day of aerobic activity) and "high aerobic activity" (≥21 minutes/day of aerobic activity), with the latter used as a proxy for current PA guidelines (150-minutes of moderate-intensity PA per week). Health outcomes included blood pressure, body mass index, percentage body fat, waist circumference, blood cholesterol and blood glucose. Analysis of covariance, adjusting for age, gender and total steps/day were used to compare groups according to volume and intensity-based steps categories. A further analysis compared the mediation effect of body fat estimates (percentage body fat, body mass index and waist circumference) on the association between steps and health outcomes, independently. Average steps/day were 6,574 ± 3,541; total steps/day were inversely associated with most health outcomes in the expected direction (p < 0.05). The "no aerobic activity" group was significantly different from the "low aerobic activity" and "high aerobic activity" in percentage body fat and diastolic blood pressure only (P < 0.05). Percentage body fat emerged as the strongest mediator of the relationship between steps and outcomes, while body mass index showed the least mediation effect. The study provides a presentation of cross-sectional pedometer data that relate to a combination of intensity and volume-based steps/day and its relationship to current guidelines. The integration of volume, intensity and duration of ambulatory physical activity in pedometer-based messages is of emerging relevance.

  5. Better Body Composition and Lipid Profile Can Be Associated with Vitamin D Status in Spanish Elderly? The PHYSMED Study.

    PubMed

    Souza, W N; Aparicio-Ugarriza, R; Bibiloni, M M; Palacios, G; Aguilar, I; Tur, J A; González-Gross, M

    2017-01-01

    Studies have shown that vitamin D deficiency increases the risk for lipid metabolism disorders, but this relationship has provided inconsistent results in elderly. Thus the aim was to assess the association between body composition and blood lipid profile levels on serum 25-hydrovitamin D [25(OH)D] concentration in Spanish elderly. A cross-sectional multicentre study was carried out in 383 participants (58.2% females) aged of 55-88 years. Fasting blood samples analyzed serum concentrations of 25(OH)D, low-density lipoprotein (LDL), high-density lipoprotein (HDL), triglycerides (TG) and total cholesterol (TC). Body composition parameters (fat mass, fat free mass) were obtained by bioimpedance, waist circumference (WC), physical activity and vitamin D intake were also evaluated. BMI, fat mass and total fat mass were lower in vitamin D sufficient subjects than vitamin D insufficient and deficient subjects, but this difference was not significant (p>0,05). Those with vitamin D adequate levels also showed lower TC/HDL ratio than those who had inadequate (insufficient or deficient) vitamin D levels (p=0.04). Significant association between 25(OH)D and BMI, waist circumference, total muscle mass, TC/HDL-c ratio, HDL and TG (for all p≤ 0.05) was found after controlling for some confounders. Subjects with inadequate HDL levels (<40mg/dL) showed 1.7 times higher odds than vitamin D deficiency than those with adequate HDL levels (>60mg/dL) (95% CI= 1.10 to 2.85 p= 0.017) and WC was negatively associated with vitamin D status odds ratio of 0.98 (0.96 to 1.00; p= 0.04). Vitamin D concentration was positively correlated with HDL-c and total muscle mass, as well as negatively correlated with WC, LDL-c/HDL-c and TC/HDL-c independently of age, gender and some confounders.

  6. Prevalence of ideal cardiovascular health in European adolescents: The HELENA study.

    PubMed

    Henriksson, Pontus; Henriksson, Hanna; Gracia-Marco, Luis; Labayen, Idoia; Ortega, Francisco B; Huybrechts, Inge; España-Romero, Vanesa; Manios, Yannis; Widhalm, Kurt; Dallongeville, Jean; González-Gross, Marcela; Marcos, Ascensión; Moreno, Luis A; Castillo, Manuel J; Ruiz, Jonatan R

    2017-08-01

    The ideal cardiovascular health (iCVH) construct consists of 4 health behaviours and 3 health factors and is strongly related to later cardiovascular disease. However, the prevalence of iCVH in European adolescents is currently unknown. The Healthy Lifestyle in Europe by Nutrition in Adolescence (HELENA) study is a cross-sectional, multicentre study conducted in 9 European countries during 2006-2007 and included 3528 adolescents (1683 boys and 1845 girls) between 12.5 and 17.5years of age. Status (ideal vs. non-ideal) for the health behaviours (smoking status, body mass index, physical activity and diet) and health factors (total cholesterol, blood pressure and fasting glucose) were determined. Overall, the prevalence of ideal health behaviours was low; non-smoking (60.9% ideal), body mass index (76.8%), physical activity (62.1%), and diet (1.7%). The prevalence of ideal health factors was; total cholesterol (65.8%), blood pressure (62.0%) and plasma glucose (88.8%). The low prevalence of iCVH behaviours, especially diet and physical activity, identified in European adolescents is likely to influence later cardiovascular health which strongly motivates efforts to increase ideal health behaviours in this population. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. The role of total body fat mass and trunk fat mass, combined with other endocrine factors, in menstrual recovery and psychopathology of adolescents with Anorexia Nervosa.

    PubMed

    Karountzos, Vasileios; Lambrinoudaki, Irene; Tsitsika, Artemis; Deligeoroglou, Efthimios

    2017-10-01

    To determine the threshold of total body and trunk fat mass required for menstrual recovery and to assess the impact of body composition in psychopathology of adolescents with Anorexia Nervosa (AN). Prospective study of 60 adolescents presented with secondary amenorrhea and diagnosed with AN. Anthropometrics, body composition by dual-energy X-ray absorptiometry, hormonal studies and responses to mental health screens (EAT-26), were obtained at the beginning and at complete weight restoration, in all adolescents, independently of menstrual recovery (Group A) or not (Group B). At weight restoration, Group A total body fat mass, trunk fat mass, and trunk/extremities fat ratio were significantly higher (p < .001) than Group B. Menstruation was expected in 20% of total body fat mass and 20% of trunk fat mass (% of total trunk tissue). At time of menstrual recovery, total body fat mass (%) and trunk fat mass (%) were significantly negatively correlated with EAT-26 (r = -0.363, p = .032) and (r = -0.416, p = .013), respectively, while an increase of 0.40% of trunk fat mass (%) lowers EAT-26 by one unit. Trunk fat mass distribution can positively influence psychopathology of adolescents with AN.

  8. On total turbulent energy and the passive and active role of buoyancy in turbulent momentum and mass transfer.

    PubMed

    de Nijs, Michel A J; Pietrzak, Julie D

    Measurements of turbulent fluctuations of horizontal and vertical components of velocity, salinity and suspended particulate matter are presented. Turbulent Prandtl numbers are found to increase with stratification and to become larger than 1. Consequently, the vertical turbulent mass transport is suppressed by buoyancy forces, before the turbulent kinetic energy (TKE) and vertical turbulent momentum exchange are inhibited. With increasing stratification, the buoyancy fluxes do not cease, instead they become countergradient. We find that buoyantly driven motions play an active role in the transfer of mass. This is in agreement with trends derived from Monin-Obukhov scaling. For positive Richardson flux numbers (Ri f ), the log velocity profile in the near-bed layer requires correction with a drag reduction. For negative Ri f , the log velocity profile should be corrected with a drag increase, with increasing |Ri f |. This highlights the active role played by buoyancy in momentum transfer and the production of TKE. However, the data do not appear to entirely follow Monin-Obukhov scaling. This is consistent with the notion that the turbulence field is not in equilibrium. The large stratification results in the decay of turbulence and countergradient buoyancy fluxes act to restore equilibrium in the energy budget. This implies that there is a finite adjustment timescale of the turbulence field to changes in velocity shear and density stratification. The energy transfers associated with the source and sink function of the buoyancy flux can be modeled with the concept of total turbulent energy.

  9. Polygalacturonase Gene Expression in Rutgers, rin, nor, and Nr Tomato Fruits 1

    PubMed Central

    DellaPenna, Dean; Kates, David S.; Bennett, Alan B.

    1987-01-01

    Polygalacturonase (PG) gene expression was studied in normally ripening tomato fruit (Lycopersicon esculentum Mill, cv Rutgers) and in three ripening-impaired mutants, rin, nor, and Nr. Normal and mutant fruit of identical chronological age were analyzed at 41, 49, and 62 days after pollination. These stages corresponded to mature-green, ripe, and overripe, respectively, for Rutgers. The amount of PG mRNA in Rutgers was highest at 49 days and accounted for 2.3% of the total mRNA mass but at 62 days had decreased to 0.004% of the total mRNA mass. In Nr, the amount of PG mRNA steadily increased between 41 and 62 days after pollination, reaching a maximum level of 0.5% of the total mRNA mass. The mutant nor exhibited barely detectable levels of PG mRNA at all stages tested. Surprisingly, PG mRNA, comprising approximately 0.06% of the mRNA mass, was detected in 49 day rin fruit. This mRNA accumulation occurred in the absence of elevated ethylene production by the fruit and resulted in the synthesis of enzymically active PG I. The different patterns of PG mRNA accumulation in the three mutants suggests that distinct molecular mechanisms contribute to reduced PG expression in each ripening-impaired mutant. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 PMID:16665727

  10. Physical activity and modernization among Bolivian Amerindians.

    PubMed

    Gurven, Michael; Jaeggi, Adrian V; Kaplan, Hillard; Cummings, Daniel

    2013-01-01

    Physical inactivity is a growing public health problem, and the fourth leading risk factor for global mortality. Conversely, indigenous populations living traditional lifestyles reportedly engage in vigorous daily activity that is protective against non-communicable diseases. Here we analyze physical activity patterns among the Tsimane, forager-horticulturalists of Amazonian Bolivia with minimal heart disease and diabetes. We assess age patterns of adult activity among men and women, test whether modernization affects activity levels, and examine whether nascent obesity is associated with reduced activity. A factorial method based on a large sample of behavioral observations was employed to estimate effects of age, sex, body mass index, and modernization variables on physical activity ratio (PAR), the ratio of total energy expenditure to basal metabolic rate. Accelerometry combined with heart rate monitoring was compared to the factorial method and used for nighttime sampling. Tsimane men and women display 24 hr physical activity level (PAL) of 2.02-2.15 and 1.73-1.85, respectively. Little time was spent "sedentary", whereas most activity was light to moderate, rather than vigorous. Activity peaks by the late twenties in men, and declines thereafter, but remains constant among women after the early teens. Neither BMI, fat free mass or body fat percentage are associated with PAR. There was no negative effect of modernization on physical activity. Tsimane display relatively high PALs typical of other subsistence populations, but of moderate intensity, and not outside the range of developed populations. Despite rapidly increasing socioeconomic change, there is little evidence that total activity has yet been affected. Overweight and obesity are more prevalent among women than men, and Spanish fluency is associated with greater obesity in women. The lack of cardiovascular disease among Tsimane is unlikely caused by activity alone; further study of diet, food intake and infectious disease is needed.

  11. Factors associated with appendicular bone mass in older women. The Study of Osteoporotic Fractures Research Group.

    PubMed

    Bauer, D C; Browner, W S; Cauley, J A; Orwoll, E S; Scott, J C; Black, D M; Tao, J L; Cummings, S R

    1993-05-01

    To determine the factors associated with appendicular bone mass in older women. Cross-sectional analysis of baseline data collected for a multicenter, prospective study of osteoporotic fractures. Four clinical centers in Baltimore, Maryland; Minneapolis, Minnesota; Portland, Oregon; and the Monongahela valley, Pennsylvania. A total of 9704 ambulatory, nonblack women, ages 65 years or older, recruited from population-based listings. Demographic and historical information and anthropometric measurements were obtained from a baseline questionnaire, interview, and examination. Single-photon absorptiometry scans were obtained at three sites: the distal radius, midradius, and calcaneus. Multivariate associations with bone mass were first examined in a randomly selected half of the cohort (training group) and were then tested on the other half of the cohort (validation group). In order of decreasing strength of association, estrogen use, non-insulin-dependent diabetes, thiazide use, increased weight, greater muscle strength, later age at menopause, and greater height were independently associated with higher bone mass. Gastric surgery, age, history of maternal fracture, smoking, and caffeine intake were associated with lower bone mass (all P < 0.05). For example, we found that 2 or more years of estrogen use was associated with a 7.2% increase in distal radius bone mass, whereas gastrectomy was associated with an 8.2% decrease in bone mass. The associations between bone mass and dietary calcium intake and rheumatoid arthritis were inconsistent. Alcohol use, physical activity, use of calcium supplements, pregnancy, breast-feeding, parental nationality, and hair color were among the many variables not associated with bone mass. Multivariate models accounted for 20% to 35% of the total variance of bone mass. A large number of factors influence the bone mass of elderly women; however, age, weight, muscle strength, and estrogen use are the most important factors.

  12. Testosterone dose-response relationships in hysterectomized women with or without oophorectomy: effects on sexual function, body composition, muscle performance and physical function in a randomized trial.

    PubMed

    Huang, Grace; Basaria, Shehzad; Travison, Thomas G; Ho, Matthew H; Davda, Maithili; Mazer, Norman A; Miciek, Renee; Knapp, Philip E; Zhang, Anqi; Collins, Lauren; Ursino, Monica; Appleman, Erica; Dzekov, Connie; Stroh, Helene; Ouellette, Miranda; Rundell, Tyler; Baby, Merilyn; Bhatia, Narender N; Khorram, Omid; Friedman, Theodore; Storer, Thomas W; Bhasin, Shalender

    2014-06-01

    This study aims to determine the dose-dependent effects of testosterone on sexual function, body composition, muscle performance, and physical function in hysterectomized women with or without oophorectomy. Seventy-one postmenopausal women who previously underwent hysterectomy with or without oophorectomy and had total testosterone levels less than 31 ng/dL or free testosterone levels less than 3.5 pg/mL received a standardized transdermal estradiol regimen during the 12-week run-in period and were randomized to receive weekly intramuscular injections of placebo or 3, 6.25, 12.5, or 25 mg of testosterone enanthate for 24 weeks. Total and free testosterone levels were measured by liquid chromatography-tandem mass spectrometry and equilibrium dialysis, respectively. The primary outcome was change in sexual function measured by the Brief Index of Sexual Functioning for Women. Secondary outcomes included changes in sexual activity, sexual distress, Derogatis Interview for Sexual Functioning, lean body mass, fat mass, muscle strength and power, and physical function. Seventy-one women were randomized; five groups were similar at baseline. Sixty-two women with analyzable data for the primary outcome were included in the final analysis. The mean on-treatment total testosterone concentrations were 19, 78, 102, 128, and 210 ng/dL in the placebo, 3-mg, 6.25-mg, 12.5-mg, and 25-mg groups, respectively. Changes in composite Brief Index of Sexual Functioning for Women scores, thoughts/desire, arousal, frequency of sexual activity, lean body mass, chest-press power, and loaded stair-climb power were significantly related to increases in free testosterone concentrations; compared with placebo, changes were significantly greater in women assigned to the 25-mg group, but not in women in the lower-dose groups. Sexual activity increased by 2.7 encounters per week in the 25-mg group. The frequency of androgenic adverse events was low. Testosterone administration in hysterectomized women with or without oophorectomy for 24 weeks was associated with dose and concentration-dependent gains in several domains of sexual function, lean body mass, chest-press power, and loaded stair-climb power. Long-term trials are needed to weigh improvements in these outcomes against potential long-term adverse effects.

  13. Physical activity for prevention of osteoporosis in patients with severe haemophilia on long-term prophylaxis.

    PubMed

    Khawaji, M; Astermark, J; Akesson, K; Berntorp, E

    2010-05-01

    Physical activity has been considered as an important factor for bone density and as a factor facilitating prevention of osteoporosis. Bone density has been reported to be reduced in haemophilia. To examine the relation between different aspects of physical activity and bone mineral density (BMD) in patients with severe haemophilia on long-term prophylaxis. The study group consisted of 38 patients with severe haemophilia (mean age 30.5 years). All patients received long-term prophylaxis to prevent bleeding. The bone density (BMD g cm(-2)) of the total body, lumbar spine, total hip, femoral neck and trochanter was measured by dual energy X-ray absorptiometry. Physical activity was assessed using the self-report Modifiable Activity Questionnaire, an instrument which collects information about leisure and occupational activities for the prior 12 months. There was only significant correlation between duration and intensity of vigorous physical activity and bone density at lumber spine L1-L4; for duration (r = 0.429 and P = 0.020) and for intensity (r = 0.430 and P = 0.019); whereas no significant correlation between all aspects of physical activity and bone density at any other measured sites. With adequate long-term prophylaxis, adult patients with haemophilia are maintaining bone mass, whereas the level of physical activity in terms of intensity and duration play a minor role. These results may support the proposition that the responsiveness to mechanical strain is probably more important for bone mass development in children and during adolescence than in adults and underscores the importance of early onset prophylaxis.

  14. Paraoxonase 1 Phenotype and Mass in South Asian versus Caucasian Renal Transplant Recipients.

    PubMed

    Connelly, Philip W; Maguire, Graham F; Nash, Michelle M; Rapi, Lindita; Yan, Andrew T; Prasad, G V Ramesh

    2012-01-01

    South Asian renal transplant recipients have a higher incidence of cardiovascular disease compared with Caucasian renal transplant recipients. We carried out a study to determine whether paraoxonase 1, a novel biomarker for cardiovascular risk, was decreased in South Asian compared with Caucasian renal transplant recipients. Subjects were matched two to one on the basis of age and sex for a total of 129 subjects. Paraoxonase 1 was measured by mass, arylesterase activity, and two-substrate phenotype assay. Comparisons were made by using a matched design. The frequency of PON1 QQ, QR and RR phenotype was 56%, 37%, and 7% for Caucasian subjects versus 35%, 44%, and 21% for South Asian subjects (χ(2) = 7.72, P = 0.02). PON1 mass and arylesterase activity were not significantly different between South Asian and Caucasian subjects. PON1 mass was significantly associated with PON1 phenotype (P = 0.0001), HDL cholesterol (P = 0.009), LDL cholesterol (P = 0.02), and diabetes status (P < 0.05). Arylesterase activity was only associated with HDL cholesterol (P = 0.003). Thus the frequency of the PON1 RR phenotype was higher and that of the QQ phenotype was lower in South Asian versus Caucasian renal transplant recipients. However, ethnicity was not a significant factor as a determinant of PON1 mass or arylesterase activity, with or without analysis including PON1 phenotype. The two-substrate method for determining PON1 phenotype may be of value for future studies of cardiovascular complications in renal transplant recipients.

  15. Objectively Assessed Physical Activity and its Association with Balance, Physical Function and Dyskinesia in Parkinson's Disease.

    PubMed

    Nero, Håkan; Benka Wallén, Martin; Franzén, Erika; Conradsson, David; Ståhle, Agneta; Hagströmer, Maria

    2016-10-19

    The desirable effects of physical activity in individuals with Parkinson's disease are well-known, although according to results from previous studies factors associated with objectively assessed physical activity are not fully investigated. To investigate demographic, disease-related and mobility-related factors that associate with objectively measured physical activity, in a sample of older adults with mild to moderate Parkinson's disease. Demographic, disease-related and mobility-related factors were gathered by interview from a total of 91 older adults with Parkinson's disease, followed by an evaluation of balance control using the Mini-BESTest. After initial testing, participants wore a tri-axial accelerometer during a week of free-living. Correlation analysis and multiple linear regression was used to investigate factors associated with total PA, represented by total activity counts, and time in brisk walking. Motor impairment, physical function, body mass index and dyskinesia contributed to the variance of total physical activity, explaining 34 % of the variance, while physical function and balance control were significant factors associated with brisk walking, explaining 22 %. This study identified factors that have not been shown to associate with objectively measured physical activity previously, such as dyskinesia, balance control and self-rated physical function. The findings also demonstrated that associated factors differ, depending on the activity behavior being investigated. However, other factors than those included in this study may also be of importance.

  16. In Situ Activation of Nitrogen-Doped Graphene Anchored on Graphite Foam for a High-Capacity Anode.

    PubMed

    Ji, Junyi; Liu, Jilei; Lai, Linfei; Zhao, Xin; Zhen, Yongda; Lin, Jianyi; Zhu, Yanwu; Ji, Hengxing; Zhang, Li Li; Ruoff, Rodney S

    2015-08-25

    We report the fabrication of a three-dimensional free-standing nitrogen-doped porous graphene/graphite foam by in situ activation of nitrogen-doped graphene on highly conductive graphite foam (GF). After in situ activation, intimate "sheet contact" was observed between the graphene sheets and the GF. The sheet contact produced by in situ activation is found to be superior to the "point contact" obtained by the traditional drop-casting method and facilitates electron transfer. Due to the intimate contact as well as the use of an ultralight GF current collector, the composite electrode delivers a gravimetric capacity of 642 mAh g(-1) and a volumetric capacity of 602 mAh cm(-3) with respect to the whole electrode mass and volume (including the active materials and the GF current collector). When normalized based on the mass of the active material, the composite electrode delivers a high specific capacity of up to 1687 mAh g(-1), which is superior to that of most graphene-based electrodes. Also, after ∼90 s charging, the anode delivers a capacity of about 100 mAh g(-1) (with respect to the total mass of the electrode), indicating its potential use in high-rate lithium-ion batteries.

  17. Plasticity in mesophyll volume fraction modulates light-acclimation in needle photosynthesis in two pines.

    PubMed

    Niinemets, Ulo; Lukjanova, Aljona; Turnbull, Matthew H; Sparrow, Ashley D

    2007-08-01

    Acclimation potential of needle photosynthetic capacity varies greatly among pine species, but the underlying chemical, anatomical and morphological controls are not entirely understood. We investigated the light-dependent variation in needle characteristics in individuals of Pinus patula Schlect. & Cham., which has 19-31-cm long pendulous needles, and individuals of P. radiata D. Don., which has shorter (8-17-cm-long) stiffer needles. Needle nitrogen and carbon contents, mesophyll and structural tissue volume fractions, needle dry mass per unit total area (M(A)) and its components, volume to total area ratio (V/A(T)) and needle density (D = M(A)/(V/A(T))), and maximum carboxylase activity of Rubisco (V(cmax)) and capacity of photosynthetic electron transport (J(max)) were investigated in relation to seasonal mean integrated irradiance (Q(int)). Increases in Q(int) from canopy bottom to top resulted in proportional increases in both needle thickness and width such that needle total to projected surface area ratio, characterizing the efficiency of light interception, was independent of Q(int). Increased light availability also led to larger M(A) and nitrogen content per unit area (N(A)). Light-dependent modifications in M(A) resulted from increases in both V/A(T) and D, whereas N(A) changed because of increases in both M(A) and mass-based nitrogen content (N(M)) (N(A) = N(M)M(A)). Overall, the volume fraction of mesophyll cells increased with increasing irradiance and V/A(T) as the fraction of hypodermis and epidermis decreased with increasing needle thickness. Increases in M(A) and N(A) resulted in enhanced J(max) and V(cmax) per unit area in both species, but mass-based photosynthetic capacity increased only in P. patula. In addition, J(max) and V(cmax) showed greater plasticity in response to light in P. patula. Species differences in mesophyll volume fraction explained most of the variation in mass-based needle photosynthetic capacity between species, demonstrating that differences in plastic adjustments in mass-based photosynthetic activities among these representative individuals were mainly associated with contrasting investments in mesophyll cells. Greater area-based photosynthetic plasticity in P. patula relative to P. radiata was associated with larger increases in M(A) and mesophyll volume fraction with increasing irradiance. These data collectively demonstrate that light-dependent increases in mass-based nitrogen contents and photosynthetic activities were associated with an increased mesophyll volume fraction in needles at higher irradiances. They also emphasize the importance of light-dependent anatomical modifications in determining needle photosynthetic capacity.

  18. You look all right to me: compromised nutritional status in paediatric patients with ulcerative colitis.

    PubMed

    Hill, Rebecca J; Davies, Peter S W

    2013-04-01

    It is reported that malnutrition is not a feature of ulcerative colitis (UC). Body mass index (BMI) is frequently used clinically to indicate nutritional status; however, it is a proxy measure at best, and body cell mass (BCM) is a much more accurate representation. The present study aims to investigate BMI in patients with UC in relation to their BCM. A total of 18 patients (7M; 11F) had their nutritional status (BCM) measured using total body potassium⁴⁰ counting every 6 months to yield a total of 77 measurements. BCM measurements were adjusted for height and sex, and BMI was calculated as weight/height², with z scores determined for both parameters. Disease activity was determined using the Pediatric Ulcerative Colitis Activity Index. Mean (±SD) height, weight, BMI, and BCM z scores were 0.39 (0.96), 0.20 (1.08), -0.05 (1.18), and -0.74 (1.41), respectively. No correlation was found between BMI and BCM z scores, and these z scores were significantly different (P=0.02), particularly in the moderate/severe disease activity group (P=0.01). Mean BCM z scores were -0.69 (1.65) of a z score below BMI z scores. Furthermore, where BMI z scores showed no relation to disease activity and no differences between disease activity categories, BCM z scores were significantly negatively correlated (r=-0.32, P=0.01), with significantly lower scores found in the moderate/severe group (P=0.01). Simply calculating BMI in patients with UC does not give adequate information regarding nutritional status, and more accurate, yet easily accessible "bedside" techniques need to be determined to improve patient care.

  19. Bulge Growth and Quenching since z = 2.5 in CANDELS/3D-HST

    NASA Astrophysics Data System (ADS)

    Lang, Philipp; Wuyts, Stijn; Somerville, Rachel S.; Förster Schreiber, Natascha M.; Genzel, Reinhard; Bell, Eric F.; Brammer, Gabe; Dekel, Avishai; Faber, Sandra M.; Ferguson, Henry C.; Grogin, Norman A.; Kocevski, Dale D.; Koekemoer, Anton M.; Lutz, Dieter; McGrath, Elizabeth J.; Momcheva, Ivelina; Nelson, Erica J.; Primack, Joel R.; Rosario, David J.; Skelton, Rosalind E.; Tacconi, Linda J.; van Dokkum, Pieter G.; Whitaker, Katherine E.

    2014-06-01

    Exploiting the deep high-resolution imaging of all five CANDELS fields, and accurate redshift information provided by 3D-HST, we investigate the relation between structure and stellar populations for a mass-selected sample of 6764 galaxies above 1010 M ⊙, spanning the redshift range 0.5 < z < 2.5. For the first time, we fit two-dimensional models comprising a single Sérsic fit and two-component (i.e., bulge + disk) decompositions not only to the H-band light distributions, but also to the stellar mass maps reconstructed from resolved stellar population modeling. We confirm that the increased bulge prominence among quiescent galaxies, as reported previously based on rest-optical observations, remains in place when considering the distributions of stellar mass. Moreover, we observe an increase of the typical Sérsic index and bulge-to-total ratio (with median B/T reaching 40%-50%) among star-forming galaxies above 1011 M ⊙. Given that quenching for these most massive systems is likely to be imminent, our findings suggest that significant bulge growth precedes a departure from the star-forming main sequence. We demonstrate that the bulge mass (and ideally knowledge of the bulge and total mass) is a more reliable predictor of the star-forming versus quiescent state of a galaxy than the total stellar mass. The same trends are predicted by the state-of-the-art, semi-analytic model by Somerville et al. In this model, bulges and black holes grow hand in hand through merging and/or disk instabilities, and feedback from active galactic nuclei shuts off star formation. Further observations will be required to pin down star formation quenching mechanisms, but our results imply that they must be internal to the galaxies and closely associated with bulge growth.

  20. Body Fat Composition: A Predictive Factor for Sleep Related Breathing Disorder in Obese Children.

    PubMed

    Bhatia, Rajeev; Lesser, Daniel J; Oliveira, Flavia G S A; Tran, Winston H; Keens, Thomas G; Khoo, Michael C K; Davidson Ward, Sally L

    2015-09-15

    The association between body fat composition as measured by dual energy x-ray absorptiometry (DEXA) scanning and pediatric sleep related breathing disorder (SRBD) is not well established. We investigated the relationship between body mass index (BMI) and DEXA parameters and their association with SRBD in obese children. Overnight polysomnography was performed on obese/overweight children (10-17 years) with habitual snoring. Total body fat mass (g), trunk fat mass (g), total body % fat, and trunk % fat were determined by DEXA. Forty-one subjects were studied. Logarithm (Log) total arousal index correlated with BMI (p < 0.01, r = 0.473), total body fat mass (p < 0.05, r = 0.331), and trunk fat mass (p < 0.05, r = 0.319). Log desaturation index correlated with BMI (p < 0.05, r = 0.313), total body fat mass (p < 0.05, r = 0.375), and trunk fat mass (p < 0.05, r = 0.391), whereas obstructive apnea hypopnea index (OAHI) did not. In males 10-12 years, there was a significant correlation between Log total arousal index and obesity parameters, but not for males aged 13-17 years. BMI correlated with DEXA parameters in all subjects: total body fat mass (p < 0.001, r = 0.850); total body % fat (p < 0.01, r = 0.425); trunk fat mass (p < 0.001, r = 0.792) and trunk % fat (p < 0.05, r = 0.318) and in 10-12 year old males. This relationship was not significant in males aged 13-17 years. Total body fat mass and trunk fat mass as well as BMI correlated with total arousal index and desaturation index. BMI correlated with DEXA parameters in 10-12 year old males but not in 13-17 year old males. The value of using DEXA scanning to study the relationship between obesity and SRBD may depend on age and pubertal stage. © 2015 American Academy of Sleep Medicine.

  1. Daily Overfeeding from Protein and/or Carbohydrate Supplementation for Eight Weeks in Conjunction with Resistance Training Does not Improve Body Composition and Muscle Strength or Increase Markers Indicative of Muscle Protein Synthesis and Myogenesis in Resistance-Trained Males

    PubMed Central

    Spillane, Mike; Willoughby, Darryn S.

    2016-01-01

    This study determined the effects of heavy resistance training and daily overfeeding with carbohydrate and/or protein on blood and skeletal muscle markers of protein synthesis (MPS), myogenesis, body composition, and muscle performance. Twenty one resistance-trained males were randomly assigned to either a protein + carbohydrate [HPC (n = 11)] or a carbohydrate [HC (n = 10)] supplement group in a double-blind fashion. Body composition and muscle performance were assessed, and venous blood samples and muscle biopsies were obtained before and after eight weeks of resistance training and supplementation. Data were analyzed by two-way ANOVA (p ≤ 0.05). Total body mass, body water, and fat mass were significantly increased in both groups in response to resistance training, but not supplementation (p < 0.05); however, lean mass was not significantly increased in either group (p = 0.068). Upper- (p = 0.024) and lower-body (p = 0.001) muscle strength and myosin heavy chain (MHC) 1 (p = 0.039) and MHC 2A (p = 0.027) were also significantly increased with resistance training. Serum IGF-1, GH, and HGF were not significantly affected (p > 0.05). Muscle total DNA, total protein, and c-Met were not significantly affected (p > 0.05). In conjunction with resistance training, the peri-exercise and daily overfeeding of protein and/or carbohydrate did not preferentially improve body composition, muscle performance, and markers indicative of MPS and myogenic activation. Key points In response to 56 days of heavy resistance training and HC or HPC supplementation, similar increases in muscle mass and strength in both groups occurred; however, the increases were not different between supplement groups. The supplementation of HPC had no preferential effect on augmenting serum IGF-1 GH, or HGF. The supplementation of HPC had no preferential effect on augmenting increases in total muscle protein content or the myogenic markers, total DNA and muscle cMet content. In response to 56 days of a daily supplemental dose of 94 g of protein and 196 g of carbohydrate, the HPC group was no more effective than 312 g of carbohydrate in the HC group in increasing muscle strength and mass due to its ability to elevate serum anabolic hormones and growth factors and markers of myogenic activation of satellite cells. PMID:26957922

  2. KNEE-JOINT LOADING IN KNEE OSTEOARTHRITIS: INFLUENCE OF ABDOMINAL AND THIGH FAT

    PubMed Central

    Messier, Stephen P.; Beavers, Daniel P.; Loeser, Richard F.; Carr, J. Jeffery; Khajanchi, Shubham; Legault, Claudine; Nicklas, Barbara J.; Hunter, David J.; DeVita, Paul

    2014-01-01

    Purpose Using three separate models that included total body mass, total lean and total fat mass, and abdominal and thigh fat as independent measures, we determined their association with knee-joint loads in older overweight and obese adults with knee osteoarthritis (OA). Methods Fat depots were quantified using computed tomography and total lean and fat mass determined with dual energy x-ray absorptiometry in 176 adults (age = 66.3 yr., BMI = 33.5 kg·m−2) with radiographic knee OA. Knee moments and joint bone-on-bone forces were calculated using gait analysis and musculoskeletal modeling. Results Higher total body mass was significantly associated (p ≤ 0.0001) with greater knee compressive and shear forces, compressive and shear impulses (p < 0.0001), patellofemoral forces (p< 0.006), and knee extensor moments (p = 0.003). Regression analysis with total lean and total fat mass as independent variables revealed significant positive associations of total fat mass with knee compressive (p = 0.0001), shear (p < 0.001), and patellofemoral forces (p = 0.01) and knee extension moment (p = 0.008). Gastrocnemius and quadriceps forces were positively associated with total fat mass. Total lean mass was associated with knee compressive force (p = 0.002). A regression model that included total thigh and total abdominal fat found both were significantly associated with knee compressive and shear forces (p ≤ 0.04). Thigh fat was associated with the knee abduction (p = 0.03) and knee extension moment (p = 0.02). Conclusions Thigh fat, consisting predominately of subcutaneous fat, had similar significant associations with knee joint forces as abdominal fat despite its much smaller volume and could be an important therapeutic target for people with knee OA. PMID:25133996

  3. Galaxy evolution in the cluster Abell 85: new insights from the dwarf population

    NASA Astrophysics Data System (ADS)

    Habas, Rebecca; Fadda, Dario; Marleau, Francine R.; Biviano, Andrea; Durret, Florence

    2018-04-01

    We present the first results of a new spectroscopic survey of the cluster Abell 85 targeting 1466 candidate cluster members within the central ˜1 deg2 of the cluster and having magnitudes mr < 20.5 using the VIsible MultiObject Spectrograph on the VLT and the Hydra spectrograh on WIYN. A total of 520 galaxies are confirmed as either relaxed cluster members or part of an infalling population. A significant fraction are low mass; the median stellar mass of the sample is 109.6 M⊙, and 25 per cent have stellar masses below 109 M⊙ (i.e. 133 dwarf galaxies). We also identify seven active galactic nuclei (AGN), four of which reside in dwarf host galaxies. We probe the evolution of star formation rates, based on Hα emission and continuum modelling, as a function of both mass and environment. We find that more star-forming galaxies are observed at larger clustercentric distances, while infalling galaxies show evidence for recently enhanced star-forming activity. Main-sequence galaxies, defined by their continuum star formation rates, show different evolutionary behaviour based on their mass. At the low-mass end, the galaxies have had their star formation recently quenched, while more massive galaxies show no significant change. The time-scales probed here favour fast quenching mechanisms, such as ram-pressure stripping. Galaxies within the green valley, defined similarly, do not show evidence of quenching. Instead, the low-mass galaxies maintain their levels of star-forming activity, while the more massive galaxies have experienced a recent burst.

  4. Effect of body mass and clothing on decomposition of pig carcasses.

    PubMed

    Matuszewski, Szymon; Konwerski, Szymon; Frątczak, Katarzyna; Szafałowicz, Michał

    2014-11-01

    Carcass mass and carcass clothing are factors of potential high forensic importance. In casework, corpses differ in mass and kind or extent of clothing; hence, a question arises whether methods for post-mortem interval estimation should take these differences into account. Unfortunately, effects of carcass mass and clothing on specific processes in decomposition and related entomological phenomena are unclear. In this article, simultaneous effects of these factors are analysed. The experiment followed a complete factorial block design with four levels of carcass mass (small carcasses 5-15 kg, medium carcasses 15.1-30 kg, medium/large carcasses 35-50 kg, large carcasses 55-70 kg) and two levels of carcass clothing (clothed and unclothed). Pig carcasses (N = 24) were grouped into three blocks, which were separated in time. Generally, carcass mass revealed significant and frequently large effects in almost all analyses, whereas carcass clothing had only minor influence on some phenomena related to the advanced decay. Carcass mass differently affected particular gross processes in decomposition. Putrefaction was more efficient in larger carcasses, which manifested itself through earlier onset and longer duration of bloating. On the other hand, active decay was less efficient in these carcasses, with relatively low average rate, resulting in slower mass loss and later onset of advanced decay. The average rate of active decay showed a significant, logarithmic increase with an increase in carcass mass, but only in these carcasses on which active decay was driven solely by larval blowflies. If a blowfly-driven active decay was followed by active decay driven by larval Necrodes littoralis (Coleoptera: Silphidae), which was regularly found in medium/large and large carcasses, the average rate showed only a slight and insignificant increase with an increase in carcass mass. These results indicate that lower efficiency of active decay in larger carcasses is a consequence of a multi-guild and competition-related pattern of this process. Pattern of mass loss in large and medium/large carcasses was not sigmoidal, but rather exponential. The overall rate of decomposition was strongly, but not linearly, related to carcass mass. In a range of low mass decomposition rate increased with an increase in mass, then at about 30 kg, there was a distinct decrease in rate, and again at about 50 kg, the rate slightly increased. Until about 100 accumulated degree-days larger carcasses gained higher total body scores than smaller carcasses. Afterwards, the pattern was reversed; moreover, differences between classes of carcasses enlarged with the progress of decomposition. In conclusion, current results demonstrate that cadaver mass is a factor of key importance for decomposition, and as such, it should be taken into account by decomposition-related methods for post-mortem interval estimation.

  5. Associations of infant subcutaneous fat mass with total and abdominal fat mass at school-age. The Generation R Study

    PubMed Central

    Santos, Susana; Gaillard, Romy; Oliveira, Andreia; Barros, Henrique; Abrahamse-Berkeveld, Marieke; van der Beek, Eline M; Hofman, Albert; Jaddoe, Vincent WV

    2017-01-01

    Background Skinfold thickness enables the measurement of overall and regional subcutaneous fatness in infancy and may be associated with total and abdominal body fat in later childhood. We examined the associations of subcutaneous fat in infancy with total and abdominal fat at school-age. Methods In a population-based prospective cohort study among 821 children, we calculated total subcutaneous fat (sum of biceps, triceps, suprailiacal and subscapular skinfold thicknesses) and central-to-total subcutaneous fat ratio (sum of suprailiacal and subscapular skinfold thicknesses/total subcutaneous fat) at 1.5 and 24 months. At 6 years, we measured fat mass index (total fat/height3), central-to-total fat ratio (trunk fat/total fat) and android-to-gynoid fat ratio (android fat/gynoid fat) by dual-energy X-ray absorptiometry and preperitoneal fat mass area by abdominal ultrasound. Results Central-to-total subcutaneous fat ratio at 1.5 months was positively associated with fat mass index and central-to-total fat ratio at 6 years, whereas both total and central-to-total subcutaneous fat ratio at 24 months were positively associated with all childhood adiposity measures (p<0.05). A 1-standard-deviation scores higher total subcutaneous fat at 24 months was associated with an increased risk of childhood overweight (Odds Ratio 1.70 [95% Confidence Interval 1.36, 2.12]). These associations were weaker than those for body mass index and stronger among girls than boys. Conclusions Subcutaneous fat in infancy is positively associated with total and abdominal fat at school-age. Our results also suggest that skinfold thicknesses add little value to estimate later body fat, as compared to body mass index. PMID:27225335

  6. Associations of Infant Subcutaneous Fat Mass with Total and Abdominal Fat Mass at School-Age: The Generation R Study.

    PubMed

    Santos, Susana; Gaillard, Romy; Oliveira, Andreia; Barros, Henrique; Abrahamse-Berkeveld, Marieke; van der Beek, Eline M; Hofman, Albert; Jaddoe, Vincent W V

    2016-09-01

    Skinfold thickness enables the measurement of overall and regional subcutaneous fatness in infancy and may be associated with total and abdominal body fat in later childhood. We examined the associations of subcutaneous fat in infancy with total and abdominal fat at school-age. In a population-based prospective cohort study among 821 children, we calculated total subcutaneous fat (sum of biceps, triceps, suprailiacal, and subscapular skinfold thicknesses) and central-to-total subcutaneous fat ratio (sum of suprailiacal and subscapular skinfold thicknesses/total subcutaneous fat) at 1.5 and 24 months. At 6 years, we measured fat mass index (total fat/height(3) ), central-to-total fat ratio (trunk fat/total fat), and android-to-gynoid fat ratio (android fat/gynoid fat) by dual-energy X-ray absorptiometry and preperitoneal fat mass area by abdominal ultrasound. Central-to-total subcutaneous fat ratio at 1.5 months was positively associated with fat mass index and central-to-total fat ratio at 6 years, whereas both total and central-to-total subcutaneous fat ratio at 24 months were positively associated with all childhood adiposity measures. A 1-standard-deviation scores higher total subcutaneous fat at 24 months was associated with an increased risk of childhood overweight (odds ratio 1.70, 95% confidence interval 1.36, 2.12). These associations were weaker than those for body mass index and stronger among girls than boys. Subcutaneous fat in infancy is positively associated with total and abdominal fat at school-age. Our results also suggest that skinfold thicknesses add little value to estimate later body fat, as compared with body mass index. © 2016 John Wiley & Sons Ltd.

  7. Seasonal metabolic depression, substrate utilisation and changes in scaling patterns during the first year cycle of tegu lizards (Tupinambis merianae).

    PubMed

    de Souza, Silvia Cristina R; de Carvalho, José Eduardo; Abe, Augusto S; Bicudo, José Eduardo P W; Bianconcini, Marilene S C

    2004-01-01

    The tegus increase in body mass after hatching until early autumn, when the energy intake becomes gradually reduced. Resting rates of oxygen consumption in winter drop to 20% of the values in the active season ((O(2))=0.0636 ml g(-1) h(-1)) and are nearly temperature insensitive over the range of 17-25 degrees C (Q(10)=1.55). During dormancy, plasma glucose levels are 60% lower than those in active animals, while total protein, total lipids and beta-hydroxybutyrate are elevated by 24%, 43% and 113%, respectively. In addition, a significant depletion of liver carbohydrate (50%) and of fat deposited in the visceral fat bodies (24%) and in the tail (25%) and a slight loss of skeletal muscle protein (14%) were measured halfway through the inactive period. Otherwise, glycogen content is increased 4-fold in the brain and 2.3-fold in the heart of dormant lizards, declining by the onset of arousal. During early arousal, the young tegus are still anorexic, although (O(2)) is significantly greater than winter rates. The fat deposits analysed are further reduced (62% and 45%, respectively) and there is a large decrease in tail muscle protein (50%) together with a significant increase in glycogen (2-3-fold) and an increase in plasma glucose (40%), which suggests a role for gluconeogenesis as a supplementary energy source in arousing animals. No change is detectable in citrate synthase activity, but beta-hydroxyacyl CoA dehydrogenase activities are strongly affected by season, reaching a 3-fold and 5-fold increase in the liver tissue of winter and arousing animals, respectively, and becoming reduced by half in skeletal muscle and heart of winter animals compared with late fall or spring active individuals. From hatching to late autumn, the increase of the fat body mass relatively to body mass is disproportionate (b=1.44), and the mass exponent changes significantly to close to 1.0 during the fasting period. The concomitant shift in the (O(2)) mass exponent in early autumn (b=0.75) to values significantly greater than 1.0 in late autumn and during winter dormancy indicates an allometric effect on the degree of metabolic depression related to the size of the fat stores and suggests greater energy conservation in the smaller young.

  8. A near-infrared relationship for estimating black hole masses in active galactic nuclei

    NASA Astrophysics Data System (ADS)

    Landt, Hermine; Ward, Martin J.; Peterson, Bradley M.; Bentz, Misty C.; Elvis, Martin; Korista, Kirk T.; Karovska, Margarita

    2013-06-01

    Black hole masses for samples of active galactic nuclei (AGN) are currently estimated from single-epoch optical spectra using scaling relations anchored in reverberation mapping results. In particular, the two quantities needed for calculating black hole masses, namely the velocity and the radial distance of the orbiting gas are derived from the widths of the Balmer hydrogen broad emission lines and the optical continuum luminosity, respectively. We have recently presented a near-infrared (near-IR) relationship for estimating AGN black hole masses based on the widths of the Paschen hydrogen broad emission lines and the total 1 μm continuum luminosity. The near-IR offers several advantages over the optical: it suffers less from dust extinction, the AGN continuum is observed only weakly contaminated by the host galaxy and the strongest Paschen broad emission lines Paα and Paβ are unblended. Here, we improve the calibration of the near-IR black hole mass relationship by increasing the sample from 14 to 23 reverberation-mapped AGN using additional spectroscopy obtained with the Gemini Near-Infrared Spectrograph. The additional sample improves the number statistics in particular at the high-luminosity end.

  9. Polarization and mass transfer during the electrolysis of molten salts with liquid metallic electrodes

    NASA Astrophysics Data System (ADS)

    Mikhalev, Yu. G.

    2014-08-01

    Calculations are used to show that the fraction of the overvoltage of the stage of discharge-ionization can be significant in the total overvoltage during the polarization of liquid metallic electrodes in molten chlorides depleted of electrochemically active particles (depending on the type of the dissipative structures that appear near the electrode/electrolyte interface). This finding is taken into account to obtain criterion equations to describe the mass-transfer rate as a function of the physicochemical properties of the electrolyte and the metal electrode.

  10. Identification of metabolites from an active fraction of Cajanus cajan seeds by high resolution mass spectrometry.

    PubMed

    Tekale, Satishkumar S; Jaiwal, Bhimrao V; Padul, Manohar V

    2016-11-15

    Antioxidants are important food additives which prolong food storage due to their protective effects against oxidative degradation of foods by free radicals. However, the synthetic antioxidants show toxic properties. Alternative economical and eco-friendly approach is screening of plant extract for natural antioxidants. Plant phenolics are potent antioxidants. Hence, in present study Cajanus cajan seeds were analyzed for antioxidant activity, Iron chelating activity and total phenolic content. The antioxidant activity using DPPH (2,2-diphenyl-1-picrylhydrazyl) radical scavenging assay showed 71.3% inhibition and 65.8% Iron chelating activity. Total 37 compounds including some short peptides and five major abundant compounds were identified in active fraction of C. cajan seeds. This study concludes that C. cajan seeds are good source of antioxidants and Iron chelating activity. Metabolites found in C. cajan seeds which remove reactive oxygen species (ROS), may help to alleviate oxidative stress associated dreaded health problem like cancer and cardiovascular diseases. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Time trends in physical activity from 1982 to 2012 in Finland.

    PubMed

    Borodulin, K; Harald, K; Jousilahti, P; Laatikainen, T; Männistö, S; Vartiainen, E

    2016-01-01

    The aim of this study was to examine population trends from 1982 to 2012 in Finland for leisure time physical activity (LTPA), commuting physical activity (CPA), occupational physical activity (OPA), and total physical activity. Furthermore, time trends in physical activity by educational levels and body mass index (BMI) categories were explored. Data were collected in independent cross-sectional population surveys, implemented every 5 years from 1982 to 2012. The data comprised 21,903 men and 24,311 women. Participants underwent a health examination and filled in questionnaires. Information on LTPA, CPA, and OPA was used both separately and combined to create an index of total physical activity. Between 1982 and 2012, high LTPA has increased in men (from 21% to 33%) and women (from 12% to 27%). High CPA and high OPA have decreased in men (from 17% to 12% and from 48% to 36%, respectively) and women (from 30% to 20% and from 26% to 21%, respectively). Total physical activity has remained fairly stable. Differences by education and BMI have increased, particularly for LTPA. Marked changes in physical activity have taken place over time. Differences in LTPA and OPA have grown wider across educational groups and BMI categories. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  12. Lifestyle Practices and Obesity in Malaysian Adolescents

    PubMed Central

    Teo, Pey Sze; Nurul-Fadhilah, Abdullah; Aziz, Mohd Ezane; Hills, Andrew P.; Foo, Leng Huat

    2014-01-01

    Aim: To determine the influence of physical activity (PA) and sedentary behavior (SB) on obesity profiles of 454 Malaysian adolescents aged 12 to 19. Methods: Validated PA and SB questionnaires were used and body composition assessed using anthropometry and dual-energy X-ray absorptiometry (DXA). Results: Gender-specific multivariate analyses showed boys with high levels of total PA and moderate-to-vigorous physical activity (MVPA) exhibited significantly lower levels of total body fat, percent body fat and android fat mass compared with low PA and MVPA groups, after adjusting for potential confounders. Girls with high SB levels showed significantly higher BMI, waist circumference and DXA-derived body fat indices than those at lower SB level. Multiple logistic analyses indicated that boys with low levels of total PA and MVPA had significantly greater obesity risk, 3.0 (OR 3.0; 95% CI, 1.1–8.1; p < 0.05) and 3.8-fold (OR 3.8; 95% CI, 1.4–10.1; p < 0.01), respectively, than more active boys. Only in girls with high SB level was there a significantly increased risk of obesity, 2.9 times higher than girls at low SP levels (OR 2.8; 95% CI, 1.0–7.5; p < 0.05). Conclusions: The present findings indicate that higher PA duration and intensity reduced body fat and obesity risk while high screen-based sedentary behaviors significantly adversely influenced body fat mass, particularly amongst girls when the PA level was low. PMID:24886753

  13. Lifestyle practices and obesity in Malaysian adolescents.

    PubMed

    Teo, Pey Sze; Nurul-Fadhilah, Abdullah; Aziz, Mohd Ezane; Hills, Andrew P; Foo, Leng Huat

    2014-05-30

    To determine the influence of physical activity (PA) and sedentary behavior (SB) on obesity profiles of 454 Malaysian adolescents aged 12 to 19. Validated PA and SB questionnaires were used and body composition assessed using anthropometry and dual-energy X-ray absorptiometry (DXA). Gender-specific multivariate analyses showed boys with high levels of total PA and moderate-to-vigorous physical activity (MVPA) exhibited significantly lower levels of total body fat, percent body fat and android fat mass compared with low PA and MVPA groups, after adjusting for potential confounders. Girls with high SB levels showed significantly higher BMI, waist circumference and DXA-derived body fat indices than those at lower SB level. Multiple logistic analyses indicated that boys with low levels of total PA and MVPA had significantly greater obesity risk, 3.0 (OR 3.0; 95% CI, 1.1-8.1; p < 0.05) and 3.8-fold (OR 3.8; 95% CI, 1.4-10.1; p < 0.01), respectively, than more active boys. Only in girls with high SB level was there a significantly increased risk of obesity, 2.9 times higher than girls at low SP levels (OR 2.8; 95% CI, 1.0-7.5; p < 0.05).   The present findings indicate that higher PA duration and intensity reduced body fat and obesity risk while high screen-based sedentary behaviors significantly adversely influenced body fat mass, particularly amongst girls when the PA level was low.

  14. Measurement of total body calcium in osteoporotic patients treated with salmon calcitonin

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Zanzi, I.; Thompson, K.; Cohn, S.H.

    1981-01-01

    In the past, the evaluation of therapies for osteoporosis has been limited by the lack of a suitable quantitative end point. The introduction of the technique of in vivo total body neutron activation analysis (TBNAA) has made possible the precise and accurate measurement of total body calcium (TBCa). Since almost 99 percent of TBCa is in the skeleton, TBNAA gives a direct measurement of skeletal mass. Thus, changes in skeletal mass serve as an objective criterion in the evaluation of the efficacy of the therapy in osteoporosis. Studies performed at Brookhaven National Laboratory and elsewhere have reported the use ofmore » calcitonin (CT) in the treatment of primary osteoporosis and related conditions in a limited number of patients. The physiological effects of CT as an inhibitor of bone resorption has been the rationale of its use. The results of a randomized, controlled, 2 year therapeutical trial of CT in a group of postmenopausal osteoporotic women are presented in this report.« less

  15. Chemical profile of mango (Mangifera indica L.) using electrospray ionisation mass spectrometry (ESI-MS).

    PubMed

    Oliveira, Bruno G; Costa, Helber B; Ventura, José A; Kondratyuk, Tamara P; Barroso, Maria E S; Correia, Radigya M; Pimentel, Elisângela F; Pinto, Fernanda E; Endringer, Denise C; Romão, Wanderson

    2016-08-01

    Mangifera indica L., mango fruit, is consumed as a dietary supplement with purported health benefits; it is widely used in the food industry. Herein, the chemical profile of the Ubá mango at four distinct maturation stages was evaluated during the process of growth and maturity using negative-ion mode electrospray ionisation Fourier transform ion cyclotron resonance mass spectrometry (ESI(-)FT-ICR MS) and physicochemical characterisation analysis (total titratable acidity (TA), total soluble solids (TSS), TSS/TA ratio, and total polyphenolic content). Primary (organic acids and sugars) and secondary metabolites (polyphenolic compounds) were mostly identified in the third maturation stage, thus indicating the best stage for harvesting and consuming the fruit. In addition, the potential cancer chemoprevention of the secondary metabolites (phenolic extracts obtained from mango samples) was evaluated using the induction of quinone reductase activity, concluding that fruit polyphenols have the potential for cancer chemoprevention. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Total body skeletal muscle mass: estimation by creatine (methyl-d3) dilution in humans

    PubMed Central

    Walker, Ann C.; O'Connor-Semmes, Robin L.; Leonard, Michael S.; Miller, Ram R.; Stimpson, Stephen A.; Turner, Scott M.; Ravussin, Eric; Cefalu, William T.; Hellerstein, Marc K.; Evans, William J.

    2014-01-01

    Current methods for clinical estimation of total body skeletal muscle mass have significant limitations. We tested the hypothesis that creatine (methyl-d3) dilution (D3-creatine) measured by enrichment of urine D3-creatinine reveals total body creatine pool size, providing an accurate estimate of total body skeletal muscle mass. Healthy subjects with different muscle masses [n = 35: 20 men (19–30 yr, 70–84 yr), 15 postmenopausal women (51–62 yr, 70–84 yr)] were housed for 5 days. Optimal tracer dose was explored with single oral doses of 30, 60, or 100 mg D3-creatine given on day 1. Serial plasma samples were collected for D3-creatine pharmacokinetics. All urine was collected through day 5. Creatine and creatinine (deuterated and unlabeled) were measured by liquid chromatography mass spectrometry. Total body creatine pool size and muscle mass were calculated from D3-creatinine enrichment in urine. Muscle mass was also measured by magnetic resonance imaging (MRI), dual-energy x-ray absorptiometry (DXA), and traditional 24-h urine creatinine. D3-creatine was rapidly absorbed and cleared with variable urinary excretion. Isotopic steady-state of D3-creatinine enrichment in the urine was achieved by 30.7 ± 11.2 h. Mean steady-state enrichment in urine provided muscle mass estimates that correlated well with MRI estimates for all subjects (r = 0.868, P < 0.0001), with less bias compared with lean body mass assessment by DXA, which overestimated muscle mass compared with MRI. The dilution of an oral D3-creatine dose determined by urine D3-creatinine enrichment provides an estimate of total body muscle mass strongly correlated with estimates from serial MRI with less bias than total lean body mass assessment by DXA. PMID:24764133

  17. Total body skeletal muscle mass: estimation by creatine (methyl-d3) dilution in humans.

    PubMed

    Clark, Richard V; Walker, Ann C; O'Connor-Semmes, Robin L; Leonard, Michael S; Miller, Ram R; Stimpson, Stephen A; Turner, Scott M; Ravussin, Eric; Cefalu, William T; Hellerstein, Marc K; Evans, William J

    2014-06-15

    Current methods for clinical estimation of total body skeletal muscle mass have significant limitations. We tested the hypothesis that creatine (methyl-d3) dilution (D3-creatine) measured by enrichment of urine D3-creatinine reveals total body creatine pool size, providing an accurate estimate of total body skeletal muscle mass. Healthy subjects with different muscle masses [n = 35: 20 men (19-30 yr, 70-84 yr), 15 postmenopausal women (51-62 yr, 70-84 yr)] were housed for 5 days. Optimal tracer dose was explored with single oral doses of 30, 60, or 100 mg D3-creatine given on day 1. Serial plasma samples were collected for D3-creatine pharmacokinetics. All urine was collected through day 5. Creatine and creatinine (deuterated and unlabeled) were measured by liquid chromatography mass spectrometry. Total body creatine pool size and muscle mass were calculated from D3-creatinine enrichment in urine. Muscle mass was also measured by magnetic resonance imaging (MRI), dual-energy x-ray absorptiometry (DXA), and traditional 24-h urine creatinine. D3-creatine was rapidly absorbed and cleared with variable urinary excretion. Isotopic steady-state of D3-creatinine enrichment in the urine was achieved by 30.7 ± 11.2 h. Mean steady-state enrichment in urine provided muscle mass estimates that correlated well with MRI estimates for all subjects (r = 0.868, P < 0.0001), with less bias compared with lean body mass assessment by DXA, which overestimated muscle mass compared with MRI. The dilution of an oral D3-creatine dose determined by urine D3-creatinine enrichment provides an estimate of total body muscle mass strongly correlated with estimates from serial MRI with less bias than total lean body mass assessment by DXA. Copyright © 2014 the American Physiological Society.

  18. Daily total physical activity level and premature death in men and women: results from a large-scale population-based cohort study in Japan (JPHC study).

    PubMed

    Inoue, Manami; Iso, Hiroyasu; Yamamoto, Seiichiro; Kurahashi, Norie; Iwasaki, Motoki; Sasazuki, Shizuka; Tsugane, Shoichiro

    2008-07-01

    The impact of daily total physical activity level on premature deaths has not been fully clarified in non-Western, relatively lean populations. We prospectively examined the association between daily total physical activity level (METs/day) and subsequent risk of all-cause mortality and mortalities from cancer, heart disease, and cerebrovascular disease. A total of 83,034 general Japanese citizens ages 45-74 years who responded to the questionnaire in 1995-1999 were followed for any cause of death through December 2005. Mutlivariate-adjusted hazard ratios were calculated with a Cox proportional hazards model controlling for potential confounding factors. During follow-up, a total of 4564 deaths were recorded. Compared with subjects in the lowest quartile, increased daily total physical activity was associated with a significantly decreased risk of all-cause mortality in both sexes (hazard ratios for the second, third, and highest quartiles were: men, 0.79, 0.82, 0.73 and women, 0.75, 0.64, 0.61, respectively). The decreased risk was observed regardless of age, frequency of leisure-time sports or physical exercise, or obesity status, albeit with a degree of risk attenuation among those with a high body mass index. A significantly decreased risk was similarly observed for death from cancer and heart disease in both sexes, and from cerebrovascular disease in women. Greater daily total physical activity level, either from occupation, daily life, or leisure time, may be of benefit in preventing premature death.

  19. Effect of Naturally Occurring nif Reiterations on Symbiotic Effectiveness in Rhizobium phaseoli

    PubMed Central

    Romero, David; Singleton, Paul W.; Segovia, Lorenzo; Morett, Enrique; Bohlool, B. Ben; Palacios, Rafael; Dávila, Guillermo

    1988-01-01

    Most naturally occurring strains of Rhizobium phaseoli possess reiteration of the nif genes. Three regions contain nitrogenase structural genes in strain CFN42. Two of these regions (a and b) have copies of nifH, nifD, and nifK, whereas the third region (c) contains only nifH. Strains containing mutations in either nif region a or nif region b had significantly diminished symbiotic effectiveness compared with the wild-type strain on the basis of nodule mass, total nitrogenase activity per plant, nitrogenase specific activity, total nitrogen in the shoot, and percentage of nitrogen. A strain containing mutations in both nif region a and nif region b was totally ineffective. These data indicate that both nif region a and nif region b are needed for full symbiotic effectiveness in R. phaseoli. PMID:16347593

  20. School-based study found that physical activity and aerobic fitness predicted increases in total body fat and abdominal fat at a mean age of 9.8 years.

    PubMed

    Danielson, Anton; Thorsson, Ola; Karlsson, Magnus K; Wollmer, Per; Andersen, Lars B; Dencker, Magnus

    2018-02-22

    We assessed whether baseline measurements of physical activity, aerobic fitness, body fat and abdominal fat were predictors of changes in body fat measurements over a two-year period. The study comprised of 204 children aged 9.8 ± 0.6 years with a normal body mass distribution, who recruited from four schools in middle-class areas of Malmö, Sweden, from 2001 to 2004. Peak oxygen uptake and physical activity were measured at baseline. Body fat was measured by dual-energy X-ray absorptiometry at baseline and two years later. Physical activity, aerobic fitness and total body fat or abdominal fat were predictors of change in total body fat or abdominal fat over a period of two years. Changes in the percentage of body fat were not related to any of the baseline measurements. Our two-year follow-up of children with a mean age of 9.8 years at baseline showed that physical activity, aerobic fitness and body fat or abdominal fat predicted changes in total body fat or abdominal fat, but not the percentage of body fat. ©2018 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.

  1. Changes of phenolic profiles and antioxidant activity in canaryseed (Phalaris canariensis L.) during germination.

    PubMed

    Chen, Zhijie; Yu, Lilei; Wang, Xinkun; Gu, Zhenxin; Beta, Trust

    2016-03-01

    Canaryseed is an important cereal crop in western Canada. The changes of the total phenolic content (TPC), antioxidant activities, phenolic acid profiles (free and bound) of canaryseed during germination were investigated in the present study. The growth properties also were investigated. Fresh weight, shoot length and root length increased, whereas dry mass of canaryseed decreased during germination. A 22.3% loss of dry matter was observed at 120h of germination. The total phenolic content and antioxidant activities of free and bound extracts showed a general trend of germinated seeds>raw seeds>soaked seeds. Free, bound and total phenolic content significantly increased 1042%, 120% and 741% at the end of germination as compared to raw seeds (p<0.05). DPPH, ABTS and ORAC assays were employed to evaluate the antioxidant activity of canaryseed. There were high correlations between total phenolic content and antioxidant activities. TPC and ORAC values showed the highest correlation (r=0.9984). Six phenolic acids in free phenolic extracts and seven phenolic acids in bound phenolic extracts were detected, respectively. Bound ferulic acid, the dominant phenolic acid in canaryseed, significantly increased during germination (p<0.05). Study showed that germination provided a new approach to further develop canaryseed as a functional food for human consumption. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. On the formation and confinement of dense clouds in QSOs and active galactic nuclei

    NASA Technical Reports Server (NTRS)

    Marscher, A. P.; Weaver, R. P.

    1979-01-01

    A model for the formation and confinement of dense (at least about 1 billion per cu cm) clouds in QSOs and active galactic nuclei is presented wherein thermal instabilities behind radiative shocks cause the collapse of regions where the preshock density is enhanced over that of the surrounding medium. Such shocks (of total energy around 10 to the 51st ergs) are likely to occur if the frequent optical outbursts observed in many of these objects are accompanied by mass ejections of comparable energy. It is found that clouds quite similar to those thought to exist in QSOs etc. can be created in this manner at radii of the order of 10 to the 17th cm. The clouds can be subsequently accelerated to observed bulk velocities by either radiation pressure or a collision with a much stronger (total energy around 10 to the 53 ergs) shock. Alternatively, their high observed velocities could be caused by gravitational infall or rotation. The mass production required at inner radii by the outflow models can be supplied through a mechanism previously discussed by Shields (1977).

  3. Muon dynamic radiography of density changes induced by hydrothermal activity at the La Soufrière of Guadeloupe volcano

    NASA Astrophysics Data System (ADS)

    Jourde, Kevin; Gibert, Dominique; Marteau, Jacques; de Bremond D'Ars, Jean; Komorowski, Jean-Christophe

    2016-09-01

    Imaging geological structures through cosmic muon radiography is a newly developed technique which shows a great potential in volcanology. Here we demonstrate that muon radiography permits to detect and characterize mass movements in shallow hydrothermal systems of low-energy active volcanoes like the La Soufrière lava dome. We present an experiment conducted on this volcano during the Summer 2014 and bring evidence that very important density changes occurred in three domains of the lava dome. Depending on their position and on the medium porosity the volumes of these domains vary from 1 × 106 m3 to 7 × 106 m3. However, the total mass budget remains approximately constant : two domains show a mass loss (Δm∈ [-0.8-0.4] × 109 kg) and the third one a mass gain (Δm∈ [1.5; 2.5] × 109 kg). We attribute the negative mass changes to the formation of steam in shallow hydrothermal reservoir previously partly filled with liquid water. This coincides with the emergence of new fumaroles on top of the volcano. The positive mass change is synchronized with the negative mass changes indicating that liquid water probably flowed from the two reservoirs invaded by steam toward the third reservoir.

  4. Muon dynamic radiography of density changes induced by hydrothermal activity at the La Soufrière of Guadeloupe volcano

    PubMed Central

    Jourde, Kevin; Gibert, Dominique; Marteau, Jacques; de Bremond d’Ars, Jean; Komorowski, Jean-Christophe

    2016-01-01

    Imaging geological structures through cosmic muon radiography is a newly developed technique which shows a great potential in volcanology. Here we demonstrate that muon radiography permits to detect and characterize mass movements in shallow hydrothermal systems of low-energy active volcanoes like the La Soufrière lava dome. We present an experiment conducted on this volcano during the Summer 2014 and bring evidence that very important density changes occurred in three domains of the lava dome. Depending on their position and on the medium porosity the volumes of these domains vary from 1 × 106 m3 to 7 × 106 m3. However, the total mass budget remains approximately constant : two domains show a mass loss (Δm∈ [−0.8;−0.4] × 109 kg) and the third one a mass gain (Δm∈ [1.5; 2.5] × 109 kg). We attribute the negative mass changes to the formation of steam in shallow hydrothermal reservoir previously partly filled with liquid water. This coincides with the emergence of new fumaroles on top of the volcano. The positive mass change is synchronized with the negative mass changes indicating that liquid water probably flowed from the two reservoirs invaded by steam toward the third reservoir. PMID:27629497

  5. Muon dynamic radiography of density changes induced by hydrothermal activity at the La Soufrière of Guadeloupe volcano.

    PubMed

    Jourde, Kevin; Gibert, Dominique; Marteau, Jacques; de Bremond d'Ars, Jean; Komorowski, Jean-Christophe

    2016-09-15

    Imaging geological structures through cosmic muon radiography is a newly developed technique which shows a great potential in volcanology. Here we demonstrate that muon radiography permits to detect and characterize mass movements in shallow hydrothermal systems of low-energy active volcanoes like the La Soufrière lava dome. We present an experiment conducted on this volcano during the Summer 2014 and bring evidence that very important density changes occurred in three domains of the lava dome. Depending on their position and on the medium porosity the volumes of these domains vary from 1 × 10(6) m(3) to 7 × 10(6) m(3). However, the total mass budget remains approximately constant : two domains show a mass loss (Δm∈ [-0.8;-0.4] × 10(9) kg) and the third one a mass gain (Δm∈ [1.5; 2.5] × 10(9) kg). We attribute the negative mass changes to the formation of steam in shallow hydrothermal reservoir previously partly filled with liquid water. This coincides with the emergence of new fumaroles on top of the volcano. The positive mass change is synchronized with the negative mass changes indicating that liquid water probably flowed from the two reservoirs invaded by steam toward the third reservoir.

  6. Galaxy triplets in Sloan Digital Sky Survey Data Release 7 - II. A connection with compact groups?

    NASA Astrophysics Data System (ADS)

    Duplancic, Fernanda; O'Mill, Ana Laura; Lambas, Diego G.; Sodré, Laerte; Alonso, Sol

    2013-08-01

    We analyse a sample of 71 triplets of luminous galaxies derived from the work of O'Mill et al. We compare the properties of triplets and their members with those of control samples of compact groups, the 10 brightest members of rich clusters and galaxies in pairs. The triplets are restricted to have members with spectroscopic redshifts in the range 0.01 ≤ z ≤ 0.14 and absolute r-band luminosities brighter than Mr = -20.5. For these member galaxies, we analyse the stellar mass content, the star formation rates, the Dn(4000) parameter and (Mg - Mr) colour index. Since galaxies in triplets may finally merge in a single system, we analyse different global properties of these systems. We calculate the probability that the properties of galaxies in triplets are strongly correlated. We also study total star formation activity and global colours, and define the triplet compactness as a measure of the percentage of the system total area that is filled by the light of member galaxies. We concentrate in the comparison of our results with those of compact groups to assess how the triplets are a natural extension of these compact systems. Our analysis suggests that triplet galaxy members behave similarly to compact group members and galaxies in rich clusters. We also find that systems comprising three blue, star-forming, young stellar population galaxies (blue triplets) are most probably real systems and not a chance configuration of interloping galaxies. The same holds for triplets composed of three red, non-star-forming galaxies, showing the correlation of galaxy properties in these systems. From the analysis of the triplet as a whole, we conclude that, at a given total stellar mass content, triplets show a total star formation activity and global colours similar to compact groups. However, blue triplets show a high total star formation activity with a lower stellar mass content. From an analysis of the compactness parameter of the systems we find that light is even more concentrated in triplets than in compact groups. We propose that triplets composed of three luminous galaxies, should not be considered as an analogous of galaxy pairs with a third extra member, but rather they are a natural extension of compact groups.

  7. Association between leg strength and muscle cross-sectional area of the quadriceps femoris with the physical activity level in octogenarians.

    PubMed

    Latorre-Román, Pedro Á; Arévalo-Arévalo, Juan Manuel; García-Pinillos, Felipe

    2016-06-03

    Aging is a complex physiological process whose main feature is the progressive loss of functionality, which may be delayed or attenuated by improving physical fitness.  To determine the association between leg strength and the muscle cross-sectional area of the quadriceps femoris in relation to physical activity level in the elderly.  Thirty-two functionally autonomous people over 80 years (men: 82.80±2.09 years; women: 83.77±4.09 years) participated in this study. The Barthel Index, the Yale Physical Activity Survey and the Chair Stand Test were the instruments used.  There were significant differences between sexes in muscle area (p<0.001) in the Chair Stand Test (p=0.028) and the walk index (p=0.029), with higher values in men. The muscle area and the Chair Stand Test correlated significantly with the walk index (r=0.445, p<0.005, and r=0.522, p<0.001, respectively) and the total weekly activity index (r=0.430, p<0.005, and r=0.519, p<0.001, respectively). In the multiple linear regression models for the total weekly activity index, muscle area and the Chair Stand Test, only the latter behaved as a predictor variable.  Muscle strength and muscle mass of quadriceps showed a significant association with the physical activity level in older people. Leg muscle strength was useful to reveal muscle mass and physical activity level in older people, which is relevant as a clinical practice indicator.

  8. Body composition changes over 9 years in healthy elderly subjects and impact of physical activity.

    PubMed

    Genton, Laurence; Karsegard, Véronique L; Chevalley, Thierry; Kossovsky, Michel P; Darmon, Patrice; Pichard, Claude

    2011-08-01

    Age-related changes of body composition affect health status. This study aims at clarifying body composition changes in healthy elderly subjects, and evaluating the impact of physical activity on these changes. In 1999, 213 subjects ≥ 65 years recruited through advertisements underwent assessment of health state, energy expenditure by physical activity, body composition by bioimpedance analysis and body cell mass by total body potassium. In 2008, 112 of them repeated these assessments with additional determination of Barthel index, Mini Mental State Examination and Geriatric Depression Score. Lean tissues decreased in both genders (p < 0.05). Compared to subjects aged 65-74 years at baseline, those aged ≥75 years lost more body weight (men: -3.7 ± 5.4 vs. 0.4 ± 5.4 kg, women: -3.6 ± 5.5 vs. 0.3 ± 5.2 kg, both p < 0.05), and fat-free mass (men: -3.6 ± 3.3 vs. -0.4 ± 2.7 kg, women: -1.8 ± 2.3 vs. -0.1 ± 2.5 kg, both p < 0.05). Plotting of fat-free mass evolution against age at baseline showed an exponential loss of fat-free mass. Increased physical activity limited lean tissue loss in men but not in women. Loss of lean tissues occurs exponentially with aging. Further research should confirm these changes in subjects over 80 years. Increasing physical activity limits fat-free mass loss in men but not women. Copyright © 2011 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism. All rights reserved.

  9. The chemical composition and antimicrobial activity of the leaf oil of Cupressus lusitanica from Monteverde, Costa Rica

    PubMed Central

    Hassanzadeh, Sara L.; Tuten, Jessika A.; Vogler, Bernhard; Setzer, William N.

    2010-01-01

    The essential oils from the leaves of three different individuals of Cupressus lusitanica were obtained by hydrodistillation and analyzed by gas chromatography - mass spectrometry. A total of 49 compounds were identified in the leaf oils. The major components of C. lusitanica leaf oil were α-pinene (40%-82%), limonene (4%-18%), isobornyl acetate (up to 10%) and cis-muurola-4(14),5-diene (up to 7%). The essential oil was screened for antimicrobial activity, and it showed antibacterial activity against Bacillus cereus and antifungal activity against Aspergillus niger. PMID:21808533

  10. Interdependence of physical inactivity, loss of muscle mass and low dietary intake: Extrapulmonary manifestations in older chronic obstructive pulmonary disease patients.

    PubMed

    Yoshimura, Kazuya; Sato, Susumu; Muro, Shigeo; Yamada, Minoru; Hasegawa, Koichi; Kiyokawa, Hirofumi; Mishima, Michiaki; Aoyama, Tomoki

    2018-01-01

    Extrapulmonary manifestations, such as reductions in skeletal muscle and physical inactivity, are important clinical features of patients with chronic obstructive pulmonary disease (COPD), and might depend on the severity of COPD. As it is still unclear whether the relationship between muscle loss and physical inactivity is dominated by a disease-specific relationship or caused by patient factors, including physiological aging, we aimed to investigate the pulmonary or extrapulmonary factors associated with physical inactivity among older COPD patients. A total of 38 older male COPD patients (aged ≥65 years) were enrolled, and were evaluated cross-sectionally. Skeletal muscle mass was measured using bioelectrical impedance, and physical activity and energy intake were recorded for 2 weeks using a pedometer and diary. Daily step counts were successfully evaluated in 28 participants (mean forced expiratory volume in 1 s [%predicted; %FEV 1 ]; 49.5%), and ranged widely. The mean step counts was 5166 steps/day, and found to have a significant relationship with dyspnea (r = -0.46), diffusing capacity (r = 0.47), %FEV1 (r = 0.44), skeletal muscle index (r = 0.59) and total dietary intake (r = 0.47), but not with age (P = 0.14). A stepwise multivariate analysis showed that the skeletal muscle index (β = 0.50) and total dietary intake (β = 0.35) were significant determinants of the daily step count (R 2 = 0.46, p < 0.01). Although various pulmonary factors are associated with daily physical activity, skeletal muscle mass and dietary intake are more closely correlated with physical activity in COPD patients. Because physical inactivity might be the strongest predictor of prognosis, the present results suggest that a comprehensive treatment strategy must be considered for older COPD patients to improve their extrapulmonary manifestations and pulmonary dysfunction. Geriatr Gerontol Int 2018; 18: 88-94. © 2017 Japan Geriatrics Society.

  11. STELLAR AND TOTAL BARYON MASS FRACTIONS IN GROUPS AND CLUSTERS SINCE REDSHIFT 1

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Giodini, S.; Pierini, D.; Finoguenov, A.

    2009-09-20

    We investigate if the discrepancy between estimates of the total baryon mass fraction obtained from observations of the cosmic microwave background (CMB) and of galaxy groups/clusters persists when a large sample of groups is considered. To this purpose, 91 candidate X-ray groups/poor clusters at redshift 0.1 <= z <= 1 are selected from the COSMOS 2 deg{sup 2} survey, based only on their X-ray luminosity and extent. This sample is complemented by 27 nearby clusters with a robust, analogous determination of the total and stellar mass inside R {sub 500}. The total sample of 118 groups and clusters with zmore » <= 1 spans a range in M {sub 500} of {approx}10{sup 13}-10{sup 15} M {sub sun}. We find that the stellar mass fraction associated with galaxies at R {sub 500} decreases with increasing total mass as M {sup -0.37+}-{sup 0.04} {sub 500}, independent of redshift. Estimating the total gas mass fraction from a recently derived, high-quality scaling relation, the total baryon mass fraction (f {sup stars+gas} {sub 500} = f {sup stars} {sub 500} + f {sup gas} {sub 500}) is found to increase by {approx}25%, when M{sub 500} increases from (M) = 5 x 10{sup 13} M{sub sun} to (M) = 7 x 10{sup 14} M{sub sun}. After consideration of a plausible contribution due to intracluster light (11%-22% of the total stellar mass) and gas depletion through the hierarchical assembly process (10% of the gas mass), the estimated values of the total baryon mass fraction are still lower than the latest CMB measure of the same quantity (WMAP5), at a significance level of 3.3sigma for groups of (M) = 5 x 10{sup 13} M{sub sun}. The discrepancy decreases toward higher total masses, such that it is 1sigma at (M) = 7 x 10{sup 14} M{sub sun}. We discuss this result in terms of nongravitational processes such as feedback and filamentary heating.« less

  12. An AC-5 cathepsin B-like protease purified from Haemonchus contortus excretory secretory products shows protective antigen potential for lambs

    PubMed Central

    De Vries, Erik; Bakker, Nicole; Krijgsveld, Jeroen; Knox, Dave P.; Heck, Albert J.R.; Yatsuda, Ana Patricia

    2009-01-01

    The immunogenic properties of cysteine proteases obtained from excretory/secretory products (ES) of Haemonchus contortus were investigated with a fraction purified with a recombinant H. contortus cystatin affinity column. The enrichment of H. contortus ES for cysteine protease was confirmed with substrate SDS-PAGE gels since the cystatin-binding fraction activity was three times higher than total ES, despite representing only 3% of total ES. This activity was inhibited by a specific cysteine protease inhibitor (E64) and by recombinant cystatin. The one-dimensional profile of the cystatin-binding fraction displayed a single band with a molecular mass of 43 kDa. Mass spectrometry showed this to be AC-5, a cathepsin B-like cysteine protease which had not been identified in ES products of H. contortus before. The cystatin binding fraction was tested as an immunogen in lambs which were vaccinated three times (week 0, 2.5 and 5), challenged with 10 000 L3 H. contortus (week 6) before necropsy and compared to unvaccinated challenge controls and another group given total ES (n = 10 per group). The group vaccinated with cystatin-binding proteins showed 36% and 32% mean worm burden and eggs per gram of faeces (EPG) reductions, respectively, compared to the controls but total ES was almost without effect. After challenge the cystatin-binding proteins induced significantly higher local and systemic ES specific IgA and IgG responses. PMID:19401141

  13. Microphysical processing of aerosol particles in orographic clouds

    NASA Astrophysics Data System (ADS)

    Pousse-Nottelmann, S.; Zubler, E. M.; Lohmann, U.

    2015-08-01

    An explicit and detailed treatment of cloud-borne particles allowing for the consideration of aerosol cycling in clouds has been implemented into COSMO-Model, the regional weather forecast and climate model of the Consortium for Small-scale Modeling (COSMO). The effects of aerosol scavenging, cloud microphysical processing and regeneration upon cloud evaporation on the aerosol population and on subsequent cloud formation are investigated. For this, two-dimensional idealized simulations of moist flow over two bell-shaped mountains were carried out varying the treatment of aerosol scavenging and regeneration processes for a warm-phase and a mixed-phase orographic cloud. The results allowed us to identify different aerosol cycling mechanisms. In the simulated non-precipitating warm-phase cloud, aerosol mass is incorporated into cloud droplets by activation scavenging and released back to the atmosphere upon cloud droplet evaporation. In the mixed-phase cloud, a first cycle comprises cloud droplet activation and evaporation via the Wegener-Bergeron-Findeisen (WBF) process. A second cycle includes below-cloud scavenging by precipitating snow particles and snow sublimation and is connected to the first cycle via the riming process which transfers aerosol mass from cloud droplets to snowflakes. In the simulated mixed-phase cloud, only a negligible part of the total aerosol mass is incorporated into ice crystals. Sedimenting snowflakes reaching the surface remove aerosol mass from the atmosphere. The results show that aerosol processing and regeneration lead to a vertical redistribution of aerosol mass and number. Thereby, the processes impact the total aerosol number and mass and additionally alter the shape of the aerosol size distributions by enhancing the internally mixed/soluble Aitken and accumulation mode and generating coarse-mode particles. Concerning subsequent cloud formation at the second mountain, accounting for aerosol processing and regeneration increases the cloud droplet number concentration with possible implications for the ice crystal number concentration.

  14. An altered hormonal profile and elevated rate of bone loss are associated with low bone mass in professional horse-racing jockeys.

    PubMed

    Dolan, Eimear; McGoldrick, Adrian; Davenport, Colin; Kelleher, Grainne; Byrne, Brendan; Tormey, William; Smith, Diarmuid; Warrington, Giles D

    2012-09-01

    Horse-racing jockeys are a group of weight-restricted athletes, who have been suggested as undertaking rapid and extreme weight cycling practices in order to comply with stipulated body-mass standards. The aim of this study was to examine bone mass, turnover and endocrine function in jockeys and to compare this group with age, gender and body mass index matched controls. Twenty male professional jockeys and 20 healthy male controls participated. Dual energy X-ray absorptiometry scans and early morning fasting blood and urine samples were used to measure bone mass, turnover and a hormonal profile. Total body bone mineral density (BMD) was significantly lower in jockeys (1.143 ± 0.05 vs. 1.27 ± 0.06 g cm(-3), p < 0.01). Bone resorptive activity was elevated in the jockey group as indicated by significantly higher urinary NTx/creatinine (76.94 ± 29.52 vs. 55.9 ± 13.9 nmol mmol(-1), p < 0.01), resulting in a significantly negative uncoupling index between bone resorption and formation. Sex hormone binding globulin (SHBG) levels were significantly higher in jockeys (41.21 ± 9.77 vs. 28.24 ± 9.98 nmol L(-1), p < 0.01) with a lower percentage of bioavailable testosterone (48.89 ± 7.38 vs. 59.18 ± 6.74 %, p < 0.01). SHBG and insulin-like growth factor-1 were independent predictors of total body and femoral neck BMD, respectively (p < 0.05). In conclusion, it appears that professional jockeys have an elevated rate of bone loss and reduced bone mass that appears to be associated with disrupted hormonal activity. It is likely that this may have occurred in response to the chronic weight cycling habitually experienced by this group.

  15. Characteristics and source apportionment of black carbon aerosols over an urban site.

    PubMed

    Rajesh, T A; Ramachandran, S

    2017-03-01

    Aethalometer based source apportionment model using the measured aerosol absorption coefficients at different wavelengths is used to apportion the contribution of fossil fuel and wood burning sources to the total black carbon (BC) mass concentration. Temporal and seasonal variabilities in BC mass concentrations, equivalent BC from fossil fuel (BC f f ), and wood burning (BC w b ) are investigated over an urban location in western India during January 2014 to December 2015. BC, BC f f , and BC w b mass concentrations exhibit strong diurnal variation and are mainly influenced by atmospheric dynamics. BC f f was higher by a factor of 2-4 than BC w b and contributes maximum to BC mass throughout the day, confirming consistent anthropogenic activities. Diurnal contribution of BC f f and BC w b exhibits opposite variation due to differences in emission sources over Ahmedabad. Night time BC values are about a factor of 1.4 higher than day time BC values. The annual mean percentage contributions of day time and night time are 42 and 58 %, respectively. BC, BC f f , and BC w b mass concentrations exhibit large and significant variations during morning, afternoon, evening, and night time. During afternoon, mass concentration values are minimum throughout the year because of the fully evolved boundary layer and reduced anthropogenic activities. BC exhibits a strong seasonal variability with postmonsoon high (8.3 μg m -3 ) and monsoon low (1.9 μg m -3 ). Annual mean BC f f and BC w b contributions are 80 and 20 %, respectively, to total BC, which suggests that major contribution of BC in Ahmedabad comes from fossil fuel emissions. The results show that the study location is dominated by fossil fuel combustion as compared to the emissions from wood burning. The results obtained represent a regional value over an urban regime which can be used as inputs on source apportionment to model BC emissions in regional and global climate models.

  16. Influence of diet, exercise and serum vitamin D on sarcopenia in post-menopausal women

    PubMed Central

    Mason, Caitlin; Xiao, Liren; Imayama, Ikuyo; Duggan, Catherine R.; Foster-Schubert, Karen E.; Kong, Angela; Campbell, Kristin L.; Wang, Ching-Yun; Villasenor, Adriana; Neuhouser, Marian L.; Alfano, Catherine M.; Blackburn, George L.; McTiernan, Anne

    2012-01-01

    Purpose To investigate the effects of 12 months of dietary weight loss and/or aerobic exercise on lean mass and the measurements defining sarcopenia in postmenopausal women, and to examine the potential moderating effect of serum 25-hydroxyvitamin D (25(OH)D) and age. Methods 439 overweight and obese postmenopausal women were randomized to: diet modification (N=118); exercise (N=117), diet+exercise (N=117), or control (N=87). The diet intervention was a group-based program with a 10% weight loss goal. The exercise intervention was 45 mins/day, 5 days/week of moderate-to-vigorous intensity aerobic activity. Total and appendicular lean mass were quantified by dual Xray absorptiometry (DXA) at baseline and 12 months. A skeletal muscle index (SMI=appendicular lean mass (kg)/m2) and the prevalence of sarcopenia (SMI<5.67 kg/m2) were calculated. Serum 25(OH)D was assayed using a competitive chemiluminescent immunoassay. Results Dietary weight loss resulted in a significant decrease in lean mass, and a borderline significant decrease in appendicular lean mass and SMI compared to controls. In contrast, aerobic exercise significantly preserved appendicular lean mass and SMI. Diet + exercise attenuated the loss of appendicular lean mass and SMI compared to diet alone, and did not result in significant loss of total- or appendicular lean mass compared to controls. Neither serum 25(OH)D nor age were significant moderators of the intervention effects. Conclusions Aerobic exercise added to dietary weight loss can attenuate the loss of appendicular lean mass during weight loss, and may be effective for the prevention and treatment of sarcopenia among overweight and obese postmenopausal women. PMID:23190588

  17. Texture-modified diets are associated with decreased muscle mass in older adults admitted to a rehabilitation ward.

    PubMed

    Shimizu, Akio; Maeda, Keisuke; Tanaka, Kei; Ogawa, Mei; Kayashita, Jun

    2018-05-01

    Texture-modified diets (TMD) have significantly lower energy and protein content than normal diets. Therefore, TMD can cause malnutrition and loss of muscle mass. However, few studies have reported the relationship between TMD and decreased skeletal muscle mass. The aim of the present study was to clarify the association between TMD and decreased skeletal muscle mass. We reviewed data of 188 older adult patients who were admitted to a rehabilitation hospital. TMD were defined based on the Japanese Dysphagia Diet Criteria 2013 proposed by the Japanese Society of Dysphagia Rehabilitation. The Mini Nutritional Assessment-Short Form was used to assess nutritional status; dual-energy X-ray absorptiometry was used to measure the skeletal muscle mass index, and the cut-off values for decreased skeletal muscle mass index were based on the Asian Working Group for Sarcopenia; the Functional Independence Measure was used to evaluate activities of daily living. The patients' mean age was 80.6 ± 7.5 years, and 62% were women. A total of 22 patients (11.7%) consumed TMD. A total of 104 patients (55.3%) had decreased skeletal muscle mass, and approximately 90% of them consumed TMD. Decreased skeletal muscle mass index (odds ratio 7.199, 95% confidence interval 1.489-34.805, P ≤ 0.01) and Functional Independence Measure scores (odds ratio 0.972, 95% confidence interval 0.952-0.992, P ≤ 0.01) were independently related to TMD in the multivariate analysis. The TMD group was associated with decreased skeletal muscle mass. Future, prospective studies are necessary to investigate causality. Geriatr Gerontol Int 2018; 18: 698-704. © 2017 Japan Geriatrics Society.

  18. Characterization of Jamaican Delonix regia and Cassia fistula Seed Extracts

    PubMed Central

    Reid, Raymond; Rattray, Vaughn; Williams, Ruth; Denny, Marcel

    2016-01-01

    Delonix regia and Cassia fistula seed extracts were evaluated for their antioxidant activity, total phenolics, ash, zinc and fatty acid content. Fourier Transform Infrared Spectroscopy (FTIR) was utilized to assess the chemical functionalities present within the seeds. Antioxidant activity was determined by the 2,2-diphenyl-1-picrylhydrazyl (DPPH) and Trolox equivalent antioxidant capacity (TEAC) assays. Total phenolics were determined by the Folin-Ciocalteu assay. Lipid extracts were characterized by nuclear magnetic resonance spectroscopy and gas chromatography/mass spectrometry. Zinc concentration was determined by atomic absorption spectroscopy. Extracts from the seeds of C. fistula had a higher antioxidant activity, free radical scavenging activity, and phenolic content than D. regia. FTIR revealed that the seeds are a rich source of protein with small quantities of fat. C. fistula extracts contained a higher percentage of total fat than D. regia. Palmitic acid was identified as the predominant saturated fatty acid in both extracts. Oleic acid and linoleic acid were identified in smaller quantities. Seed extracts may be considered for use in food and nutraceutical applications. PMID:27034834

  19. Validation of a physical activity questionnaire to measure the effect of mechanical strain on bone mass.

    PubMed

    Kemper, Han C G; Bakker, I; Twisk, J W R; van Mechelen, W

    2002-05-01

    Most of the questionnaires available to estimate the daily physical activity levels of humans are based on measuring the intensity of these activities as multiples of resting metabolic rate (METs). Metabolic intensity of physical activities is the most important component for evaluating effects on cardiopulmonary fitness. However, animal studies have indicated that for effects on bone mass the intensity in terms of energy expenditure (metabolic component) of physical activities is less important than the intensity of mechanical strain in terms of the forces by the skeletal muscles and/or the ground reaction forces. The physical activity questionnaire (PAQ) used in the Amsterdam Growth and Health Longitudinal Study (AGAHLS) was applied to investigate the long-term effects of habitual physical activity patterns during youth on health and fitness in later adulthood. The PAQ estimates both the metabolic components of physical activities (METPA) and the mechanical components of physical activities (MECHPA). Longitudinal measurements of METPA and MECHPA were made in a young population of males and females ranging in age from 13 to 32 years. This enabled evaluation of the differential effects of physical activities during adolescence (13-16 years), young adulthood (21-28 years), and the total period of 15 years (age 13-28 years) on bone mineral density (BMD) of the lumbar spine, as measured by dual-energy X-ray absorptiometry (DXA) in males (n = 139) and females (n = 163) at a mean age of 32 years. The PAQ used in the AGAHLS during adolescence (13-16 years) and young adulthood (21-28 years) has the ability to measure the physical activity patterns of both genders, which are important for the development of bone mass at the adult age. MECHPA is more important than METPA. The highest coefficient of 0.33 (p < 0.01) was between MECHPA measured over the total period of 15 years (13-28 years) and lumbar BMD at age 32 years. Only during adolescence (12-16 years) was METPA more important with regard to lumbar BMD at age 32 years, with a beta of 0.21 (p < 0.01). The relative validity of the PAQ was established by comparing PAQ scores during four annual measurements in 200 boys and girls with two other objective measures of physical activity: movement counters (pedometers) and heart rate monitoring. These showed significant (p < 0.01) correlations in both genders, varying between 0.16 and 0.20. The small variation indicates, however, that all three instruments measure different aspects of physical activity. The results from the PAQ, with respect to MECHPA, validated in humans the results from animal studies in which bone adaptation during skeletal growth and development continuously adjust skeletal mass and architecture to changing mechanical stimuli caused by physical activity.

  20. 40 CFR 86.156-98 - Calculations; refueling test.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... standard shall be computed by dividing the total refueling mass emissions by the total gallons of fuel... of the net hydrocarbon mass change and methanol mass change (if applicable) in the enclosure is used to determine refueling mass emissions. The mass is calculated from initial and final hydrocarbon and...

  1. 40 CFR 86.156-98 - Calculations; refueling test.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... standard shall be computed by dividing the total refueling mass emissions by the total gallons of fuel... of the net hydrocarbon mass change and methanol mass change (if applicable) in the enclosure is used to determine refueling mass emissions. The mass is calculated from initial and final hydrocarbon and...

  2. 40 CFR 86.156-98 - Calculations; refueling test.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... standard shall be computed by dividing the total refueling mass emissions by the total gallons of fuel... of the net hydrocarbon mass change and methanol mass change (if applicable) in the enclosure is used to determine refueling mass emissions. The mass is calculated from initial and final hydrocarbon and...

  3. Development of Tissue to Total Mass Correction Factor for Porites divaricata in Calcification Rate Studies

    NASA Astrophysics Data System (ADS)

    Cannone, T. C.; Kelly, S. K.; Foster, K.

    2013-05-01

    One anticipated result of ocean acidification is lower calcification rates of corals. Many studies currently use the buoyant weights of coral nubbins as a means of estimating skeletal weight during non-destructive experiments. The objectives of this study, conducted at the Little Cayman Research Centre, were twofold: (1) to determine whether the purple and yellow color variations of Porites divaricata had similar tissue mass to total mass ratios; and (2) to determine a correction factor for tissue mass based on the total coral mass. T-test comparisons indicated that the tissue to total mass ratios were statistically similar for purple and yellow cohorts, thus allowing them to be grouped together within a given sample population. Linear regression analysis provided a correction factor (r2 = 0.69) to estimate the tissue mass from the total mass, which may eliminate the need to remove tissue during studies and allow subsequent testing on the same nubbins or their return to the natural environment. Additional work is needed in the development of a correction factor for P. divaricata with a higher prediction accuracy.

  4. Increase of Total Body Water with Decrease of Body Mass while Running 100 km Nonstop--Formation of Edema?

    ERIC Educational Resources Information Center

    Knechtle, Beat; Wirth, Andrea; Knechtle, Patrizia; Rosemann, Thomas

    2009-01-01

    We investigated whether ultraendurance runners in a 100-km run suffer a decrease of body mass and whether this loss consists of fat mass, skeletal muscle mass, or total body water. Male ultrarunners were measured pre- and postrace to determine body mass, fat mass, and skeletal muscle mass by using the anthropometric method. In addition,…

  5. In General, the Total Voltammetric Current from a Mixture of Redox-Active Substances will Not be the Sum of the Currents that Each Substance would Produce Independently at the Same Concentration as in the Mixture

    NASA Technical Reports Server (NTRS)

    Leventis, Nicholas; Oh, Woon Su; Gao, Xue-Rong; Rawashdeh, Abdel Monem M.

    2003-01-01

    At the potential range where both decamethylferrocene (dMeFc) and ferrocene (Fc) are oxidized with rates controlled by linear diffusion, electrogenerated Fc(+) radicals diffusing outwards from the electrode react quantitatively (K23 C=5.8 x 10(exp 8) with dMeFc diffusing towards the electrode and produce Fc and dMeFc. That reaction replaces dMeFc with Fc, whose diffusion coefficient is higher than that of dMeFc(+), and the total mass-transfer limited current from the mixture is increased by approximately 10%. Analogous observations are made when mass-transfer is controlled by convective-diffusion as in RDE voltammetry. Similar results have been obtained with another, and for all practical purposes randomly selected pair of redox-active substances, [Co(bipy)3](2+) and N - methylphenothiazine (MePTZ); reaction of MePTZ(+) with [Co(bipy)3](2+) replaces the latter with MePTZ, which diffuses faster and the current increases by approximately 20%. The experimental voltammograms have been simulated numerically and the role of (a) the rate constant of the homogeneous reaction; (b) the relative concentrations; and, (c) the diffusion coefficients of all species involved have been studied in detail. Importantly, it was also identified that within any given redox system the dependence of the mass-transfer limited current on the bulk concentrations of the redox-active species is expected to be non-linear. These findings are discussed in terms of their electroanalytical implications.

  6. In vitro antioxidant and hypoglycemic activities of Ethiopian spice blend Berbere.

    PubMed

    Loizzo, Monica R; Di Lecce, Giuseppe; Boselli, Emanuele; Bonesi, Marco; Menichini, Federica; Menichini, Francesco; Frega, Natale Giuseppe

    2011-11-01

    The metal chelating activity, antioxidant properties, and the effect on carbohydrate-hydrolyzing enzymes of Ethiopian spice blend Berbere have been investigated. Berbere contains a total amount of phenols corresponding to 71.3 mg chlorogenic acid equivalent per gram of extract and a total flavonoid content of 32.5 mg quercetin equivalent per gram of extract. An increase of the resistance towards forced oxidation was obtained when Berbere was added to sunflower oil. In order to evaluate the bioactivity of the non-polar constituents, an n-hexane extract was obtained from Berbere. The gas chromatography-mass spectrometry analysis revealed the presence of 19 fatty acids constituents (98.1% of the total oil content). Among them, linoleic acid was the major component (72.0% of the total lipids). The ethanolic extract had the highest ferric-reducing ability power (35.4 μM Fe(II)/g) and DPPH scavenging activity with a concentration giving 50% inhibition (IC(50)) value of 34.8 μg/ml. Moreover, this extract exhibited good hypoglycemic activity against α-amylase (IC(50) = 78.3 μg/ml). In conclusion, Ethiopian spice blend Berbere showed promising antioxidant and hypoglycemic activity via the inhibition of carbohydrate digestive enzymes. These activities may be of interest from functional point of view and for the revalorization of the spice blend in gastronomy also outside the African country.

  7. Chemical Composition and Bioactivities of Two Common Chaenomeles Fruits in China: Chaenomeles speciosa and Chaenomeles sinensis.

    PubMed

    Miao, Jing; Zhao, Chengcheng; Li, Xia; Chen, Xuetao; Mao, Xinhui; Huang, Hanhan; Wang, Tingting; Gao, Wenyuan

    2016-08-01

    Contents of total flavonoids, total phenolics, total triterpenes, total condensed tannin and total saponins in peels, flesh and endocarps of Chaenomeles speciosa (CSP) and Chaenomeles sinensis (CSS) were determined by colorimetric method, while 5 phenolics (vanillic, gallic, chlorogenic, ferulic and p-coumaric acids), 2 triterpenes (oleanolic and ursolic acids), and 3 flavonoids (rutin, catechin and epicatechin) were identified and quantified by high-performance liquid chromatography-mass spectrometry (HPLC-MS) and HPLC, and antioxidant and α-glucosidase inhibitory activities of them also were evaluated as well as their digestive characteristics. In the correlation analysis, total phenolics, vanillic acid, catechin, ursolic acid and oleanolic acid all contribute to DPPH(·) scavenge capacity, gallic acid contributes to total ferric reducing antioxidant power, while total triterpenes, total saponins, chlorogenic acid and ferullic acid contribute to α-glucosidase inhibitory activity. In the principal component analysis, endocarps of CSP and CSS both show better quality than their peels and flesh, respectively. In vitro digestion can increase contents of total flavonoids, total condensed tannin and total saponins, while contents of total phenolics and total triterpenes decreased greatly. Our study would contribute to the full use of discarded parts of the 2 Chaenomeles and be helpful to establish a good foundation for further research of CSP and CSS. © 2016 Institute of Food Technologists®

  8. Resting and field metabolic rates of adult male yellow-bellied marmots, Marmota flaviventris.

    PubMed

    Salsbury, C M; Armitage, K B

    1994-08-01

    Resting metabolic rate (RMR) and field metabolic rate (FMR) of wild-caught males were estimated from oxygen consumption and the doubly-labeled water method, respectively. The average FMR:RMR ratio of 6.9 was much greater than ratios reported for other mammals. Total FMR (kJ/day) increased and specific RMR (kJ/kg/day) decreased with time. Neither total RMR nor specific FMR were significantly related to time. The decrease in specific RMR may result from a circannual decrease in maintenance expenditure and a seasonal increase in body mass. Total FMR may increase through the season as conditions for male activity become more favorable.

  9. Correlates of physical fitness and activity in Taiwanese children.

    PubMed

    Chen, J-L; Unnithan, V; Kennedy, C; Yeh, C-H

    2008-03-01

    This cross-sectional study examined factors related to children's physical fitness and activity levels in Taiwan. A total of 331 Taiwanese children, aged 7 and 8, and their mothers participated in the study. Children performed physical fitness tests, recorded their physical activities during two weekdays and completed self-esteem questionnaires. Research assistants measured the children's body mass and stature. Mothers completed demographic, parenting style and physical activity questionnaires. Attending urban school, lower body mass index (BMI), older age and better muscular endurance contributed to the variance in better aerobic capacity, and attending rural school and better aerobic capacity contributed to the variance in better muscular endurance in boys. Attending urban school, lower BMI and better athletic competence contributed to the variance in better aerobic capacity, and younger age, rural school and higher household income contributed to the variance in better flexibility in girls. Despite the limitations of the study, with many countries and regions, including Taiwan, now emphasizing the importance of improving physical fitness and activity in children, an intervention that is gender-, geographically, and developmentally appropriate can improve the likelihood of successful physical fitness and activity programmes.

  10. Total and domain-specific sitting time among employees in desk-based work settings in Australia.

    PubMed

    Bennie, Jason A; Pedisic, Zeljko; Timperio, Anna; Crawford, David; Dunstan, David; Bauman, Adrian; van Uffelen, Jannique; Salmon, Jo

    2015-06-01

    To describe the total and domain-specific daily sitting time among a sample of Australian office-based employees. In April 2010, paper-based surveys were provided to desk-based employees (n=801) in Victoria, Australia. Total daily and domain-specific (work, leisure-time and transport-related) sitting time (minutes/day) were assessed by validated questionnaires. Differences in sitting time were examined across socio-demographic (age, sex, occupational status) and lifestyle characteristics (physical activity levels, body mass index [BMI]) using multiple linear regression analyses. The median (95% confidence interval [CI]) of total daily sitting time was 540 (531-557) minutes/day. Insufficiently active adults (median=578 minutes/day, [95%CI: 564-602]), younger adults aged 18-29 years (median=561 minutes/day, [95%CI: 540-577]) reported the highest total daily sitting times. Occupational sitting time accounted for almost 60% of total daily sitting time. In multivariate analyses, total daily sitting time was negatively associated with age (unstandardised regression coefficient [B]=-1.58, p<0.001) and overall physical activity (minutes/week) (B=-0.03, p<0.001) and positively associated with BMI (B=1.53, p=0.038). Desk-based employees reported that more than half of their total daily sitting time was accrued in the work setting. Given the high contribution of occupational sitting to total daily sitting time among desk-based employees, interventions should focus on the work setting. © 2014 Public Health Association of Australia.

  11. Whey protein, amino acids, and vitamin D supplementation with physical activity increases fat-free mass and strength, functionality, and quality of life and decreases inflammation in sarcopenic elderly.

    PubMed

    Rondanelli, Mariangela; Klersy, Catherine; Terracol, Gilles; Talluri, Jacopo; Maugeri, Roberto; Guido, Davide; Faliva, Milena A; Solerte, Bruno S; Fioravanti, Marisa; Lukaski, Henry; Perna, Simone

    2016-03-01

    Interventions to attenuate the adverse effects of age-related loss of skeletal muscle and function include increased physical activity and nutritional supplementation. This study tested the hypothesis that nutritional supplementation with whey protein (22 g), essential amino acids (10.9 g, including 4 g leucine), and vitamin D [2.5 μg (100 IU)] concurrent with regular, controlled physical activity would increase fat-free mass, strength, physical function, and quality of life, and reduce the risk of malnutrition in sarcopenic elderly persons. A total of 130 sarcopenic elderly people (53 men and 77 women; mean age: 80.3 y) participated in a 12-wk randomized, double-blind, placebo-controlled supplementation trial. All participants concurrently took part in a controlled physical activity program. We examined body composition with dual-energy X-ray absorptiometry, muscle strength with a handgrip dynamometer, and blood biochemical indexes of nutritional and health status, and evaluated global nutritional status, physical function, and quality of life before and after the 12 wk of intervention. Compared with physical activity and placebo, supplementation plus physical activity increased fat-free mass (1.7-kg gain, P < 0.001), relative skeletal muscle mass (P = 0.009), android distribution of fat (P = 0.021), handgrip strength (P = 0.001), standardized summary scores for physical components (P = 0.030), activities of daily living (P = 0.001), mini nutritional assessment (P = 0.003), and insulin-like growth factor I (P = 0.002), and lowered C-reactive protein (P = 0.038). Supplementation with whey protein, essential amino acids, and vitamin D, in conjunction with age-appropriate exercise, not only boosts fat-free mass and strength but also enhances other aspects that contribute to well-being in sarcopenic elderly. This trial was registered at clinicaltrials.gov as NCT02402608. © 2016 American Society for Nutrition.

  12. Risk in the mist? Deriving data to quantify microbial health risks associated with aerosol generation by water-efficient devices during typical domestic water-using activities.

    PubMed

    O'Toole, J; Keywood, M; Sinclair, M; Leder, K

    2009-01-01

    The aim of this study was to address existing data gaps and to determine the size distribution of aerosols associated with water-efficient devices during typical domestic activities. This information is important to assist in understanding infection spread during water-using activities and in designing water regulations. Three water-using scenarios were evaluated: i) showering using a water-efficient showerhead; ii) use of a high pressure spray unit for cleaning cars and iii) toilet flushing using a dual flush low volume flush device. For each scenario a control condition (conventional lower efficiency device) was selected for benchmarking purposes. Shower module results highlighted the complexity of particle generation and removal processes and showed that more than 90% of total particle mass in the breathing zone was attributed to particle diameters greater than 6 mum. Conversely, results for car washing experiments showed that particle diameters up to 6 mum constituted the major part of the total mass generated by both water-efficient and conventional devices. Even under worse case scenario conditions for toilet flushing, particle measurements were at or below the level of detection of the measuring instrumentation. The data provide information that assists in health risk assessment and in determining future research directions, including methodological aspects.

  13. Antibiofilm activity of cashew juice pulp against Staphylococcus aureus, high performance liquid chromatography/diode array detection and gas chromatography-mass spectrometry analyses, and interference on antimicrobial drugs.

    PubMed

    Dias-Souza, Marcus V; Dos Santos, Renan M; de Siqueira, Ezequias P; Ferreira-Marçal, Pedro H

    2017-07-01

    The epidemiology of Staphylococcus aureus infections has evolved in recent years, as this species is a major Gram-positive pathogen associated with healthcare services. The antimicrobial resistance of this species raises an urgent need for new treatment strategies. Fruits play important nutritional and economic roles in society, but their biological and pharmacological features are poorly explored when compared to nonedible parts of plants such as barks and leaves. In this study, we show that the cashew apple juice [cashew juice pulp (CJP)] extract is active against the planktonic cells of S. aureus strains, and for the first time, we show that CJP is also active against S. aureus biofilms. High performance liquid chromatography and gas chromatography-mass spectrometry analyses were conducted to prospect for polyphenols and free carbohydrates, respectively. Cashew apple juice, which is rich in nutrients, is widely consumed in Brazil; therefore, the quality attributes of CJPs were investigated. Samples were evaluated for pH, total titratable acidity, vitamin C levels, and total soluble solids. We also detected an antagonistic interference of CJP when it was combined with different antimicrobial drugs. Copyright © 2016. Published by Elsevier B.V.

  14. Phenolic profiles and antioxidant activity of Turkish Tombul hazelnut samples (natural, roasted, and roasted hazelnut skin).

    PubMed

    Pelvan, Ebru; Olgun, Elmas Öktem; Karadağ, Ayşe; Alasalvar, Cesarettin

    2018-04-01

    The phenolic profiles and antioxidant status of hazelnut samples [natural (raw) hazelnut, roasted hazelnut, and roasted hazelnut skin] were compared. Free and bound (ester-linked and glycoside-linked) phenolic acids were examined using liquid chromatography-tandem mass spectrometry (LC-MS/MS). Comprehensive identification of phenolics was carried out using Q-exactive hybrid quadrupole-orbitrap mass spectrometer (Q-OT-MS). Samples were also assessed for their total phenolics and antioxidant activities using three different assays. Ten free and bound phenolic acids were quantified in hazelnut samples. Roasted hazelnut skin contained the highest content of total phenolic acids, followed by natural and roasted hazelnuts. The majority of phenolic acids were present in the bound form. Using a Q-OT-MS, 22 compounds were tentatively identified, 16 of which were identified for the first time in hazelnut samples. The newly identified compounds consisted of flavonoids, phenolic acids and related compounds, hydrolysable tannins and related compounds, and other phenolics. Three antioxidant assays demonstrated similar trends that roasted hazelnut skin rendered the highest activity. The present work suggests that roasted hazelnut skin is a rich source of phenolics and can be considered as a value-added co-product for use as functional food ingredient and antioxidant. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Effects of activity, genetic selection and their interaction on muscle metabolic capacities and organ masses in mice.

    PubMed

    Kelly, Scott A; Gomes, Fernando R; Kolb, Erik M; Malisch, Jessica L; Garland, Theodore

    2017-03-15

    Chronic voluntary exercise elevates total daily energy expenditure and food consumption, potentially resulting in organ compensation supporting nutrient extraction/utilization. Additionally, species with naturally higher daily energy expenditure often have larger processing organs, which may represent genetic differences and/or phenotypic plasticity. We tested for possible adaptive changes in organ masses of four replicate lines of house mice selected (37 generations) for high running (HR) compared with four non-selected control (C) lines. Females were housed with or without wheel access for 13-14 weeks beginning at 53-60 days of age. In addition to organ compensation, chronic activity may also require an elevated aerobic capacity. Therefore, we also measured hematocrit and both citrate synthase activity and myoglobin concentration in heart and gastrocnemius. Both selection (HR versus C) and activity (wheels versus no wheels) significantly affected morphological and biochemical traits. For example, with body mass as a covariate, mice from HR lines had significantly higher hematocrit and larger ventricles, with more myoglobin. Wheel access lengthened the small intestine, increased relative ventricle and kidney size, and increased skeletal muscle citrate synthase activity and myoglobin concentration. As compared with C lines, HR mice had greater training effects for ventricle mass, hematocrit, large intestine length and gastrocnemius citrate synthase activity. For ventricle and gastrocnemius citrate synthase activity, the greater training was quantitatively explainable as a result of greater wheel running (i.e. 'more pain, more gain'). For hematocrit and large intestine length, differences were not related to amount of wheel running and instead indicate inherently greater adaptive plasticity in HR lines. © 2017. Published by The Company of Biologists Ltd.

  16. Influence of Climate, Variety and Production Process on Tocopherols, Plastochromanol-8 and Pigments in Flaxseed Oil

    PubMed Central

    Škevin, Dubravka; Kraljić, Klara; Pospišil, Milan; Neđeral, Sandra; Blekić, Monika

    2015-01-01

    Summary The objective of this study is to compare the influence of genotype, environmental conditions and processing methods after maturation and harvesting of four varieties of flaxseed (Altess, Biltstar, Niagara and Oliwin) on the levels of tocochromanols, carotenoids and chlorophyll in flaxseed oil. Samples were produced by cold pressing of dry seeds and seeds heated for 30 min at 60 °C. Temperature, sunshine and rainfall were primary environmental conditions included. Grand mean of mass fraction of γ-tocopherol was (522±29), of plastochromanol-8 (305±2) and total tocochromanols (831±3) mg per kg of oil. The highest levels of these compounds and strongest antioxidant activity were found in cold- -pressed oil of Biltstar variety. During seed maturation, levels of γ-tocopherol and plastochromanol-8 increased with average temperature and total sunshine and decreased with total rainfall. Fifth week after flowering was identified as the maturation period with best climate conditions to achieve optimal tocochromanol content. Grand mean of mass fraction of carotenoids expressed as β-carotene was (1.83±0.01) and of chlorophyll expressed as pheophytin a (0.43±0.10) mg per kg of oil. Altess variety had the highest levels of pigments. Antioxidant activity decreased with the increase of chlorophyll, while correlations with carotenoids were not determined. Generally, oil obtained by cold pressing had higher levels of tocochromanols and lower levels of pigments but similar antioxidant activity to the oil after seed conditioning. The results of this study contribute to identifying the flaxseed variety that is the best for oil production with the highest antioxidant activity and nutritive value, and provide better understanding of tocochromanol biosynthesis depending on different climate conditions. PMID:27904385

  17. Diet, physical activity, and sedentary behaviors as risk factors for overweight in adolescence.

    PubMed

    Patrick, Kevin; Norman, Gregory J; Calfas, Karen J; Sallis, James F; Zabinski, Marion F; Rupp, Joan; Cella, John

    2004-04-01

    The proportion of overweight adolescents has increased, but the behavioral risk factors for overweight youth are not well understood. To examine how diet, physical activity, and sedentary behaviors relate to overweight status in adolescents. Baseline data from the Patient-Centered Assessment and Counseling for Exercise Plus Nutrition Project, a randomized controlled trial of adolescents to determine the effects of a clinic-based intervention on physical activity and dietary behaviors. A total of 878 adolescents aged 11 to 15 years, 42% of whom were from minority backgrounds. Centers for Disease Control and Prevention body mass index-for-age percentiles divided into 2 categories: normal weight (<85th percentile) and at risk for overweight plus overweight (AR + O) (>or=85th percentile). Overall, 45.7% of the sample was classified as AR + O with a body mass index for age at the 85th percentile or higher. More girls from minority backgrounds (54.8%) were AR + O compared with non-Hispanic white girls (42%) (chi(2)(1) = 7.6; P =.006). Bivariate analyses indicated that girls and boys in the AR + O group did fewer minutes per day of vigorous physical activity, consumed fewer total kilojoules per day, and had fewer total grams of fiber per day than those in the normal-weight group. Boys in the AR + O group also did fewer minutes per day of moderate physical activity and watched more minutes per day of television on nonschool days than normal-weight boys. Final multivariate models indicated that independent of socioeconomic status (as assessed by household education level), girls had a greater risk of being AR + O if they were Hispanic or from another minority background (odds ratio [OR] = 1.65; 95% confidence interval [CI], 1.09-2.49) and a reduced risk of being AR + O as minutes per day of vigorous physical activity increased (OR = 0.93; 95% CI, 0.89-0.97). A low level of vigorous physical activity was the only significant risk factor for boys being AR + O (OR = 0.92; 95% CI, 0.89-0.95). Analyses based on meeting behavioral guidelines supported these findings and showed that failing to meet the 60 min/d moderate to vigorous physical activity guideline was associated with overweight status for both girls and boys. In addition, boys who failed to meet sedentary behavior and dietary fiber guidelines were more likely to be overweight. Of the 7 dietary and physical activity variables examined in this cross-sectional study, insufficient vigorous physical activity was the only risk factor for higher body mass index for adolescent boys and girls. Prospective studies are needed to clarify the relative importance of dietary and physical activity behaviors on overweight in adolescence.

  18. 40 CFR Table 5 to Subpart Xxxx of... - Requirements for Performance Tests

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ..., establish the total regeneration mass or volumetric flow, and establish the temperature of the carbon bed within 15 minutes of completing any cooling cycles. The total regeneration mass, volumetric flow, and... or less, regardless of the inlet concentration.(2). Collect carbon bed total regeneration mass or...

  19. 40 CFR Table 5 to Subpart Xxxx of... - Requirements for Performance Tests

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ..., establish the total regeneration mass or volumetric flow, and establish the temperature of the carbon bed within 15 minutes of completing any cooling cycles. The total regeneration mass, volumetric flow, and... or less, regardless of the inlet concentration.(2). Collect carbon bed total regeneration mass or...

  20. 40 CFR Table 5 to Subpart Xxxx of... - Requirements for Performance Tests

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ..., establish the total regeneration mass or volumetric flow, and establish the temperature of the carbon bed within 15 minutes of completing any cooling cycles. The total regeneration mass, volumetric flow, and... or less, regardless of the inlet concentration.(2). Collect carbon bed total regeneration mass or...

  1. 40 CFR Table 5 to Subpart Xxxx of... - Requirements for Performance Tests

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ..., establish the total regeneration mass or volumetric flow, and establish the temperature of the carbon bed within 15 minutes of completing any cooling cycles. The total regeneration mass, volumetric flow, and... or less, regardless of the inlet concentration.(2). Collect carbon bed total regeneration mass or...

  2. 40 CFR Table 5 to Subpart Xxxx of... - Requirements for Performance Tests

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ..., establish the total regeneration mass or volumetric flow, and establish the temperature of the carbon bed within 15 minutes of completing any cooling cycles. The total regeneration mass, volumetric flow, and... or less, regardless of the inlet concentration.(2). Collect carbon bed total regeneration mass or...

  3. Fipronil washoff to municipal wastewater from dogs treated with spot-on products.

    PubMed

    Teerlink, Jennifer; Hernandez, Jorge; Budd, Robert

    2017-12-01

    Fipronil and fipronil degradates have been reported in treated wastewater effluent at concentrations that exceed USEPA Aquatic Life Benchmarks, posing a potential risk to the surface waters to which they discharge. Fipronil is a common insecticide found in spot-on flea and tick treatment products that have the potential for down-the-drain transport and direct washoff into surface water. Volunteers currently treating their dogs with a fipronil-containing spot-on product were recruited. Dogs were washed either 2, 7, or 28days after product application, and rinsate from 34 discrete bathing events were analyzed by LC-MS/MS for fipronil and fipronil degradates (collectively known as fiproles). Total fipronil application dosage ranged from 67.1-410.0mg per dog following manufacturers' recommendation based on dog body weight. Total mass of fiproles measured in rinsate ranged from 3.6-230.6mg per dog (0.2 ̶ 86.0% of mass applied). Average percentage of fiproles detected in rinsate generally decreased with increasing time from initial application: 21±22, 16±13, and 4±5% respectively for 2, 7, and 28days post application. Fipronil was the dominant fiprole, >63% of total fiproles for all samples and >92% of total fiproles in 2 and 7day samples. Results confirm a direct pathway of pesticides to municipal wastewater through the use of spot-on products on dogs and subsequent bathing by either professional groomers or by pet owners in the home. Comparisons of mass loading calculated using California sales data and recent wastewater monitoring results suggest fipronil-containing spot-on products are a potentially important source of fipronil to wastewater treatment systems in California. This study highlights the potential for other active ingredients (i.e., bifenthrin, permethrin, etofenprox, imidacloprid) contained in spot-on and other pet products (i.e., shampoos, sprays) to enter wastewater catchments through bathing activities, posing a potential risk to the aquatic organisms downstream of wastewater discharge. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Chlorine partitioning in the lowermost Arctic vortex during the cold winter 2015/2016

    NASA Astrophysics Data System (ADS)

    Marsing, Andreas; Jurkat, Tina; Voigt, Christiane; Kaufmann, Stefan; Schlage, Romy; Engel, Andreas; Hoor, Peter; Krause, Jens

    2017-04-01

    Reactive chlorine compounds in the polar winter stratosphere are central to the formation of the Arctic ozone hole. To study the distribution and partitioning of active chlorine and reservoir species in the lower stratosphere, we performed in-situ measurements of HCl and ClONO2 with the mass spectrometer AIMS during the POLSTRACC aircraft campaign in the Arctic winter 2015/2016 between 320 K and 410 K. In addition to chlorine reservoir gases, in-situ measurements of chemically stable tracers provide means to identify vortex air masses and to infer total inorganic chlorine (Cly). The distribution of chlorine and the degree of activation during the winter, as well as the reformation of the reservoir species at the end of the polar winter vary with altitude and potential temperature. Using trajectory calculations, we demonstrate transport pathways that distribute high amounts of previously activated chlorine into the lowermost stratosphere. Here, active chlorine may have a large oxidation capacity with respect to climate relevant trace gases.

  5. Boundary-Layer-Ingesting Inlet Flow Control

    NASA Technical Reports Server (NTRS)

    Owens, Lewis R.; Allan, Brian G.; Gorton, Susan A.

    2006-01-01

    This paper gives an overview of a research study conducted in support of the small-scale demonstration of an active flow control system for a boundary-layer-ingesting (BLI) inlet. The effectiveness of active flow control in reducing engine inlet circumferential distortion was assessed using a 2.5% scale model of a 35% boundary-layer-ingesting flush-mounted, offset, diffusing inlet. This experiment was conducted in the NASA Langley 0.3-meter Transonic Cryogenic Tunnel at flight Mach numbers with a model inlet specifically designed for this type of testing. High mass flow actuators controlled the flow through distributed control jets providing the active flow control. A vortex generator point design configuration was also tested for comparison purposes and to provide a means to examine a hybrid vortex generator and control jets configuration. Measurements were made of the onset boundary layer, the duct surface static pressures, and the mass flow through the duct and the actuators. The distortion and pressure recovery were determined by 40 total pressure measurements on 8 rake arms each separated by 45 degrees and were located at the aerodynamic interface plane. The test matrix was limited to a maximum free-stream Mach number of 0.85 with scaled mass flows through the inlet for that condition. The data show that the flow control jets alone can reduce circumferential distortion (DPCP(sub avg)) from 0.055 to about 0.015 using about 2.5% of inlet mass flow. The vortex generators also reduced the circumferential distortion from 0.055 to 0.010 near the inlet mass flow design point. Lower inlet mass flow settings with the vortex generator configuration produced higher distortion levels that were reduced to acceptable levels using a hybrid vortex generator/control jets configuration that required less than 1% of the inlet mass flow.

  6. Boundary-Layer-Ingesting Inlet Flow Control

    NASA Technical Reports Server (NTRS)

    Owens, Lewis R.; Allan, Brian G.; Gorton, Susan A.

    2006-01-01

    This paper gives an overview of a research study conducted in support of the small-scale demonstration of an active flow control system for a boundary-layer-ingesting (BLI) inlet. The effectiveness of active flow control in reducing engine inlet circumferential distortion was assessed using a 2.5% scale model of a 35% boundary-layer-ingesting flush-mounted, offset, diffusing inlet. This experiment was conducted in the NASA Langley 0.3-meter Transonic Cryogenic Tunnel at flight Mach numbers with a model inlet specifically designed for this type of testing. High mass flow actuators controlled the flow through distributed control jets providing the active flow control. A vortex generator point design configuration was also tested for comparison purposes and to provide a means to examine a hybrid vortex generator and control jets configuration. Measurements were made of the onset boundary layer, the duct surface static pressures, and the mass flow through the duct and the actuators. The distortion and pressure recovery were determined by 40 total pressure measurements on 8 rake arms each separated by 45 degrees and were located at the aerodynamic interface plane. The test matrix was limited to a maximum free-stream Mach number of 0.85 with scaled mass flows through the inlet for that condition. The data show that the flow control jets alone can reduce circumferential distortion (DPCPavg) from 0.055 to about 0.015 using about 2.5% of inlet mass flow. The vortex generators also reduced the circumferential distortion from 0.055 to 0.010 near the inlet mass flow design point. Lower inlet mass flow settings with the vortex generator configuration produced higher distortion levels that were reduced to acceptable levels using a hybrid vortex generator/control jets configuration that required less than 1% of the inlet mass flow.

  7. Methotrexate Polyglutamate Monitoring in Patients With Crohn's Disease.

    PubMed

    Fischer, Monika; Siva, Shivi; Cook, Gwendolyn K; Jones, David R; Fadda, Hala M

    2017-05-01

    Methotrexate is an efficacious immunosuppressant for induction and maintenance of remission in Crohn's disease. The goal of this pilot study was to determine whether total or individual methotrexate glutamate levels (MTXGlu n ) in red blood cells correlate with disease activity and adverse events in Crohn's disease. A cross-sectional study was undertaken with 12 patients on a stable dose of 25 mg weekly methotrexate (oral or subcutaneous). Clinical disease activity was assessed by the Harvey-Bradshaw Index (HBI), and biologic disease activity was measured by inflammatory markers. Concentrations of individual MTXGlu n levels were measured in red blood cells (RBCs) using high-performance liquid chromatography-mass spectrometry. No association was observed between RBC individual (MTXGlu n ) or total methotrexate glutamate concentrations and clinical disease activity (HBI score) or inflammatory markers or adverse events. Although Crohn's disease patients in remission appeared to generally have higher RBC total longer-chain methotrexate polyglutamate (MTXGlu 3+4+5 ) concentrations compared with those with active disease, a definitive association between RBC MTXGlu 3+4+5 levels and clinical disease activity could not be established. Larger longitudinal studies in patients with diverse disease activity are needed to establish the value of MTXGlu n levels as indicators of treatment efficacy and clinical outcome. © 2016, The American College of Clinical Pharmacology.

  8. Effect of cultivar and variety on phenolic compounds and antioxidant activity of cherry wine.

    PubMed

    Xiao, Zuobing; Fang, Lingling; Niu, Yunwei; Yu, Haiyan

    2015-11-01

    To compare the influence of cultivar and variety on the phenolic compounds and antioxidant activity (AA) of cherry wines, total phenolic (TP), total flavonoid (TF), total anthocyanin (TA), total tannin (TT), five individual phenolic acids, and AA were determined. An ultra-performance liquid chromatography tandem mass spectrometry (HPLC-DAD/ESI-MS) method was developed for the determination of gallic acid (GAE), p-hydroxybenzoic acid (PHB), chlorogenic acid (CHL), vanillic acid (VAN), and caffeic acid (CAF). A principal component analysis (PCA) and a cluster analysis (CA) were used to analyze differences related to cultivar and variety. The TP, TF, TA, TT, and AA of samples sourced from the Shandong province of China were higher than those from the Jiangsu province. The PCA and CA results showed that phenolic compounds in cherry wines were closely related to cultivar and variety and that cultivar had more influence on the phenolic compounds of cherry wines than variety. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Physical activity, but not sedentary time, influences bone strength in late adolescence.

    PubMed

    Tan, Vina Ps; Macdonald, Heather M; Gabel, Leigh; McKay, Heather A

    2018-03-20

    Physical activity is essential for optimal bone strength accrual, but we know little about interactions between physical activity, sedentary time, and bone outcomes in older adolescents. Physical activity (by accelerometer and self-report) positively predicted bone strength and the distal and midshaft tibia in 15-year-old boys and girls. Lean body mass mediated the relationship between physical activity and bone strength in adolescents. To examine the influence of physical activity (PA) and sedentary time on bone strength, structure, and density in older adolescents. We used peripheral quantitative computed tomography to estimate bone strength at the distal tibia (8% site; bone strength index, BSI) and tibial midshaft (50% site; polar strength strain index, SSI p ) in adolescent boys (n = 86; 15.3 ± 0.4 years) and girls (n = 106; 15.3 ± 0.4 years). Using accelerometers (GT1M, Actigraph), we measured moderate-to-vigorous PA (MVPA Accel ), vigorous PA (VPA Accel ), and sedentary time in addition to self-reported MVPA (MVPA PAQ-A ) and impact PA (ImpactPA PAQ-A ). We examined relations between PA and sedentary time and bone outcomes, adjusting for ethnicity, maturity, tibial length, and total body lean mass. At the distal tibia, MVPA Accel and VPA Accel positively predicted BSI (explained 6-7% of the variance, p < 0.05). After adjusting for lean mass, only VPA Accel explained residual variance in BSI. At the tibial midshaft, MVPA Accel , but not VPA Accel , positively predicted SSI p (explained 3% of the variance, p = 0.01). Lean mass attenuated this association. MVPA PAQ-A and ImpactPA PAQ-A also positively predicted BSI and SSI p (explained 2-4% of the variance, p < 0.05), but only ImpactPA PAQ-A explained residual variance in BSI after accounting for lean mass. Sedentary time did not independently predict bone strength at either site. Greater tibial bone strength in active adolescents is mediated, in part, by lean mass. Despite spending most of their day in sedentary pursuits, adolescents' bone strength was not negatively influenced by sedentary time.

  10. Superasymmetric fission of heavy nuclei induced by intermediate-energy protons

    NASA Astrophysics Data System (ADS)

    Deppman, A.; Andrade-II, E.; Guimarães, V.; Karapetyan, G. S.; Tavares, O. A. P.; Balabekyan, A. R.; Demekhina, N. A.; Adam, J.; Garcia, F.; Katovsky, K.

    2013-12-01

    In this work we present the results for the investigation of intermediate-mass fragment (IMF) production with the proton-induced reaction at 660 MeV on 238U and 237Np target. The data were obtained with the LNR Phasotron U-400M Cyclotron at Joint Institute for Nuclear Research (JINR), Dubna, Russia. A total of 93 isotopes, in the mass range of 30

  11. Mediating effects of body composition between physical activity and body esteem in Hong Kong adolescents: a structural equation modeling approach.

    PubMed

    Mak, Kwok-Kei; Cerin, Ester; McManus, Alison M; Lai, Ching-Man; Day, Jeffrey R; Ho, Sai-Yin

    2016-01-01

    This study investigated the mediating role of body mass index (BMI) in the relationship between physical activity and body esteem in adolescents. Nine hundred and five Hong Kong Chinese students aged 12-18 years participated in a cross-sectional study in 2007. Students' BMI was computed as an indicator of their body composition. Their physical activity level and body esteem were examined using the Physical Activity Rating for Children and Youth (PARCY) and Body Esteem Scale (BES), respectively. Structural equation modelling was used to investigate the mediating effects of BMI and physical activity in predicting body esteem, with stratification by sex. The overall fit of the hypothesized models was satisfactory in boys (NFI = 0.94; NNFI = 0.88; CFI = 0.95; RMSEA = 0.07) and girls (NFI = 0.89; NNFI = 0.77; CFI = 0.91; RMSEA = 0.11). When BMI was considered as a mediator, higher physical activity had a significant negative total effect on body esteem in boys, but not in girls. The indirect effect of higher physical activity on body esteem via BMI was positive in boys, but negative in girls. Regular physical activity may help overweight adolescents, especially boys, improve their body esteem. Kinesiologists and health professionals could explore the use of physical activity prescriptions for weight management, aiming at body esteem improvement in community health programs for adolescents. Among Western adolescents, negative body esteem is more pervasive in girls than in boys. There are consistent findings of the association between higher body mass index and lower body esteem in adolescents, but the association between physical activity and body esteem are equivocal. A negative association between body mass index and body esteem was found in both Hong Kong adolescent boys and girls. The indirect effect of physical activity on body esteem via body mass index was positive in Hong Kong adolescent boys, but negative in girls.

  12. The longitudinal effects of physical activity and dietary calcium on bone mass accrual across stages of pubertal development.

    PubMed

    Lappe, Joan M; Watson, Patrice; Gilsanz, Vicente; Hangartner, Thomas; Kalkwarf, Heidi J; Oberfield, Sharon; Shepherd, John; Winer, Karen K; Zemel, Babette

    2015-01-01

    Childhood and adolescence are critical periods of bone mineral content (BMC) accrual that may have long-term consequences for osteoporosis in adulthood. Adequate dietary calcium intake and weight-bearing physical activity are important for maximizing BMC accrual. However, the relative effects of physical activity and dietary calcium on BMC accrual throughout the continuum of pubertal development in childhood remains unclear. The purpose of this study was to determine the effects of self-reported dietary calcium intake and weight-bearing physical activity on bone mass accrual across the five stages of pubertal development in a large, diverse cohort of US children and adolescents. The Bone Mineral Density in Childhood study was a mixed longitudinal study with 7393 observations on 1743 subjects. Annually, we measured BMC by dual-energy X-ray absorptiometry (DXA), physical activity and calcium intake by questionnaire, and pubertal development (Tanner stage) by examination for up to 7 years. Mixed-effects regression models were used to assess physical activity and calcium intake effects on BMC accrual at each Tanner stage. We found that self-reported weight-bearing physical activity contributed to significantly greater BMC accrual in both sexes and racial subgroups (black and nonblack). In nonblack males, the magnitude of the activity effect on total body BMC accrual varied among Tanner stages after adjustment for calcium intake; the greatest difference between high- and low-activity boys was in Tanner stage 3. Calcium intake had a significant effect on bone accrual only in nonblack girls. This effect was not significantly different among Tanner stages. Our findings do not support differential effects of physical activity or calcium intake on bone mass accrual according to maturational stage. The study demonstrated significant longitudinal effects of weight-bearing physical activity on bone mass accrual through all stages of pubertal development. © 2014 American Society for Bone and Mineral Research.

  13. Anthrobiogeochemical platinum, palladium and rhodium cycles of earth: Emerging environmental contamination

    NASA Astrophysics Data System (ADS)

    Mitra, Arijeet; Sen, Indra Sekhar

    2017-11-01

    Anthrobiogeochemical cycles have been a subject of scientific research for many decades as they are important for identifying possible sources, sinks, and pathways of an element in the environment. In this study, we quantified global cycles for the platinum group elements (PGE; platinum (Pt), palladium (Pd) and rhodium (Rh)). We quantified the stocks of Pt, Pd, and Rh in Earth's various reservoirs, such as the core, mantle, consolidated crust, biomass, seawater, unconsolidated sediments, and atmosphere, as well as coal and petroleum deposits. We further quantified their fluxes, both natural and anthropogenic, between each reservoir, by identifying the flows across the hydrosphere, geosphere, biosphere, atmosphere and anthroposphere, including from mining activities, fossil fuel and biomass burning, construction activities, soil erosion, human contributions to net primary productivity, riverine transport, aeolian dust movement, primary production, volcanic eruption, sea-salt spray, crustal subduction, crust formation at mid ocean ridges, PGE recovery from recycling processes, and cosmic dust inputs at the Earth's surface. Stocks of PGEs were quantified by multiplying the mass of the reservoir by the average Pt, Pd and Rh concentration in the reservoir, whereas Pt, Pd and Rh fluxes were calculated by multiplying the rate of mass movement across the reservoirs with the Pt, Pd and Rh concentrations of the material. Uncertainties were explicitly incorporated in stock and flow estimations through Monte Carlo simulations. Our calculations reveal that the total surficial anthropogenic Pt, Pd, and Rh mobilizations were greater than their corresponding natural surficial mobilizations. We show that crustal subduction and crustal formation is the most important natural flow and contributes 21-42% of total PGE mobilization. When Earth's surficial processes are considered, soil erosion is the dominant flow for Rh and Pt mobilization, comprising 33% and 13%, respectively, of the total mobilization on Earth's surface, whereas NPP dominates the natural Pd mobilization. On the other hand, mining activities, fossil fuel burning and automobile emissions are the most important anthropogenic flows. Therefore, our qualitative and quantitative assessment indicates that mining activities contribute almost 60-80% of the total anthropogenic flow on Earth, and crustal subduction and production dominates the total global PGE cycle.

  14. Exercise program affects body composition but not weight in postmenopausal women.

    PubMed

    Velthuis, Miranda J; Schuit, Albertine J; Peeters, Petra H M; Monninkhof, Evelyn M

    2009-01-01

    The aim of this study was to investigate the effect of a 12-month moderate-to-vigorous exercise program combining aerobic and muscle strength training on body composition among sedentary, postmenopausal women. A randomized controlled trial was conducted. A total of 189 sedentary postmenopausal women (age 50-69 y, body mass index 22-40 kg/m2) were randomly assigned to an exercise (n = 96) or a control group (n = 93). Study parameters measured at baseline, 4 months, and 12 months were as follows: body weight and body height (body mass index), waist and hip circumference (body fat distribution), and dual-energy x-ray absorptiometry (total body fat and lean mass). Differences in changes in study parameters between exercise and control group were examined with generalized estimating equations analysis. The exercise program did not result in significant effects on weight, body mass index, and hip circumference. The exercise group experienced a statistically significant greater loss in total body fat, both absolute (-0.33 kg) (borderline) as in a percentage (-0.43%) compared with the control group. In addition, lean mass increased significantly (+0.31 kg), whereas waist circumference (-0.57 cm) decreased significantly compared with the control group. We conclude that a 12-month exercise program combining aerobic and muscle strength training did not affect weight but positively influenced body composition of postmenopausal women. Affecting body fat distribution and waist circumference may have important health implications because it is an independent risk factor in obese but also in nonobese people. Therefore, this study gives further credence to efforts of public health and general practitioners aiming to increase physical activity levels of postmenopausal women.

  15. The rs3736228 polymorphism in the LRP5 gene is associated with calcaneal ultrasound parameter but not with body composition in a cohort of young Caucasian adults.

    PubMed

    Correa-Rodríguez, María; Schmidt-RioValle, Jacqueline; Rueda-Medina, Blanca

    2017-11-01

    The aim of the present study was to investigate the possible influence of low-density lipoprotein receptor-related protein 5 (LRP5) and sclerostin (SOST) genes as genetic factors contributing to calcaneal quantitative ultrasound (QUS) and body composition variables in a population of young Caucasian adults. The study population comprised a total of 575 individuals (mean age 20.41years; SD 2.36) whose bone mass was assessed through QUS to determine broadband ultrasound attenuation (BUA, dB/MHz). Body composition measurements were performed using a body composition analyser. Seven single-nucleotide polymorphisms (SNPs) of LRP5 (rs2306862, rs599083, rs556442 and rs3736228) and SOST (rs4792909, rs851054 and rs2023794) were selected as genetic markers and genotyped using TaqMan OpenArray ® technology. Linear regression analysis was used to test the possible association of the tested SNPs with QUS and body composition parameters. Linear regression analysis revealed that the rs3736228 SNP of LPR5 was significantly associated with BUA after adjustment for age, sex, weight, height, physical activity and calcium intake (P = 0.028, β (95% CI) = 0.089 (0.099-1.691). For the remaining SNPs, no significant association with the QUS measurement was observed. Regarding body composition, no significant association was found between LRP5 and SOST polymorphisms and body mass index, total fat mass and total lean mass after adjustment for age and sex as covariates. We concluded that the rs3736228 LRP5 genetic polymorphism influences calcaneal QUS parameter in a population of young Caucasian adults. This finding suggests that LRP5 might be an important genetic marker contributing to bone mass accrual early in life.

  16. Determination of the total drug-related chlorine and bromine contents in human blood plasma using high performance liquid chromatography-tandem ICP-mass spectrometry (HPLC-ICP-MS/MS).

    PubMed

    Klencsár, Balázs; Bolea-Fernandez, Eduardo; Flórez, María R; Balcaen, Lieve; Cuyckens, Filip; Lynen, Frederic; Vanhaecke, Frank

    2016-05-30

    A fast, accurate and precise method for the separation and determination of the total contents of drug-related Cl and Br in human blood plasma, based on high performance liquid chromatography - inductively coupled plasma - tandem mass spectrometry (HPLC-ICP-MS/MS), has been developed. The novel approach was proved to be a suitable alternative to the presently used standard methodology (i.e. based on a radiolabelled version of the drug molecule and radiodetection), while eliminating the disadvantages of the latter. Interference-free determination of (35)Cl has been accomplished via ICP-MS/MS using H2 as reaction gas and monitoring the (35)ClH2(+) reaction product at mass-to-charge ratio of 37. Br could be measured "on mass" at a mass-to-charge of 79. HPLC was relied on for the separation of the drug-related entities from the substantial amount of inorganic Cl. The method developed was found to be sufficiently precise (repeatability <10% RSD) and accurate (recovery between 95 and 105%) and shows a linear dynamic range (R(2)>0.990) from the limit of quantification (0.05 and 0.01 mg/L for Cl and Br in blood plasma, respectively) to at least 5 and 1mg/L for Cl and Br, respectively. Quantification via either external or internal standard calibration provides reliable results for both elements. As a proof-of-concept, human blood plasma samples from a clinical study involving a newly developed Cl- and Br-containing active pharmaceutical ingredient were analysed and the total drug exposure was successfully described. Cross-validation was achieved by comparing the results obtained on Cl- and on Br-basis. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. Exercise coupled with dietary restriction reduces oxidative stress in male adolescents with obesity.

    PubMed

    Li, Chunyan; Feng, Feihu; Xiong, Xiaoling; Li, Rui; Chen, Ning

    2017-04-01

    The increased oxidative stress is usually observed in obese population, but the control of body weight by calorie restriction and/or exercise training can ameliorate oxidative stress. In order to evaluate oxidative stress in response to exercise and dietary restriction in obese adolescents, a total of 20 obese volunteers were enrolled in a 4-week intervention program including exercise training and dietary restriction. Body compositions and blood samples were analysed before and after 4-week intervention, and biomarkers associated with oxidative stress were examined. After 4-week exercise training coupled with dietary restriction, physical composition parameters including body mass, body mass index (BMI), lean body mass, body fat mass and fat mass ratio had obvious reduction by 12.43%, 13.51%, 5.83%, 25.05% and 14.52%, respectively. In addition, the activities of antioxidant enzymes, such as superoxide dismutase (SOD) and glutathione peroxidase (GPx) revealed a remarkable enhancement. On the other hand, protein carbonyls (PC) exhibited an obvious reduction. Moreover, total thiols and nitrites with respect to baseline revealed a reducing trend although no significant difference was observed. Therefore, the 4-week exercise intervention coupled with dietary restriction is benefit for the loss of body weight and the mitigation of oxidative stress in obese population so that it can be a recommendable intervention prescription for the loss of body weight.

  18. MassiveNuS: cosmological massive neutrino simulations

    NASA Astrophysics Data System (ADS)

    Liu, Jia; Bird, Simeon; Zorrilla Matilla, José Manuel; Hill, J. Colin; Haiman, Zoltán; Madhavacheril, Mathew S.; Petri, Andrea; Spergel, David N.

    2018-03-01

    The non-zero mass of neutrinos suppresses the growth of cosmic structure on small scales. Since the level of suppression depends on the sum of the masses of the three active neutrino species, the evolution of large-scale structure is a promising tool to constrain the total mass of neutrinos and possibly shed light on the mass hierarchy. In this work, we investigate these effects via a large suite of N-body simulations that include massive neutrinos using an analytic linear-response approximation: the Cosmological Massive Neutrino Simulations (MassiveNuS). The simulations include the effects of radiation on the background expansion, as well as the clustering of neutrinos in response to the nonlinear dark matter evolution. We allow three cosmological parameters to vary: the neutrino mass sum Mν in the range of 0–0.6 eV, the total matter density Ωm, and the primordial power spectrum amplitude As. The rms density fluctuation in spheres of 8 comoving Mpc/h (σ8) is a derived parameter as a result. Our data products include N-body snapshots, halo catalogues, merger trees, ray-traced galaxy lensing convergence maps for four source redshift planes between zs=1–2.5, and ray-traced cosmic microwave background lensing convergence maps. We describe the simulation procedures and code validation in this paper. The data are publicly available at http://columbialensing.org.

  19. Beryllium-7 in vegetation, soil, sediment and runoff on the northern Loess Plateau.

    PubMed

    Zhang, Fengbao; Yang, Mingyi; Zhang, Jiaqiong

    2018-06-01

    Beryllium-7 ( 7 Be), as a potentially powerful tracer, was widely used to document soil redistribution and identify sediment sources in recent decades, but the quantity and distribution of 7 Be in vegetation, soil, sediment and runoff on the Loess Plateau have not been fully described. In this study, we measured 7 Be in vegetation, soil, sediment and runoff on the northern Loess Plateau of China and analyzed its variations during the rainy season to assess the potential of the 7 Be method for documenting soil redistribution and identifying sediment sources in a wide range of environments. The results indicated that vegetation, soil, and sediment samples showed higher levels and larger variations of 7 Be activities during the rainy season. The drying plants showed 7 Be mass activity that was more than three times higher than that of living and semi-decomposed plants. 7 Be mass activity in plants and sediment was much higher than in the soil. 7 Be activity in runoff water with a few submicron suspended particles varied slightly and was far lower than in plant, soil and sediment samples. The cumulative precipitation generally determined 7 Be inventory held by plants and soil. An inverse relationship was found between the 7 Be mass activity in sediment and the sediment amount. Globally, approximate 30% of the total 7 Be was held by plants in both the herbaceous and subshrub plots. Approximate 10% of the total 7 Be was lost with sediment from the bare plot. A very small proportion of 7 Be (1.18%-3.20%) was lost with runoff, and the vast majority of 7 Be was retained in the slope soil at the end of rainy season. Vegetation cover and soil erosion significantly affected the spatial distribution and variations of the 7 Be inventory in soil, providing a necessary condition for the development of a 7 Be method to document soil erosion on slopes with vegetation. Copyright © 2018 Elsevier B.V. All rights reserved.

  20. The Effects of Hypergravity and Adrenalectomy on Bone Mineral Content, Urine Calcium and Body Mass in Rats

    NASA Technical Reports Server (NTRS)

    Lau, A.; Ramirez, J.; Melson, E.; Moran, M.; Baer, L.; Arnaud, S.; Wade, C.; Girten, B.; Dalton, Bonnie (Technical Monitor)

    2001-01-01

    The effects of 14 days of increased gravitational load, and the absence of adrenal stress hormones on total body bone mineral content (BMC) were examined in male Sprague-Dawley rats. Centrifugation at 2 Gs (2G) was used to increase the gravitational load, and bilateral adrenalectomy (ADX) was used to eliminate the production of adrenal stress hormones. Stationary groups at 1 G (1G) and sham operated (SHAM) animals served as controls. Thirty rats (n=6 or 8) made up the four experimental groups (1G SHAM, 1G ADX, 2G SHAM and 2G ADX). BMC was assessed by dual energy x-ray absorptiometry (DXA) which was performed to determine the total body bone mineral content, and also through bone ashing of the left femur and the left humerus. Activity was determined through biotelemetry, also body mass and food intake were measured. Multi-factorial analysis of variance (MANCOVA) and Newman Keuls post hoc tests were used to analyze significant effects (p is less than 0.05) for the primary variables. Results from both DXA and the ashed femur indicated that BMC decreased significantly with increased G for both the SHAM and ADX groups. The BMC determined by DXA for the 1G ADX group was also significantly lower than the 1G SHAM group, however the 2G SHAM and 2G ADX groups were not significantly different. However, the bone ashing results showed the femur differed significantly only between the rates of centrifugation and not between the ADX and SHAM. The humerus showed no significant difference between any of the groups. There was a significant decrease in body mass with increased G and there was no ADX effect on body mass. When DXA BMC was normalized for body mass changes, there were no significant group differences. However, with bone ashing, the femur BMC/BW still showed significant difference between rates of centrifugation, with the 2G group being lower. Activity level decreased with body mass, and food intake data showed there was significant hypophagia during the first few days of centrifugation. Urine calcium was measured and was found decrease at the start of centrifugation for the 2G groups and rise to a level higher than that of the stationary groups. Finally, the correlation between BW and BMC was determined to be highly correlated (r = .71). These results suggest that the decrease in total body BMC seen with hypergravity may be based to a large extent on the differences in body mass induced by the 2G load.

  1. Body composition, nutritional status, and endothelial function in physically active men without metabolic syndrome--a 25 year cohort study.

    PubMed

    Pigłowska, Małgorzata; Kostka, Tomasz; Drygas, Wojciech; Jegier, Anna; Leszczyńska, Joanna; Bill-Bielecka, Mirosława; Kwaśniewska, Magdalena

    2016-04-27

    The purpose of this analysis was to investigate the relationship between body composition, metabolic parameters and endothelial function among physically active healthy middle-aged and older men. Out of 101 asymptomatic men prospectively tracked for traditional cardiovascular risk factors (mean observation period 25.1 years), 55 metabolically healthy individuals who maintained stable leisure time physical activity (LTPA) level throughout the observation and agreed to participate in the body composition assessment were recruited (mean age 60.3 ± 9.9 years). Body composition and raw bioelectrical parameters were measured with bioelectrical impedance analysis (BIA). Microvascular endothelial function was evaluated by means of the reactive hyperemia index (RHI) using Endo-PAT2000 system. Strong correlations were observed between lifetime physical activity (PA), aerobic fitness and most of analyzed body composition parameters. The strongest inverse correlation was found for fat mass (p < 0.01) while positive relationship for fat-free mass (p < 0.01), total body water (p < 0.05 for current aerobic capacity and p < 0.01 for historical PA), body cell mass (p < 0.001), muscle mass (p < 0.001), calcium and potassium (p < 0.01 and p < 0.001 for current aerobic capacity and p < 0.001 and p < 0.01 for historical PA, respectively) and glycogen mass (p < 0.001). Among metabolic parameters, HDL cholesterol (HDL-C) and uric acid were significantly associated with most body composition indicators. Regarding endothelial function, a negative correlation was found for RHI and body mass (p < 0.05) while positive relationship for RHI and body cell mass (p < 0.05), calcium (p < 0.05) and potassium mass (p < 0.05). Impaired endothelial function was observed among 8 subjects. Among bioelectrical parameters, impedance (Z) and resistance (R) normalized for subjects' height were negatively related with body mass, body mass index (BMI) and waist circumference (p < 0.001); while reactance (Xc) normalized for patients' height was negatively related with body mass (p < 0.05). The mean phase angle value was relatively high (8.83 ± 1.22) what reflects a good level of cellularity and cell function. Phase angle was positively related with body mass and BMI (p < 0.05). Both fat mass and muscle mass components are important predictors of metabolic profile. Maintaining regular high PA level and metabolically healthy status through young and middle adulthood may have beneficial influence on body composition parameters and may prevent age-related decrease of fat-free mass and endothelial dysfunction.

  2. Microplate-compatible total internal reflection fluorescence microscopy for receptor pharmacology

    NASA Astrophysics Data System (ADS)

    Chen, Minghan; Zaytseva, Natalya V.; Wu, Qi; Li, Min; Fang, Ye

    2013-05-01

    We report the use of total internal reflection fluorescence (TIRF) microscopy for analyzing receptor pharmacology and the development of a microplate-compatible TIRF imaging system. Using stably expressed green fluorescence protein tagged β2-adrenergic receptor as the reporter, we found that the activation of different receptors results in distinct kinetic signatures of the TIRF intensity of cells. These TIRF signatures closely resemble the characteristics of their respective label-free dynamic mass redistribution signals in the same cells. This suggests that TIRF in microplate can be used for profiling and screening drugs.

  3. Global Lightning Activity

    NASA Technical Reports Server (NTRS)

    Christian, Hugh

    2003-01-01

    Our knowledge of the global distribution of lightning has improved dramatically since the 1995 launch of the Optical Transient Detector (OTD) followed in 1997 by the launch of the Lightning Imaging Sensor (LIS). Together, these instruments have generated a continuous seven-year record of global lightning activity. These lightning observations have provided a new global perspective on total lightning activity. For the first time, total lightning activity (CG and IC) has been observed over large regions with high detection efficiencies and accurate geographic location. This has produced new insights into lightning distributions, times of occurrence and variability. It has produced a revised global flash rate estimate (46 flashes per second) and has lead to a new realization of the significance of total lightning activity in severe weather. Accurate flash rate estimates are now available for large areas of the earth (+/- 72deg latitude) Ocean-land contrasts as a function of season are clearly revealed, as are orographic effects and seasonal and interannual variability. The data set indicates that air mass thunderstorms, not large storm systems dominate global activity. The ability of LIS and OTD to detect total lightning has lead to improved insight into the correlation between lightning and storm development. The relationship between updraft development and lightning activity is now well established and presents an opportunity for providing a new mechanism for remotely monitoring storm development. In this concept, lightning would serve as a surrogate for updraft velocity. It is anticipated hat this capability could lead to significantly improved severe weather warning times and reduced false warning rates.

  4. Effect of starvation and exercise on actual and total activity of the branched-chain 2-oxo acid dehydrogenase complex in rat tissues.

    PubMed Central

    Wagenmakers, A J; Schepens, J T; Veerkamp, J H

    1984-01-01

    Starvation does not change the actual activity per g of tissue of the branched-chain 2-oxo acid dehydrogenase in skeletal muscles, but affects the total activity to a different extent, depending on the muscle type. The activity state (proportion of the enzyme present in the active state) does not change in diaphragm and decreases in quadriceps muscle. Liver and kidney show an increase of both activities, without a change of the activity state. In heart and brain no changes were observed. Related to organ wet weights, the actual activity present in the whole-body muscle mass decreases on starvation, whereas the activities present in liver and kidney do not change, or increase slightly. Exercise (treadmill-running) of untrained rats for 15 and 60 min causes a small increase of the actual activity and the activity state of the branched-chain 2-oxo acid dehydrogenase complex in heart and skeletal muscle. Exercise for 1 h, furthermore, increased the actual and the total activity in liver and kidney, without a change of the activity state. In brain no changes were observed. The actual activity per g of tissue in skeletal muscle was less than 2% of that in liver and kidney, both before and after exercise and starvation. Our data indicate that the degradation of branched-chain 2-oxo acids predominantly occurs in liver and to a smaller extent in kidney and skeletal muscle in fed, starved and exercised rats. PMID:6508743

  5. AN EVALUATION OF THE PROTEIN MASS OF PARTICULATE MATTER

    EPA Science Inventory

    A comparison of ambient particulate matter mass concentrations with the total protein mass concentration has not been performed previously for North Carolina and was the goal of this study. The analysis of total protein mass was used as an all inclusive indicator of biologically ...

  6. Vertebrate blood cell volume increases with temperature: implications for aerobic activity.

    PubMed

    Gillooly, James F; Zenil-Ferguson, Rosana

    2014-01-01

    Aerobic activity levels increase with body temperature across vertebrates. Differences in these levels, from highly active to sedentary, are reflected in their ecology and behavior. Yet, the changes in the cardiovascular system that allow for greater oxygen supply at higher temperatures, and thus greater aerobic activity, remain unclear. Here we show that the total volume of red blood cells in the body increases exponentially with temperature across vertebrates, after controlling for effects of body size and taxonomy. These changes are accompanied by increases in relative heart mass, an indicator of aerobic activity. The results point to one way vertebrates may increase oxygen supply to meet the demands of greater activity at higher temperatures.

  7. Predictors of Serum Dioxin, Furan and PCB Concentrations among Women from Chapaevsk, Russia

    PubMed Central

    Humblet, Olivier; Williams, Paige L.; Korrick, Susan A.; Sergeyev, Oleg; Emond, Claude; Birnbaum, Linda S.; Burns, Jane S.; Altshul, Larisa; Patterson, Donald G.; Turner, Wayman E.; Lee, Mary M.; Revich, Boris; Hauser, Russ

    2011-01-01

    INTRODUCTION Dioxins, furans and polychlorinated biphenyls (PCBs) are persistent and bioaccumulative toxic chemicals that are ubiquitous in the environment. We assessed predictors of their serum concentrations among women living in a Russian town contaminated by past industrial activity. METHODS Blood samples from 446 mothers aged 23–52 years were collected between 2003–2005 as part of the Russian Children’s Study. Serum dioxin, furan and PCB concentrations were quantified using high-resolution gas chromatography-mass spectrometry. Potential determinants of exposure were collected through interviews. Multivariate linear regression models were used to identify predictors of serum concentrations and toxic equivalencies (TEQs). RESULTS AND DISCUSSION The median total PCB concentrations and total TEQs were 260 ng/g lipid and 25 pg TEQ/g lipid, respectively. In multivariate analyses, both total PCB concentrations and total TEQs increased significantly with age, residential proximity to a local chemical plant, duration of local farming, and consumption of local beef. Both decreased with longer breastfeeding, recent increases in body mass index, and later blood draw date. These demographic and lifestyle predictors showed generally similar associations with the various measures of serum dioxins, furans, and PCBs. PMID:20578718

  8. Characterization of urban aerosol in Cork city (Ireland) using aerosol mass spectrometry

    NASA Astrophysics Data System (ADS)

    Dall'Osto, M.; Ovadnevaite, J.; Ceburnis, D.; Martin, D.; Healy, R. M.; O'Connor, I. P.; Kourtchev, I.; Sodeau, J. R.; Wenger, J. C.; O'Dowd, C.

    2013-05-01

    Ambient wintertime background urban aerosol in Cork city, Ireland, was characterized using aerosol mass spectrometry. During the three-week measurement study in 2009, 93% of the ca. 1 350 000 single particles characterized by an Aerosol Time-of-Flight Mass Spectrometer (TSI ATOFMS) were classified into five organic-rich particle types, internally mixed to different proportions with elemental carbon (EC), sulphate and nitrate, while the remaining 7% was predominantly inorganic in nature. Non-refractory PM1 aerosol was characterized using a High Resolution Time-of-Flight Aerosol Mass Spectrometer (Aerodyne HR-ToF-AMS) and was also found to comprise organic aerosol as the most abundant species (62%), followed by nitrate (15%), sulphate (9%) and ammonium (9%), and chloride (5%). Positive matrix factorization (PMF) was applied to the HR-ToF-AMS organic matrix, and a five-factor solution was found to describe the variance in the data well. Specifically, "hydrocarbon-like" organic aerosol (HOA) comprised 20% of the mass, "low-volatility" oxygenated organic aerosol (LV-OOA) comprised 18%, "biomass burning" organic aerosol (BBOA) comprised 23%, non-wood solid-fuel combustion "peat and coal" organic aerosol (PCOA) comprised 21%, and finally a species type characterized by primary {m/z} peaks at 41 and 55, similar to previously reported "cooking" organic aerosol (COA), but possessing different diurnal variations to what would be expected for cooking activities, contributed 18%. Correlations between the different particle types obtained by the two aerosol mass spectrometers are also discussed. Despite wood, coal and peat being minor fuel types used for domestic space heating in urban areas, their relatively low combustion efficiencies result in a significant contribution to PM1 aerosol mass (44% and 28% of the total organic aerosol mass and non-refractory total PM1, respectively).

  9. Tin particle size measurements in high explosively driven shockwave experiments using Mie scattering method

    NASA Astrophysics Data System (ADS)

    Monfared, Shabnam; Buttler, William; Schauer, Martin; Lalone, Brandon; Pack, Cora; Stevens, Gerald; Stone, Joseph; Special Technologies Laboratory Collaboration; Los Alamos National Laboratory Team

    2014-03-01

    Los Alamos National Laboratory is actively engaged in the study of material failure physics to support the hydrodynamic models development, where an important failure mechanism of explosively shocked metals causes mass ejection from the backside of a shocked surface with surface perturbations. Ejecta models are in development for this situation. Our past work has clearly shown that the total ejected mass and mass-velocity distribution sensitively link to the wavelength and amplitude of these perturbations. While we have had success developing ejecta mass and mass-velocity models, we need to better understand the size and size-velocity distributions of the ejected mass. To support size measurements we have developed a dynamic Mie scattering diagnostic based on a CW laser that permits measurement of the forward attenuation cross-section combined with a dynamic mass-density and mass-velocity distribution, as well as a measurement of the forward scattering cross-section at 12 angles (5- 32.5 degrees) in increments of 2.5 degrees. We compare size distribution followed from Beers law with attenuation cross-section and mass measurement to the dynamic size distribution determined from scattering cross-section alone. We report results from our first quality experiments.

  10. POX 52: A Dwarf Seyfert 1 Galaxy with an Intermediate-Mass Black Hole

    NASA Astrophysics Data System (ADS)

    Barth, Aaron J.; Ho, Luis C.; Rutledge, Robert E.; Sargent, Wallace L. W.

    2004-05-01

    We describe new optical images and spectra of POX 52, a dwarf galaxy with an active nucleus that was originally detected in the POX objective-prism survey. While POX 52 was originally thought to be a Seyfert 2 galaxy, the new data reveal an emission-line spectrum very similar to that of the dwarf Seyfert 1 galaxy NGC 4395, with broad components to the permitted line profiles, and we classify POX 52 as a Seyfert 1 galaxy. The host galaxy appears to be a dwarf elliptical, and its brightness profile is best fit by a Sérsic model with an index of 3.6+/-0.2 and a total magnitude of MV=-17.6. Applying mass-luminosity-line width scaling relations to estimate the black hole mass from the broad Hβ line width and nonstellar continuum luminosity, we find MBH~1.6×105Msolar. The stellar velocity dispersion in the host galaxy, measured from the Ca II λ8498, 8542 lines, is 36+/-5 km s-1, also suggestive of a black hole mass of order 105Msolar. Further searches for active nuclei in dwarf galaxies can provide unique constraints on the demographics of black holes in the mass range below 106Msolar.

  11. Changes in Metabolic Hormones in Malaysian Young Adults following Helicobacter pylori Eradication

    PubMed Central

    Yap, Theresa Wan-Chen; Leow, Alex Hwong-Ruey; Azmi, Ahmad Najib; Francois, Fritz; Perez-Perez, Guillermo I; Blaser, Martin J.; Poh, Bee-Hoon; Loke, Mun-Fai; Goh, Khean-Lee; Vadivelu, Jamuna

    2015-01-01

    Background More than half of the world’s adults carry Helicobacter pylori. The eradication of H. pylori may affect the regulation of human metabolic hormones. The aim of this study was to evaluate the effect of H. pylori eradication on meal-associated changes in appetite-controlled insulinotropic and digestive hormones, and to assess post-eradication changes in body mass index as part of a currently on-going multicentre ESSAY (Eradication Study in Stable Adults/Youths) study. Methods We enrolled 29 H. pylori-positive young adult (18–30 year-old) volunteer subjects to evaluate the effect of H. pylori eradication on meal-associated changes on eight gastrointestinal hormones, using a multiplex bead assay. Changes in body mass index and anthropometric measurements were recorded, pre- and post-eradication therapy. Results Pre-prandial active amylin, total peptide YY (PYY) and pancreatic polypeptide (PP) levels were significantly elevated 12 months post-eradication compared with baseline (n = 18; Wilcoxon's signed rank test, p<0.05). Four of the post-prandial gut metabolic hormones levels (GLP-1, total PYY, active amylin, PP) were significantly higher 12 months post-eradication compared to baseline (n = 18; p<0.05). Following H. pylori eradication, the BMI and anthropometric values did not significantly change. Conclusions Our study indicates that H. pylori eradication was associated with long-term disturbance in three hormones (active amylin, PP and total PYY) both pre- and post-prandially and one hormone (GLP-1) post-prandially. Longer post-eradication monitoring is needed to investigate the long-term impact of the observed hormonal changes on metabolic homeostasis. PMID:26291794

  12. Impact of Breakfast Skipping and Breakfast Choice on the Nutrient Intake and Body Mass Index of Australian Children

    PubMed Central

    Fayet-Moore, Flavia; Kim, Jean; Sritharan, Nilani; Petocz, Peter

    2016-01-01

    Recent data on breakfast consumption among Australian children are limited. This study examined the impact of breakfast skipping and breakfast type (cereal or non-cereal) on nutrient intakes, likelihood of meeting nutrient targets and anthropometric measures. A secondary analysis of two 24-h recall data from the 2007 Australian National Children’s Nutrition and Physical Activity Survey was conducted (2–16 years; n = 4487) to identify (a) breakfast skippers and (b) breakfast consumers, with breakfast consumers further sub-divided into (i) non-cereal and (ii) cereal consumers. Only 4% skipped breakfast and 59% of skippers were 14–16 years. Breakfast consumers had significantly higher intakes of calcium and folate, and significantly lower intakes of total fat than breakfast skippers. Cereal consumers were more likely to meet targets and consume significantly higher fibre, calcium, iron, had significantly higher intakes of folate, total sugars and carbohydrate, and significantly lower intakes of total fat and sodium than non-cereal consumers. The prevalence of overweight was lower among breakfast consumers compared to skippers, and among cereal consumers compared to-cereal consumers (p < 0.001), while no significant differences were observed for mean body mass index (BMI), BMI z-score, waist circumference and physical activity level across the categories. Breakfast and particularly breakfast cereal consumption contributes important nutrients to children’s diets. PMID:27517957

  13. Effect of immobile isolated enzymes from rumen liquid by using alginate matrices on the bay leaf extraction

    NASA Astrophysics Data System (ADS)

    Paramita, Vita; Yulianto, Mohammad Endy; Yohana, Eflita; Arifan, Fahmi; Hanifah, Amjad, Muhammad Taqiyuddin

    2015-12-01

    This research aims to develop the enzymatically of bay leaves phytochemical extraction process. The novelty and the main innovations of this research is the development of extraction process by using enzymatic extractor and isolate the enzymes from rumen liquid to shift the equilibrium phase, increase the extraction rate and increase the extraction yield. The activity of rumen liquid enzyme was represented by the activity of cellulase and protease. The analyze of total flavonoid content was performed by using UV-Vis Spectrofometry. The activity of immobilized enzyme of cellulase (0.08±0.00 U/ml) was lower than the un-immobilized one (0.23±0.00 U/ml). However, there was no difference activity of the immobilized (0.75±0.00 U/ml) and un-immobilized (0.76±0.01 U/ml) of protease. The model of mass transfer of un-immobilized enzyme can be fitted on the experimental data, however the model of mass transfer of immobilized enzyme did not match with the experimental data. The mass transfer coefficient of enzymatic extraction flavonoids bay leaf without immobilization was 0.17167 s-1 which greater than the reported value of obtained KLa from extraction by using electric heating.

  14. Short-term fasting induces intra-hepatic lipid accumulation and decreases intestinal mass without reduced brush-border enzyme activity in mink (Mustela vison) small intestine.

    PubMed

    Bjornvad, C R; Elnif, J; Sangild, P T

    2004-11-01

    For many mammalian species short-term fasting is associated with intestinal atrophy and decreased digestive capacity. Under natural conditions, strictly carnivorous animals often experience prey scarcity during winter, and they may therefore be particularly well adapted to short-term food deprivation. To examine how the carnivorous gastrointestinal tract is affected by fasting, small-intestinal structure, brush-border enzyme activities and hepatic structure and function were examined in fed mink (controls) and mink that had been fasted for 1-10 days. During the first 1-2 days of fasting, intestinal mass decreased more rapidly than total body mass and villus heights were reduced 25-40%. In contrast, tissue-specific activity of the brush-border enzymes sucrase, maltase, lactase, aminopeptidase A and dipeptidylpeptidase IV increased 0.5- to 1.5-fold at this time, but returned to prefasting levels after 6 days of fasting. After 6-10 days of fasting there was a marked increase in the activity of hepatic enzymes and accumulation of intra-hepatic lipid vacuoles. Thus, mink may be a useful model for studying fasting-induced intestinal atrophy and adaptation as well as mechanisms involved in accumulation of intra-hepatic lipids following food deprivation in strictly carnivorous domestic mammals, such as cats and ferrets.

  15. Clinical and hematological response to hydroxyurea in a patient with Hb Lepore/beta-thalassemia.

    PubMed

    Rigano, P; Manfré, L; La Galla, R; Renda, D; Renda, M C; Calabrese, A; Calzolari, R; Maggio, A

    1997-05-01

    The possibility of increasing Hb F in vivo using drugs like 5-azacytidine, hydroxyurea, and butyrate has been established. However, in many cases this does not entail an increase in total hemoglobin. We report on a patient with Hb Lepore/beta-thalassemia being treated with hydroxyurea (30 mg/Kg/day) because of the presence of erythroid extramedullary masses with severe neurological abnormalities. During therapy the patient showed a remarkable improvement in neurological signs due to the reduction in extra-medullary masses, a significant increase in both total hemoglobin (from 5.8 to 9.7 g/dl) and Hb F (from 4.9 g/dl to 9.1 g/dl). The marked improvement in hemoglobin level in our patient with Hb Lepore/beta-thalassemia suggests gamma-globin gene activation due to the DNA structure determined by the crossover event.

  16. Energy Expenditure and Aging

    PubMed Central

    Manini, Todd M.

    2009-01-01

    The study of energy expenditure (EE) has deep roots in understanding aging and lifespan in all species. In humans, total EE decreases substantially in advanced age resulting from parallel changes in resting metabolic rate (RMR) and activity EE. For RMR, this reduction appears to be due to a reduction in organ mass and specific metabolic rates of individual tissues. However, these anatomical changes explain very little regarding the decline in activity EE, which is governed by both genetic and environmental sources. The biological control centers for activity EE are closely coupled with body mass fluctuations and seem to originate in the brain. Several candidate neuromodulators may be involved in the age-related reduction of activity EE that include: orexin, agouti-related proteins and dopaminergic pathways. Unfortunately, the existing body of research has primarily focused on how neuromodulators influence weight gain and only a few studies have been performed in aging models. Recent evidence suggests that activity EE has an important role in dictating lifespan and thus places emphasis on future research to uncover the underlying biological mechanisms. The study of EE continues to unlock clues to aging. PMID:19698803

  17. Physical Activity and Modernization among Bolivian Amerindians

    PubMed Central

    Gurven, Michael; Jaeggi, Adrian V.; Kaplan, Hillard; Cummings, Daniel

    2013-01-01

    Background Physical inactivity is a growing public health problem, and the fourth leading risk factor for global mortality. Conversely, indigenous populations living traditional lifestyles reportedly engage in vigorous daily activity that is protective against non-communicable diseases. Here we analyze physical activity patterns among the Tsimane, forager-horticulturalists of Amazonian Bolivia with minimal heart disease and diabetes. We assess age patterns of adult activity among men and women, test whether modernization affects activity levels, and examine whether nascent obesity is associated with reduced activity. Methods and Findings A factorial method based on a large sample of behavioral observations was employed to estimate effects of age, sex, body mass index, and modernization variables on physical activity ratio (PAR), the ratio of total energy expenditure to basal metabolic rate. Accelerometry combined with heart rate monitoring was compared to the factorial method and used for nighttime sampling. Tsimane men and women display 24 hr physical activity level (PAL) of 2.02–2.15 and 1.73–1.85, respectively. Little time was spent “sedentary”, whereas most activity was light to moderate, rather than vigorous. Activity peaks by the late twenties in men, and declines thereafter, but remains constant among women after the early teens. Neither BMI, fat free mass or body fat percentage are associated with PAR. There was no negative effect of modernization on physical activity. Conclusions Tsimane display relatively high PALs typical of other subsistence populations, but of moderate intensity, and not outside the range of developed populations. Despite rapidly increasing socioeconomic change, there is little evidence that total activity has yet been affected. Overweight and obesity are more prevalent among women than men, and Spanish fluency is associated with greater obesity in women. The lack of cardiovascular disease among Tsimane is unlikely caused by activity alone; further study of diet, food intake and infectious disease is needed. PMID:23383262

  18. Development of a high-throughput screening assay for stearoyl-CoA desaturase using rat liver microsomes, deuterium labeled stearoyl-CoA and mass spectrometry.

    PubMed

    Soulard, Patricia; McLaughlin, Meg; Stevens, Jessica; Connolly, Brendan; Coli, Rocco; Wang, Leyu; Moore, Jennifer; Kuo, Ming-Shang T; LaMarr, William A; Ozbal, Can C; Bhat, B Ganesh

    2008-10-03

    Several recent reports suggest that stearoyl-CoA desaturase 1 (SCD1), the rate-limiting enzyme in monounsaturated fatty acid synthesis, plays an important role in regulating lipid homeostasis and lipid oxidation in metabolically active tissues. As several manifestations of type 2 diabetes and related metabolic disorders are associated with alterations in intracellular lipid partitioning, pharmacological manipulation of SCD1 activity might be of benefit in the treatment of these disease states. In an effort to identify small molecule inhibitors of SCD1, we have developed a mass spectrometry based high-throughput screening (HTS) assay using deuterium labeled stearoyl-CoA substrate and induced rat liver microsomes. The methodology developed allows the use of a nonradioactive substrate which avoids interference by the endogenous SCD1 substrate and/or product that exist in the non-purified enzyme source. Throughput of the assay was up to twenty 384-well assay plates per day. The assay was linear with protein concentration and time, and was saturable for stearoyl-CoA substrate (K(m)=10.5 microM). The assay was highly reproducible with an average Z' value=0.6. Conjugated linoleic acid and sterculic acid, known inhibitors of SCD1, exhibited IC(50) values of 0.88 and 0.12 microM, respectively. High-throughput mass spectrometry screening of over 1.7 million compounds in compressed format demonstrated that the enzyme target is druggable. A total of 2515 hits were identified (0.1% hit rate), and 346 were confirmed active (>40% inhibition of total SCD activity at 20 microM--14% conformation rate). Of the confirmed hits 172 had IC(50) values of <10 microM, including 111 <1 microM and 48 <100 nM. A large number of potent drug-like (MW<450) hits representing six different chemical series were identified. The application of mass spectrometry to high-throughput screening permitted the development of a high-quality screening protocol for an otherwise intractable target, SCD1. Further medicinal chemistry and characterization of SCD inhibitors should lead to the development of reagents to treat metabolic disorders.

  19. Effect of Elliptical High Intensity Interval Training on Metabolic Risk Factor in Pre- and Type 2 Diabetes Patients: A Pilot Study.

    PubMed

    Fex, Annie; Leduc-Gaudet, Jean-Philippe; Filion, Marie-Eve; Karelis, Antony D; Aubertin-Leheudre, Mylène

    2015-07-01

    The purpose of the current study was to examine the impact of 12 weeks of elliptical high intensity interval training (HIIT) on metabolic risk factors and body composition in pre- and type 2 diabetes patients. Sixteen pre- (n = 8) and type 2 diabetes (n = 8) participants completed this study. Fasting blood glucose, HbA1c, anthropometric measurements, body composition (DXA), blood pressure, resting heart rate, VO2max, and dietary factors, as well as total and physical activity energy expenditure, were measured. The HIIT program on the elliptical was performed 3 times a week for 12 weeks. After the intervention, we observed a significant improvement for fasting blood glucose, waist and hip circumference, appendicular fat mass, leg lean body mass and appendicular lean body mass, systolic blood pressure, resting heart rate, and VO2max (P < .05). In addition, we noted a lower tendency for leg fat mass (P = .06) and diastolic blood pressure (P = .05) as well as a higher tendency for total energy expenditure (P = .06) after the intervention. The current study indicates that elliptical HIIT seems to improve metabolic risk factors and body composition in pre- and type 2 diabetes patients.

  20. Impact of Altitudes and Habitats on Valerenic Acid, Total Phenolics, Flavonoids, Tannins, and Antioxidant Activity of Valeriana jatamansi.

    PubMed

    Jugran, Arun K; Bahukhandi, Amit; Dhyani, Praveen; Bhatt, Indra D; Rawal, Ranbeer S; Nandi, Shyamal K

    2016-07-01

    The changes in total phenolics, flavonoids, tannins, valerenic acid, and antioxidant activity were assessed in 25 populations of Valeriana jatamansi sampled from 1200 to 2775 m asl and four habitat types of Uttarakhand, West Himalaya. Significant (p < 0.05) variations in total phenolics, flavonoids, valerenic acid, and antioxidant activity in aerial and root portions and across the populations were observed. Antioxidant activity measured by three in vitro antioxidant assays, i.e., 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic) (ABTS) radical scavenging, 2,2'-diphenyl-1-picryylhydrazyl (DPPH) free radical scavenging, and ferric-reducing antioxidant power (FRAP) assays, showed significant (p < 0.05) differences across the populations. However, no clear pattern was found in phytochemicals across the altitudinal range. Among habitat types, (pine, oak, mixed forest, and grassy land), variation in phytochemical content and antioxidant activity were observed. Equal class ranking, neighbor-joining cluster analysis, and principal component analysis (PCA) identified Talwari, Jaberkhet, Manjkhali, and Khirshu populations as promising sources with higher phytochemicals and antioxidant activity. The results recommended that the identified populations with higher value of phytochemicals and antioxidants can be utilized for mass multiplication and breeding program to meet the domestic as well as commercial demand.

  1. Disentangling the body weight-bone mineral density association among breast cancer survivors: an examination of the independent roles of lean mass and fat mass

    PubMed Central

    2013-01-01

    Background Bone mineral density (BMD) and lean mass (LM) may both decrease in breast cancer survivors, thereby increasing risk of falls and fractures. Research is needed to determine whether lean mass (LM) and fat mass (FM) independently relate to BMD in this patient group. Methods The Health, Eating, Activity, and Lifestyle Study participants included 599 women, ages 29–87 years, diagnosed from 1995–1999 with stage 0-IIIA breast cancer, who underwent dual-energy X-ray absorptiometry scans approximately 6-months postdiagnosis. We calculated adjusted geometric means of total body BMD within quartiles (Q) of LM and FM. We also stratified LM-BMD associations by a fat mass index threshold that tracks with obesity (lower body fat: ≤12.9 kg/m2; higher body fat: >12.9 kg/m2) and stratified FM-BMD associations by appendicular lean mass index level corresponding with sarcopenia (non-sarcopenic: ≥ 5.45 kg/m2 and sarcopenic: < 5.45 kg/m2). Results Higher LM (Q4 vs. Q1) was associated with higher total body BMD overall (1.12 g/cm2 vs. 1.07 g/cm2, p-trend < 0.0001), and among survivors with lower body fat (1.13 g/cm2 vs. 1.07 g/cm2, p-trend < 0.0001) and higher body fat (1.15 g/cm2 vs. 1.08 g/cm2, p-trend = 0.004). Higher FM (Q4 vs. Q1) was associated with higher total body BMD overall (1.12 g/cm2 vs. 1.07 g/cm2, p-trend < 0.0001) and among non-sarcopenic survivors (1.15 g/cm2 vs. 1.08 g/cm2, p < 0.0001), but the association was not significant among sarcopenic survivors (1.09 g/cm2 vs. 1.04 g/cm2, p-trend = 0.18). Conclusion Among breast cancer survivors, higher LM and FM were independently related to higher total body BMD. Future exercise interventions to prevent bone loss among survivors should consider the potential relevance of increasing and preserving LM. PMID:24161130

  2. 40 CFR Table 5 to Subpart Ppp of... - Process Vents From Batch Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  3. 40 CFR Table 5 to Subpart Ppp of... - Process Vents From Batch Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  4. 40 CFR Table 5 to Subpart Ppp of... - Process Vents From Batch Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  5. 40 CFR 62.15250 - May I conduct stack testing less often?

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 15 nanograms per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter (total mass) for Class II units, for 2 consecutive years. In this case, you may choose... per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic...

  6. 40 CFR 62.15250 - May I conduct stack testing less often?

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 15 nanograms per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter (total mass) for Class II units, for 2 consecutive years. In this case, you may choose... per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic...

  7. 40 CFR 62.15250 - May I conduct stack testing less often?

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 15 nanograms per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic meter (total mass) for Class II units, for 2 consecutive years. In this case, you may choose... per dry standard cubic meter (total mass) for Class I units, or 30 nanograms per dry standard cubic...

  8. Lean Body Mass and Bone Health in Urban Adolescents From Northern India.

    PubMed

    Marwaha, Raman K; Garg, M K; Bhadra, Kuntal; Mahalle, Namita; Mithal, Ambrish; Tandon, Nikhil

    2017-03-15

    To prepare percentile charts of lean body mass (LBM) among Indian urban children and adolescents; and to evaluate gender differences in LBM, and its relation with pubertal status. Secondary data analysis. School in city of Delhi, India. 1403 apparently healthy children and adolescents (826 boys) with mean (SD) age 13.2 (2.7) years. Lean body mass assessed by dual energy absorptiometry. Total and regional lean mass were greater in older age groups in both sexes. LBM showed rising trends up to the age of 18 years in boys, whereas it plateaued after the age of 15 years in girls. The age-associated increase in LBM was significantly higher in boys (130%) compared to girls (83%) (P<0.001). Total and regional lean mass increased with progression of pubertal staging in both genders. During pubertal development, LBM almost doubled (100% increase) from stage-2 to stage-5 in boys, as opposed to a 73% rise in girls (P<0.001). Total and regional lean mass and Appendicular skeletal muscle mass index (ASMI) was positively correlated with age, body mass index (BMI), serum 25(OH)D, total fat mass, and bone mineral content (BMC). Relation between LBM and BMC remained significant even after adjusting for age, fat mass and various biochemical parameters. Total and regional LBM rise with age and pubertal maturation in both genders, but more so in boys when compared to girls. LBM has direct bearing on BMC even after adjusting for age, fat mass and biochemical parameters.

  9. Radiological characterization and evaluation of high volume bauxite residue alkali activated concretes.

    PubMed

    Croymans, Tom; Schroeyers, Wouter; Krivenko, Pavel; Kovalchuk, Oleksandr; Pasko, Anton; Hult, Mikael; Marissens, Gerd; Lutter, Guillaume; Schreurs, Sonja

    2017-03-01

    Bauxite residue, also known as red mud, can be used as an aggregate in concrete products. The study involves the radiological characterization of different types of concretes containing bauxite residue from Ukraine. The activity concentrations of radionuclides from the 238 U, 232 Th decay series and 40 K were determined for concrete mixture samples incorporating 30, 40, 50, 60, 75, 85 and 90% (by mass) of bauxite residue using gamma-ray spectrometry with a HPGe detector. The studied bauxite residue can, from a radiological point of view using activity concentration indexes developed by Markkanen, be used in concrete for building materials and in road construction, even in percentages reaching 90% (by mass). However, when also occupational exposure is considered it is recommended to incorporate less than 75% (by mass) of Ukrainian bauxite residue during the construction of buildings in order to keep the dose to workers below the dose criterion used by Radiation Protection (RP) 122 (0.3 mSv/a). Considering RP122 for evaluation of the total effective dose to workers no restrictions are required for the use of the Ukrainian bauxite residue in road construction. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Seasonal acclimatization of metabolism in Eurasian tree sparrows (Passer montanus).

    PubMed

    Zheng, Wei-Hong; Li, Ming; Liu, Jin-Song; Shao, Shu-Li

    2008-12-01

    Acclimatization to winter conditions is an essential prerequisite for survival of small passerines of the northern temperate zone. Changes in photoperiod, ambient temperature and food availability trigger seasonal acclimatization in physiology and behavior of many birds. In the present study, seasonal adjustments in several physiological, hormonal, and biochemical markers were examined in wild-captured Eurasian tree sparrows (Passer montanus) from the Heilongjiang Province in China. In winter sparrows had higher body mass and basal metabolic rate (BMR). Consistently, the dry mass of liver, heart, gizzard, small intestine, large intestine and total digestive tract were higher in winter than in that in summer. The contents of mitochondrial protein in liver, and state-4 respiration and cytochrome c oxidase (COX) activity in liver and muscle increased significantly in winter. Circulating level of serum triiodothyronine (T3) was significantly higher in winter than in summer. Together, these data suggest that tree sparrows mainly coped with cold by enhancing thermogenic capacities through increased organ masses and heightened activity of respiratory enzymes activities. The results support the view that prominent winter increases in BMR are manifestations of winter acclimatization in tree sparrows and that seasonal variation in metabolism in sparrows is similar to that in other small temperate-wintering birds.

  11. Properties of extracts from defatted rice bran by its subcritical water treatment.

    PubMed

    Wiboonsirikul, Jintana; Kimura, Yukitaka; Kadota, Megumi; Morita, Hisahiro; Tsuno, Takuo; Adachi, Shuji

    2007-10-17

    Defatted rice bran was extracted with water and subcritical water at 50-250 degrees C for 5 min. The highest extract yield was achieved at 200 degrees C, at which the maximum amounts of protein and carbohydrate were also obtained. The total phenolic and furfural contents, radical scavenging activity, and antioxidative activity for the autoxidation of linoleic acid increased with increasing treatment temperature. The bran extracts exhibited emulsifying activity except for the extract prepared at 250 degrees C, which was concomitant with the disappearance of its high-molecular-mass substances. The extract prepared at 200 degrees C also had the highest emulsion-stabilizing activity.

  12. Relationship between insulin resistance-associated metabolic parameters and anthropometric measurements with sugar-sweetened beverage intake and physical activity levels in US adolescents: findings from the 1999-2004 National Health and Nutrition Examination Survey.

    PubMed

    Bremer, Andrew A; Auinger, Peggy; Byrd, Robert S

    2009-04-01

    To evaluate the relationship between insulin resistance-associated metabolic parameters and anthropometric measurements with sugar-sweetened beverage intake and physical activity levels. A cross-sectional analysis of the National Health and Nutrition Examination Survey data collected by the National Center for Health Statistics. Nationally representative samples of US adolescents participating in the National Health and Nutrition Examination Survey during the years 1999-2004. A total of 6967 adolescents aged 12 to 19 years. Sugar-sweetened beverage consumption and physical activity levels. Glucose and insulin concentrations, a homeostasis model assessment of insulin resistance (HOMA-IR), total, high-density lipoprotein, and low-density lipoprotein cholesterol concentrations, triglyceride concentrations, systolic and diastolic blood pressure, waist circumference, and body mass index (calculated as weight in kilograms divided by height in meters squared) percentile for age and sex. Multivariate linear regression analyses showed that increased sugar-sweetened beverage intake was independently associated with increased HOMA-IR, systolic blood pressure, waist circumference, and body mass index percentile for age and sex and decreased HDL cholesterol concentrations; alternatively, increased physical activity levels were independently associated with decreased HOMA-IR, low-density lipoprotein cholesterol concentrations, and triglyceride concentrations and increased high-density lipoprotein cholesterol concentrations. Furthermore, low sugar-sweetened beverage intake and high physical activity levels appear to modify each others' effects of decreasing HOMA-IR and triglyceride concentrations and increasing high-density lipoprotein cholesterol concentrations. Sugar-sweetened beverage intake and physical activity levels are each independently associated with insulin resistance-associated metabolic parameters and anthropometric measurements in adolescents. Moreover, low sugar-sweetened beverage intake and high physical activity levels appear to modify each others' effects on several health-related outcome variables.

  13. Association Between Physical Activity Intensity and Physical Capacity Among Individuals Awaiting Bariatric Surgery.

    PubMed

    Rioux, Brittany V; Sénéchal, Martin; Kwok, Karen; Fox, Jill; Gamey, Dean; Bharti, Neha; Vergis, Ashley; Hardy, Krista; Bouchard, Danielle R

    2017-05-01

    Physical activity is a routine component of the lifestyle modification program implemented prior to bariatric surgery, and one of the goals is to improve patients' physical capacity. However, the physical activity intensity recommended to meet that goal is unknown. This study aimed to assess the association between time spent at different physical activity intensities and physical capacity in patients awaiting bariatric surgery. A total of 39 women and 13 men were recruited. The primary outcome was physical capacity measured using six objective tests: 6-min walk, chair stand, sit and reach, unipodal balance (eyes open and eyes closed), and hand grip strength tests. The primary exposure variable was physical activity intensity (i.e., sedentary, light, moderate, and vigorous) measured by accelerometers. The average body mass index was 46.3 ± 5.4 kg/m 2 . Only 6% of total time was spent at moderate to vigorous intensity, while 71% of the time was spent sedentary. When adjusted for body mass index, age, and sex, four of the six physical capacity tests were significantly associated with moderate intensity physical activity β(SE): 6-min walk 9.7 (2.7), chair stand 0.3 (0.1), balance (eyes open) 1.8 (0.7), and hand grip strength 1.2 (0.4), and only the 6-min walk was associated with sedentary activity 1.7 (0.7). These results suggest that physical capacity is associated with time spent at moderate intensity in individuals awaiting bariatric surgery. The next step is to study if an increase in time spent at moderate intensity will translate to improvements in physical capacity.

  14. Anti-inflammatory evaluation and characterization of leaf extract of Ananas comosus.

    PubMed

    Kargutkar, Samira; Brijesh, S

    2018-04-01

    Ananas comosus (L.) Merr (Pineapple) is a tropical plant with an edible fruit. In the present study, the potential anti-inflammatory activity of A. comosus leaf extract (ALE) was studied. ALE prepared using soxhlet apparatus was subjected to preliminary qualitative phytochemical analysis and quantitative estimations of flavonoids and tannins. The components present in ALE were identified using liquid chromatography-mass spectrometry (LC-MS) and gas chromatography-mass spectrometry (GC-MS). Inhibitory effects of ALE on protein denaturation, and proteinase activity were assessed. Its effect on secretion of pro-inflammatory cytokines and inflammatory mediators by lipopolysaccharide-stimulated macrophages was also analyzed. Further, its anti-inflammatory activity in carrageenan-induced inflammatory rat model was examined. The preliminary qualitative phytochemical analysis revealed presence of flavonoids, phenols, tannins, carbohydrates, glycosides, and proteins in the extract. Total flavonoids and total tannins were 0.17 ± 0.006 mg equivalent of quercetin/g of ALE and 4.04 ± 0.56 mg equivalent of gallic acid/g of ALE. LC-MS analysis identified the presence of 4-hydroxy pelargonic acid, 3,4,5-trimethoxycinnamic and 4-methoxycinnamic acid, whereas GC-MS analysis identified the presence of campesterol and ethyl isoallocholate that have been previously reported for anti-inflammatory activity. ALE showed significant inhibition of protein denaturation and proteinase activity and also controlled secretion of tumour necrosis factor-α, interleukin-1β and prostaglandins, as well as the generation of reactive oxygen species by activated macrophages. ALE also significantly decreased carrageenan-induced acute paw edema. The study, therefore, identified the components present in ALE that may be responsible for its anti-inflammatory activity and thus demonstrated its potential use against acute inflammatory diseases.

  15. Measuring Intermediate-Mass Black-Hole Binaries with Advanced Gravitational Wave Detectors.

    PubMed

    Veitch, John; Pürrer, Michael; Mandel, Ilya

    2015-10-02

    We perform a systematic study to explore the accuracy with which the parameters of intermediate-mass black-hole binary systems can be measured from their gravitational wave (GW) signatures using second-generation GW detectors. We make use of the most recent reduced-order models containing inspiral, merger, and ringdown signals of aligned-spin effective-one-body waveforms to significantly speed up the calculations. We explore the phenomenology of the measurement accuracies for binaries with total masses between 50M(⊙) and 500M(⊙) and mass ratios between 0.1 and 1. We find that (i) at total masses below ∼200M(⊙), where the signal-to-noise ratio is dominated by the inspiral portion of the signal, the chirp mass parameter can be accurately measured; (ii) at higher masses, the information content is dominated by the ringdown, and total mass is measured more accurately; (iii) the mass of the lower-mass companion is poorly estimated, especially at high total mass and more extreme mass ratios; and (iv) spin cannot be accurately measured for our injection set with nonspinning components. Most importantly, we find that for binaries with nonspinning components at all values of the mass ratio in the considered range and at a network signal-to-noise ratio of 15, analyzed with spin-aligned templates, the presence of an intermediate-mass black hole with mass >100M(⊙) can be confirmed with 95% confidence in any binary that includes a component with a mass of 130M(⊙) or greater.

  16. Impact of Policy and Built Environment Changes on Obesity-related Outcomes: A Systematic Review of Naturally-Occurring Experiments

    PubMed Central

    Mayne, Stephanie L.; Auchincloss, Amy H.; Michael, Yvonne L.

    2016-01-01

    Policies and changes to the built environment are promising targets for obesity prevention efforts and can be evaluated as “natural”- or “quasi”-experiments. This systematic review examined the use of natural- or quasi-experiments to evaluate the efficacy of policy and built environment changes on obesity-related outcomes (body mass index, diet, or physical activity). PubMed (Medline) was searched for studies published 2005–2013; 1,175 abstracts and 115 articles were reviewed. Of the 37 studies included, 18 studies evaluated impacts on nutrition/diet, 17 on physical activity, and 3 on body mass index. Nutrition-related studies found greater effects due to bans/restrictions on unhealthy foods, mandates offering healthier foods, and altering purchase/payment rules on foods purchased using low-income food vouchers compared to other interventions (menu labeling, new supermarkets). Physical activity-related studies generally found stronger impacts when the intervention involved improvements to active transportation infrastructure, longer follow-up time, or measured process outcomes (e.g., cycling rather than total physical activity) compared to other studies. Only three studies directly assessed body mass index or weight, and only one (installing light-rail system) observed a significant effect. Studies varied widely in the strength of their design and studies with weaker designs were more likely to report associations in the positive direction. PMID:25753170

  17. Bulge growth and quenching since z = 2.5 in CANDELS/3D-HST

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lang, Philipp; Wuyts, Stijn; Schreiber, Natascha M. Förster

    2014-06-10

    Exploiting the deep high-resolution imaging of all five CANDELS fields, and accurate redshift information provided by 3D-HST, we investigate the relation between structure and stellar populations for a mass-selected sample of 6764 galaxies above 10{sup 10} M {sub ☉}, spanning the redshift range 0.5 < z < 2.5. For the first time, we fit two-dimensional models comprising a single Sérsic fit and two-component (i.e., bulge + disk) decompositions not only to the H-band light distributions, but also to the stellar mass maps reconstructed from resolved stellar population modeling. We confirm that the increased bulge prominence among quiescent galaxies, as reportedmore » previously based on rest-optical observations, remains in place when considering the distributions of stellar mass. Moreover, we observe an increase of the typical Sérsic index and bulge-to-total ratio (with median B/T reaching 40%-50%) among star-forming galaxies above 10{sup 11} M {sub ☉}. Given that quenching for these most massive systems is likely to be imminent, our findings suggest that significant bulge growth precedes a departure from the star-forming main sequence. We demonstrate that the bulge mass (and ideally knowledge of the bulge and total mass) is a more reliable predictor of the star-forming versus quiescent state of a galaxy than the total stellar mass. The same trends are predicted by the state-of-the-art, semi-analytic model by Somerville et al. In this model, bulges and black holes grow hand in hand through merging and/or disk instabilities, and feedback from active galactic nuclei shuts off star formation. Further observations will be required to pin down star formation quenching mechanisms, but our results imply that they must be internal to the galaxies and closely associated with bulge growth.« less

  18. Mass distribution in galaxy clusters: the role of Active Galactic Nuclei feedback

    NASA Astrophysics Data System (ADS)

    Teyssier, Romain; Moore, Ben; Martizzi, Davide; Dubois, Yohan; Mayer, Lucio

    2011-06-01

    We use 1-kpc resolution cosmological Adaptive Mesh Refinement (AMR) simulations of a Virgo-like galaxy cluster to investigate the effect of feedback from supermassive black holes on the mass distribution of dark matter, gas and stars. We compared three different models: (i) a standard galaxy formation model featuring gas cooling, star formation and supernovae feedback, (ii) a 'quenching' model for which star formation is artificially suppressed in massive haloes and finally (iii) the recently proposed active galactic nucleus (AGN) feedback model of Booth and Schaye. Without AGN feedback (even in the quenching case), our simulated cluster suffers from a strong overcooling problem, with a stellar mass fraction significantly above observed values in M87. The baryon distribution is highly concentrated, resulting in a strong adiabatic contraction (AC) of dark matter. With AGN feedback, on the contrary, the stellar mass in the brightest cluster galaxy (BCG) lies below observational estimates and the overcooling problem disappears. The stellar mass of the BCG is seen to increase with increasing mass resolution, suggesting that our stellar masses converge to the correct value from below. The gas and total mass distributions are in better agreement with observations. We also find a slight deficit (˜10 per cent) of baryons at the virial radius, due to the combined effect of AGN-driven convective motions in the inner parts and shock waves in the outer regions, pushing gas to Mpc scales and beyond. This baryon deficit results in a slight adiabatic expansion of the dark matter distribution that can be explained quantitatively by AC theory.

  19. Higher-speed coronal mass ejections and their geoeffectiveness

    NASA Astrophysics Data System (ADS)

    Singh, A. K.; Bhargawa, Asheesh; Tonk, Apeksha

    2018-06-01

    We have attempted to examine the ability of coronal mass ejections to cause geoeffectiveness. To that end, we have investigated total 571 cases of higher-speed (> 1000 km/s) coronal mass ejection events observed during the years 1996-2012. On the basis of angular width (W) of observance, events of coronal mass ejection were further classified as front-side or halo coronal mass ejections (W = 360°); back-side halo coronal mass ejections (W = 360°); partial halo (120°< W < 360°) and non-halo (W < 120°). From further analysis, we found that front halo coronal mass ejections were much faster and more geoeffective in comparison of partial halo and non-halo coronal mass ejections. We also inferred that the front-sided halo coronal mass ejections were 67.1% geoeffective while geoeffectiveness of partial halo coronal mass ejections and non-halo coronal mass ejections were found to be 44.2% and 56.6% respectively. During the same period of observation, 43% of back-sided CMEs showed geoeffectiveness. We have also investigated some events of coronal mass ejections having speed > 2500 km/s as a case study. We have concluded that mere speed of coronal mass ejection and their association with solar flares or solar activity were not mere criterion for producing geoeffectiveness but angular width of coronal mass ejections and their originating position also played a key role.

  20. Difference in glucagon-like peptide-1 concentrations between C-peptide negative type 1 diabetes mellitus patients and healthy controls.

    PubMed

    Zibar, Karin; Ćuća, Jadranka Knežević; Blaslov, Kristina; Bulum, Tomislav; Smirčić-Duvnjak, Lea

    2015-03-01

    The role of glucagon-like peptide-1 (GLP-1) has become a new scientific interest in the field of pathophysiology of type 1 diabetes mellitus (T1DM), but the results of the published studies were contradictory. The aim of our study was therefore to measure fasting and postprandial GLP-1 concentrations in T1DM patients and in healthy controls and to examine the difference in those concentrations between the two groups of subjects. The cross-sectional study included 30 C-peptide negative T1DM patients, median age 37 years (20-59), with disease duration 22 years (3-45), and 10 healthy controls, median age 30 years (27-47). Fasting and postprandial total and active GLP-1 concentrations were measured by ELISA (ALPCO, USA). The data were statistically analysed by SPSS, and significance level was accepted at P < 0.05. Both fasting total and active GLP-1 concentrations were significantly lower in T1DM patients (total 0.4 pmol/L, 0-6.4 and active 0.2 pmol/L, 0-1.9) compared with healthy controls (total 3.23 pmol/L, 0.2-5.5 and active 0.8 pmol/L, 0.2-3.6), P = 0.008 for total GLP-1 and P = 0.001 for active GLP-1. After adjustment for age, sex and body mass index, binary logistic regression showed that both fasting total and active GLP-1 remained significantly independently lower in T1DM patients (total GLP-1: OR 2.43, 95% CI 1.203-4.909 and active GLP-1: OR 8.73, 95% CI 1.472-51.787). T1DM patients had independently lower total and active GLP-1 fasting concentrations in comparison with healthy people, which supports the potential therapeutic role of incretin therapy, along with insulin therapy, in T1DM patients. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  1. Research on new dynamic force calibration system

    NASA Astrophysics Data System (ADS)

    Zhang, Li

    2008-06-01

    Sinusoidal force calibration method based on electrodynamic shaker and interferometric system was studied several years before at Physikalisch-Technische Bundesanstalt (PTB). In that system a load mass are screwed on the top of force transducer, the sinusoidal forces realized by accelerated load masses are traceable to acceleration and mass according to the force definition F(t) = ma(t), where m is the total mass acting on the sensing element of the force transducer and a is the time and spatial-dependent acceleration of the mass, which is directly measured by a laser interferometer. This paper will introduce a new dynamic force calibration system developed at Changcheng Institute of Metrology and Measurement (CIMM). It uses electrodynamic shakers to generate dynamic force in the range from 1N to 20kN, and heterodyne laser interferometers are used for acceleration measurement. A new air bearing system is developed to increase the performance of shakers and an active vibration isolator is used to reduce enviromental disturbance to the interferometric system.

  2. [Pregnancy and lactation are not risk factors for osteoporosis or fractures].

    PubMed

    Karlsson, Magnus K; Ahlborg, Henrik G; Karlsson, Caroline

    Observational and case control studies infer that a pregnancy and a period of lactation are followed by loss in bone mass of up to 5%. The reason for this loss is virtually impossible to conclude as so many factors known to influence the bone mass undergo changes during a pregnancy and lactation. The increased calcium demand, changed nutritional habits, reduced smoking and alcohol consumption seen in many women during these periods, the changes in body weight and fat content, the changed level of physical activity and the changed levels of hormones with potential to influence the bone metabolism could all influence the bone mass. Most studies also report that the deficit in "bone mass" normalises after weaning. Multiple pregnancies and long total duration of lactation can not be regarded as risk factors for osteoporosis and fragility fractures as most reports indicate that women with multiple pregnancies have similar or higher bone mass and similar or lower fracture incidence than their peers with no children.

  3. Injuries in Collegiate Women’s Volleyball: A Four-Year Retrospective Analysis

    PubMed Central

    Sole, Christopher J.; Kavanaugh, Ashley A.; Stone, Michael H.

    2017-01-01

    A four-year retrospective analysis of injury data was conducted on a collegiate (NCAA Division I) women’s volleyball team. Twenty athletes (Year 1: age = 19.4 ± 0.9 y, height = 175.2 ± 5.1 cm, body mass = 70.5 ± 10.2 kg; Year 2: age = 20.1 ± 1.0 y, height = 175.7 ± 4.7 cm, body mass = 69.5 ± 10.1 kg; Year 3: age = 20.1 ± 1.4 y, height = 173.8 ± 6.3 cm, body mass = 69.9 ± 10.8 kg; Year 4: age = 19.5 ± 1.4 y, height = 174.4 ± 8.6 cm, body mass = 72.7 ± 10.8 kg) participated in this study, accounting for 1483 total training exposures. Injury was defined as any damage to a body part, incurred during volleyball or strength and conditioning-related activities, which interfered with training and/or competition. Injury rate was normalized to the number of athletes and exposure and expressed as injuries per 1000 exposures. A total of 133 injuries were recorded. The most common injury was to the knee (left = 7.5%, right = 12.0%). Injuries occurred most often in volleyball practice (75.2%), followed by competition (20.3%), and strength and conditioning-related activities (4.5%). Non-contact injuries (upper body = 26.3%, lower body = 53.4%) were more common than contact injuries (upper-body = 13.5%, lower-body = 6.8%). An examination of injury rates relative to the training year revealed patterns in injury occurrence. Specifically, spikes in injury rate were consistently observed during periods of increased training volume that were preceded by breaks in organized training, such as the early pre-season and off-season training periods.

  4. Comparison of estimates of resting energy expenditure equations in haemodialysis patients.

    PubMed

    Hung, Rachel; Sridharan, Sivakumar; Farrington, Ken; Davenport, Andrew

    2017-04-21

    Waste products of metabolism accumulate in patients with chronic kidney disease, and require clearance by haemodialysis (HD). We wished to determine whether there was an association between resting energy expenditure (REE) and total energy expenditure (TEE) in HD patients and body composition. We determined REE by recently validated equations (CKD equation) and compared REE with that estimated by standard equations for REE, and TEE calculated from patient reported physical activity, in HD patients with corresponding body composition measured by dual energy X-ray absorptiometry (DEXA) scanning. We studied 107 patients, 69 male (64.5%), mean age 62.7 ± 15.1 years. The CKD equation REE was 72.5 ± 13.3 watts (W) and TEE 83.2 ± 9.7 W. There was a strong association between REE with body surface area (BSA) (r2 = 0.80), total soft lean and fat lean tissue mass (r2 = 0.69), body mass index (BMI) (r2 = 0.34), all p<0.001. REE estimated using the modified Harris Benedict, Mifflin St. Jeor, Katch McArdle, Bernstein and Robertson equations underestimated REE compared to the CKD equation. TEE was more strongly associated with BSA (r2 = 0.51), appendicular muscle mass (r2 = 0.42), than BMI (r2 = 0.15) all p<0.001.TEE was greater for those employed (104.9 ± 10.7 vs. 83.1 ± 12.3 W, p<0.001), and with no co-morbidity (88.7 ± 14.8 vs. 82.7 ± 12.3 W, p<0.05). Standard equations underestimate REE in HD patients compared to the CKD equation. TEE was greater in those with more skeletal muscle mass, in those who were employed and in those with the least co-morbidity. More metabolically active patients may well require greater dialytic clearances.

  5. Linking sedimentary total organic carbon to 210Pbex chronology from Changshou Lake in the Three Gorges Reservoir Region, China.

    PubMed

    Anjum, Raheel; Gao, Jinzhang; Tang, Qiang; He, Xiubin; Zhang, Xinbao; Long, Yi; Shi, Zhonglin; Wang, Mingfeng

    2017-05-01

    The influences of total organic carbon (TOC) and total nitrogen (TN) on Lead-210 ( 210 Pb) dating have recently been of increasing concern in lacustrine research. Sediment core from Changshou Lake in the Longxi catchment was investigated for influence of TOC on 210 Pb dating. Lead-210 excess ( 210 Pb ex ), Cesium-137 ( 137 Cs) activities, TOC, TN, and particle size were measured. We proposed a dating index based on 137 Cs chronology and particle size distribution of the lake sediment profile and rainfall erosivities calculated from Longxi catchment metrological records. Increasing trends in TOC and TN were specifically caused by commercial cage fish farming after 1989. The statistically significant correlation between 210 Pb ex activity, TOC (0.61, p = 0.04) and TN (0.51, p = 0.04), respectively explained post-1989 210 Pb scavenging. The 210 Pb ex activity was closely related with coupled peaks of TOC and TN from mass depth 5-10 g cm -2 . Higher TOC/TN ratio (8.33) indicated submerged macrophytes and native aquatic algal growth as main source of carbon from enhanced primary productivity because of massive fertilizer use and coherent climate warming. The study supported key hypothesis on vital role of fertilizer usage and algal derived TOC in controlling sedimentary 210 Pb ex activity at Changshou Lake sediment. 137 Cs profile and erosive events as time markers provided reliable and consistent sedimentation rate of (1.6 cm y -1 ). 210 Pb ex activity decayed exponentially after peak at mass depth 5.68 g cm -2 . Therefore, violation of 210 Pb dating primary assumptions made it inappropriate for sediment dating at Changshou Lake. TOC content must be considered while using 210 Pb as dating tool for lake sediment profiles. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Parenting Style as a Moderator of the Association between Parenting Behaviors and the Weight Status of Adolescents

    ERIC Educational Resources Information Center

    Wen, Xu; Hui, Stanley Sai-Chuen

    2012-01-01

    Based on the contextual model of parenting style, this study aimed to examine whether the associations between parenting behaviors and adolescents' dietary habits, physical activity, and weight status is moderated by parenting style. A total of 1,869 parent-adolescent dyads were recruited in southern China. The adolescents' body mass index,…

  7. Essential oils of enhinophora lamondiana (Apiales: Umbelliferae): a relationship between chemical profile and biting deterrence and larvicidal activity against mosquitoes (Diptera:Culicidae)

    USDA-ARS?s Scientific Manuscript database

    The essential oils from the flower, leaf, and stem of Echinophora lamondiana B.Yildiz et Z.Bahcecioglu were analyzed by gas chromatography–flame ionization detection and gas chromatography–mass spectrometry. In total, 41, 37, and 44 compounds were identified, which accounted for 98.0, 99.1, and 97.0...

  8. The relationship of endogenous plasma concentrations of β-Hydroxy β-Methyl Butyrate (HMB) to age and total appendicular lean mass in humans.

    PubMed

    Kuriyan, Rebecca; Lokesh, Deepa P; Selvam, Sumithra; Jayakumar, J; Philip, Mamatha G; Shreeram, Sathyavageeswaran; Kurpad, Anura V

    2016-08-01

    The maintenance of muscle mass and muscle strength is important for reducing the risk of chronic diseases. The age- related loss of muscle mass and strength is associated with adverse outcomes of physical disability, frailty and death. β-Hydroxy β-Methyl Butyrate (HMB), a metabolite of leucine, has beneficial effects on muscle mass and strength under various catabolic conditions. The objectives of the present study were to determine if age- related differences existed in endogenous plasma HMB levels, and to assess if HMB levels correlated to total appendicular lean mass and forearm grip strength. Anthropometry, dietary and physical activity assessment, and the estimation of fasting plasma HMB concentrations and handgrip strength were performed on the 305 subjects (children, young adults and older adults). Lean mass, which serves as a surrogate for muscle mass was measured using dual energy X-ray absorptiometry (DEXA). Mean plasma HMB concentrations were significantly lower with increasing age groups, with children having highest mean HMB concentration (p<0.01) followed by young adults and older adults. Female subjects (across all ages) had significantly lower plasma HMB concentrations. A significant positive correlation between HMB concentrations and appendicular lean mass normalized for body weight (%), appendicular lean mass (r=0.37; p<0.001) was observed in the young adults and older adults group. Handgrip strength was positively associated with plasma HMB concentrations in young adults (r=0.58; p<0.01) and the older adults group (r=0.28; p<0.01). The findings of the present study suggest that there is an age- related decline in endogenous HMB concentrations in humans and the HMB concentrations were positively correlated with appendicular lean mass and hand grip strength in young adults and older adults group. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  9. Health Benefits of an Innovative Exercise Program for Mitochondrial Disorders.

    PubMed

    Fiuza-Luces, Carmen; Díez-Bermejo, Jorge; Fernández-DE LA Torre, Miguel; Rodríguez-Romo, Gabriel; Sanz-Ayán, Paz; Delmiro, Aitor; Munguía-Izquierdo, Diego; Rodríguez-Gómez, Irene; Ara, Ignacio; Domínguez-González, Cristina; Arenas, Joaquín; Martín, Miguel A; Lucia, Alejandro; Morán, María

    2018-06-01

    We determined the effects of an innovative 8-wk exercise intervention (aerobic, resistance, and inspiratory muscle training) for patients with mitochondrial disease. Several end points were assessed in 12 patients (19-59 yr, 4 women) at pretraining, posttraining, and after 4-wk detraining: aerobic power, muscle strength/power and maximal inspiratory pressure (main end points), ability to perform activities of daily living, body composition, quality of life, and blood myokines (secondary end points). The program was safe, with patients' adherence being 94% ± 5%. A significant time effect was found for virtually all main end points (P ≤ 0.004), indicating a training improvement. Similar findings (P ≤ 0.003) were found for activities of daily living tests, total/trunk/leg lean mass, total fat mass, femoral fracture risk, and general health perception. No differences were found for blood myokines, except for an acute exertional increase in interleukin 8 at posttraining/detraining (P = 0.002) and in fatty acid binding protein 3 at detraining (P = 0.002). An intervention including novel exercises for mitochondrial disease patients (e.g., inspiratory muscle training) produced benefits in numerous indicators of physical capacity and induced a previously unreported shift toward a healthier body composition phenotype.

  10. Optimisation of Microwave-Assisted Extraction of Pomegranate (Punica granatum L.) Seed Oil and Evaluation 
of Its Physicochemical and Bioactive Properties.

    PubMed

    Çavdar, Hasene Keskin; Yanık, Derya Koçak; Gök, Uğur; Göğüş, Fahrettin

    2017-03-01

    Pomegranate seed oil was extracted in a closed-vessel high-pressure microwave system. The characteristics of the obtained oil, such as fatty acid composition, free fatty acidity, total phenolic content, antioxidant activity and colour, were compared to those of the oil obtained by cold solvent extraction. Response surface methodology was applied to optimise extraction conditions: power (176-300 W), time (5-20 min), particle size ( d =0.125-0.800 mm) and solvent to sample ratio (2:1, 6:1 and 10:1, by mass). The predicted highest extraction yield (35.19%) was obtained using microwave power of 220 W, particle size in the range of d =0.125-0.450 mm and solvent-to-sample ratio of 10:1 (by mass) in 5 min extraction time. Microwave-assisted solvent extraction (MASE) resulted in higher extraction yield than that of Soxhlet (34.70% in 8 h) or cold (17.50% in 8 h) extraction. The dominant fatty acid of pomegranate seed oil was punicic acid (86%) irrespective of the extraction method. Oil obtained by MASE had better physicochemical properties, total phenolic content and antioxidant activity than the oil obtained by cold solvent extraction.

  11. Carbon source/sink function of a subtropical, eutrophic lake determined from an overall mass balance and a gas exchange and carbon burial balance.

    PubMed

    Yang, Hong; Xing, Yangping; Xie, Ping; Ni, Leyi; Rong, Kewen

    2008-02-01

    Although studies on carbon burial in lake sediments have shown that lakes are disproportionately important carbon sinks, many studies on gaseous carbon exchange across the water-air interface have demonstrated that lakes are supersaturated with CO(2) and CH(4) causing a net release of CO(2) and CH(4) to the atmosphere. In order to more accurately estimate the net carbon source/sink function of lake ecosystems, a more comprehensive carbon budget is needed, especially for gaseous carbon exchange across the water-air interface. Using two methods, overall mass balance and gas exchange and carbon burial balance, we assessed the carbon source/sink function of Lake Donghu, a subtropical, eutrophic lake, from April 2003 to March 2004. With the overall mass balance calculations, total carbon input was 14 905 t, total carbon output was 4950 t, and net carbon budget was +9955 t, suggesting that Lake Donghu was a great carbon sink. For the gas exchange and carbon burial balance, gaseous carbon (CO(2) and CH(4)) emission across the water-air interface totaled 752 t while carbon burial in the lake sediment was 9477 t. The ratio of carbon emission into the atmosphere to carbon burial into the sediment was only 0.08. This low ratio indicates that Lake Donghu is a great carbon sink. Results showed good agreement between the two methods with both showing Lake Donghu to be a great carbon sink. This results from the high primary production of Lake Donghu, substantive allochthonous carbon inputs and intensive anthropogenic activity. Gaseous carbon emission accounted for about 15% of the total carbon output, indicating that the total output would be underestimated without including gaseous carbon exchange.

  12. Effects of a 12-week intervention period with football and running for habitually active men with mild hypertension.

    PubMed

    Knoepfli-Lenzin, C; Sennhauser, C; Toigo, M; Boutellier, U; Bangsbo, J; Krustrup, P; Junge, A; Dvorak, J

    2010-04-01

    The present study examined the effect of football (F, n=15) training on the health profile of habitually active 25-45-year-old men with mild hypertension and compared it with running (R, n=15) training and no additional activity (controls, C, n=17). The participants in F and R completed a 1-h training session 2.4 times/week for 12 weeks. Systolic and diastolic blood pressure decreased in all groups but the decrease in diastolic blood pressure in F (-9 +/- 5 (+/- SD) mmHg) was higher than that in C (-4 +/- 6 mmHg). F was as effective as R in decreasing body mass (-1.6 +/- 1.8 vs-1.5 +/- 2.1 kg) and total fat mass (-2.0 +/- 1.5 vs -1.6 +/- 1.5 kg) and in increasing supine heart rate variability, whereas no changes were detected for C. Maximal stroke volume improved in F (+13.1%) as well as in R (+10.1%) compared with C (-4.9%). Total cholesterol decreased in F (5.8 +/- 1.2 to 5.5 +/- 0.9 mmol/L) but was not altered in R and C. We conclude that football training, consisting of high-intensity intermittent exercise, results in positive effects on blood pressure, body composition, stroke volume and supine heart rate variability, and elicits at least the same cardiovascular health benefits as continuous running exercise in habitually active men with mild hypertension.

  13. Total homocysteine is positively correlated with body mass index, waist-to-hip ratio, and fat mass among overweight reproductive women: A cross-sectional study.

    PubMed

    Al-Bayyari, Nahla; Hamadneh, Jehan; Hailat, Rae'd; Hamadneh, Shereen

    2017-12-01

    Conflicting associations between total homocysteine (tHcy), body mass index (BMI) lean body mass, and fat mass in the general population have been reported. We investigated the hypothesis that elevated tHcy levels are associated with increased BMI, waist-to-hip ratio (WHR), and body fat mass percent. In Jordan, obesity and overweight are prevalent among reproductive women and hyperhomocysteinemia, along with obesity and overweight, are independent risk factors for cardiovascular diseases. The participants used in this cross-sectional study were 325 overweight Jordanian women aged between 18 and 49 years old. The main outcome measures were tHcy, BMI, WHR, fat mass, fat-free mass, and total body water. Serum tHcy was analyzed using a liquid chromatography tandem mass spectrophotometry (LC-MS/MS) complete kit. The body compositions were measured using a bioelectrical impedance analyzer. Study participants were stratified according to their tHcy level into two groups, ≤10 μmol/L and >10 μmol/L, and the difference between mean values of body compositions was evaluated. The tHcy was significantly and negatively correlated with age, fat-free mass, and total body water, and significantly and positively correlated with BMI, hip circumference, WHR, fat mass, and dry lean weight. The chi-square and the independent sample t-tests showed statistically significant (P ≤ .05) differences between tHcy and BMI, WHR, fat and fat-free mass, and total body water percentages. In conclusion, BMI, WHR and body fat mass were found to be associated with elevated tHcy levels among overweight reproductive women, and they might be used as independent predictors of the tHcy level. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. 40 CFR Table 5 to Subpart Ppp of... - Process Vents From Batch Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... collected—PR. d,e Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  15. 40 CFR Table 6 to Subpart Ppp of... - Process Vents From Continuous Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... operating—PR. d e Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  16. 40 CFR Table 5 to Subpart Ppp of... - Process Vents From Batch Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... collected—PR. d e Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  17. 40 CFR Table 6 to Subpart Ppp of... - Process Vents From Continuous Unit Operations-Monitoring, Recordkeeping, and Reporting Requirements

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... operating—PR. d,e Carbon Adsorber f Total regeneration stream mass or volumetric flow during carbon bed regeneration cycle(s), and 1. Record of total regeneration stream mass or volumetric flow for each carbon bed regeneration cycle.2. Record and report the total regeneration stream mass or volumetric flow during each...

  18. 40 CFR 63.829 - Recordkeeping requirements.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... mass of all HAP containing materials used and the mass fraction of HAP present in each HAP containing... the criteria of § 63.821(b)(1), the owner or operator shall maintain records of the total mass of each... maintain records of the total mass and organic HAP content of each material applied on product and...

  19. 40 CFR 63.829 - Recordkeeping requirements.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... mass of all HAP containing materials used and the mass fraction of HAP present in each HAP containing... the criteria of § 63.821(b)(1), the owner or operator shall maintain records of the total mass of each... maintain records of the total mass and organic HAP content of each material applied on product and...

  20. 40 CFR 63.829 - Recordkeeping requirements.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... mass of all HAP containing materials used and the mass fraction of HAP present in each HAP containing... the criteria of § 63.821(b)(1), the owner or operator shall maintain records of the total mass of each... maintain records of the total mass and organic HAP content of each material applied on product and...

  1. 40 CFR 63.829 - Recordkeeping requirements.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... mass of all HAP containing materials used and the mass fraction of HAP present in each HAP containing... the criteria of § 63.821(b)(1), the owner or operator shall maintain records of the total mass of each... maintain records of the total mass and organic HAP content of each material applied on product and...

  2. Long work hours and adiposity among police officers in a US northeast city.

    PubMed

    Gu, Ja K; Charles, Luenda E; Burchfiel, Cecil M; Fekedulegn, Desta; Sarkisian, Khachatur; Andrew, Michael E; Ma, Claudia; Violanti, John M

    2012-11-01

    To investigate the associations between long work hours and adiposity measures in police officers. Participants included 408 officers from the Buffalo Cardio-Metabolic Occupational Police Stress study who were examined between 2004 and 2009. Total work hours were abstracted from payroll records and questionnaires. Analysis of variance and covariance models were used. Among male officers who worked the midnight shift, mean values of waist circumference and body mass index increased with longer work hours after adjustment for age, physical activity, energy intake, sleep duration, smoking status, police rank, activities after work (eg, child/family care, sports), and household income. Adiposity measures were not associated with work hours among women on any shift. Working longer hours was significantly associated with larger waist circumferences and higher body mass index among male police officers working the midnight shift.

  3. Composition and antioxidant activity of the essential oils of Xylopia aethiopica (Dun) A. Rich. (Annonaceae) leaves, stem bark, root bark, and fresh and dried fruits, growing in Ghana.

    PubMed

    Karioti, Anastasia; Hadjipavlou-Litina, Dimitra; Mensah, Merlin L K; Fleischer, Theophilus C; Skaltsa, Helen

    2004-12-29

    The chemical composition of the essential oils obtained from the leaves, the barks of the stem and the root, as well as from the fresh and dried fruits of Xylopia aethiopica, growing in Ghana, was investigated by gas chromatography/mass spectrometry analyses. Kovats indices, mass spectra, and standard compounds were used to identify a total of 93 individual compounds. The monoterpene hydrocarbons formed the main portion in all studied samples. beta-Pinene was predominant in all cases, while trans-m-mentha-1(7),8-diene was the main compound in the essential oils of the leaves and the barks of roots and stems. Their potential antioxidant activity was also investigated and found to be significant in scavenging superoxide anion radical.

  4. Is Serum Prostate-specific Antigen a Diagnostic Marker for Benign and Malignant Breast Tumors in Women.

    PubMed

    Razavi, Seyed Hasan Emami; Ghajarzadeh, Mahsa; Abdollahi, Alireza; Taran, Ludmila; Shoar, Saeed; Omranipour, Ramesh

    2015-06-01

    Breast cancer is the most common cancer in women. Prostrate-specific antigen (PSA) is a marker of prostate gland malignancy which has been considered in cases with breast cancer in recent years. The goal of this study was to determine total and free PSA levels in cases with malignant and benign breast lesions. Ninety women with histological proved malignant breast masses and 90 with benign breast masses were enrolled. Total and free PSA levels along with histological grade and conditions of vascular and perinural invasion, status of hormonal tumor receptors, immune-histo-chemistry markers recorded for all cases. Total and free PSA levels were assessed after treatment in cases with malignant masses. Total and free PSA levels were significantly higher in cases with malignant masses. The best cut off point for total PSA to differentiate benign and malignant masses was 0.31 and the best cut off point for free PSA to differentiate benign and malignant masses was 0.19. After treatment, mean free PSA level was significantly lower than free PSA before treatment (0.23 vs 0.3, p<0.001). Serum PSA level could be applied for differentiating benign and malignant breast masses.

  5. Biologic activity of porphyromonas endodontalis complex lipids.

    PubMed

    Mirucki, Christopher S; Abedi, Mehran; Jiang, Jin; Zhu, Qiang; Wang, Yu-Hsiung; Safavi, Kamran E; Clark, Robert B; Nichols, Frank C

    2014-09-01

    Periapical infections secondary to pulpal necrosis are associated with bacterial contamination of the pulp. Porphyromonas endodontalis, a gram-negative organism, is considered to be a pulpal pathogen. P. gingivalis is phylogenetically related to P. endodontalis and synthesizes several classes of novel complex lipids that possess biological activity, including the capacity to promote osteoclastogenesis and osteoclast activation. The purpose of this study was to extract and characterize constituent lipids of P. endodontalis and evaluate their capacity to promote proinflammatory secretory responses in the macrophage cell line, RAW 264.7, as well as their capacity to promote osteoclastogenesis and inhibit osteoblast activity. Constituent lipids of both organisms were fractionated by high-performance liquid chromatography and were structurally characterized using electrospray mass spectrometry or electrospray-mass spectrometry/mass spectrometry. The virulence potential of P. endodontalis lipids was then compared with known biologically active lipids isolated from P. gingivalis. P. endodontalis total lipids were shown to promote tumor necrosis factor alpha secretion from RAW 264.7 cells, and the serine lipid fraction appeared to account for the majority of this effect. P. endodontalis lipid preparations also increased osteoclast formation from RAW 264.7 cells, but osteoblast differentiation in culture was inhibited and appeared to be dependent on Toll-like receptor 2 expression. These effects underscore the importance of P. endodontalis lipids in promoting inflammatory and bone cell activation processes that could lead to periapical pathology. Copyright © 2014 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  6. Goitrous hypothyroidism associated with treatment with trimethoprim-sulfamethoxazole in a young dog.

    PubMed

    Seelig, Davis M; Whittemore, Jacqueline C; Lappin, Michael R; Myers, Alan M; Avery, Paul R

    2008-04-15

    A 16-week-old female Boxer that had been treated for 5 weeks with trimethoprim-sulfamethoxazole and chloramphenicol because of aspiration pneumonia was evaluated for bilaterally symmetric masses in the subcutaneous tissues of the ventral neck, in the region of the larynx. Fine-needle aspirates were obtained from the neck masses; cytologic examination revealed well-differentiated thyroid epithelial tissue. A blood sample was collected for serum biochemical and thyroid function analyses. Mild hyperphosphatemia, severe hypercholesterolemia, mild hyperkalemia, and a mild increase in creatine kinase activity were identified. Serum concentration of total thyroxine was less than the lower reference limit, and that of thyroid-stimulating hormone was greater than the upper reference limit. Findings were consistent with a diagnosis of clinical hypothyroidism in a skeletally immature dog. Treatment with trimethoprim-sulfamethoxazole was discontinued. The dog was reevaluated 3 weeks later, at which time the neck masses were markedly decreased in size. Serum concentrations of cholesterol and potassium were lower; serum concentrations of total thyroxine and thyroid-stimulating hormone were near or within respective reference ranges. Age-appropriate increases in serum phosphorus concentration and serum alkaline phosphatase activity were also detected. To the authors' knowledge, this is the first report of antimicrobial-induced goiter in a dog. Cytologic examination of fine-needle aspirates and interpretation of data from serum biochemical and thyroid function analyses were needed to obtain a definitive diagnosis. Practitioners should include goiter among the differential diagnoses for ventral neck swellings in young dogs receiving potentiated sulfonamide antimicrobials.

  7. Specific activity and isotope abundances of strontium in purified strontium-82

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Fitzsimmons, J. M.; Medvedev, D. G.; Mausner, L. F.

    2015-11-12

    A linear accelerator was used to irradiate a rubidium chloride target with protons to produce strontium-82 (Sr-82), and the Sr-82 was purified by ion exchange chromatography. The amount of strontium associated with the purified Sr-82 was determined by either: ICP-OES or method B which consisted of a summation of strontium quantified by gamma spectroscopy and ICP-MS. The summation method agreed within 10% to the ICP-OES for the total mass of strontium and the subsequent specific activities were determined to be 0.25–0.52 TBq mg -1. Method B was used to determine the isotope abundances by weight% of the purified Sr-82, andmore » the abundances were: Sr-82 (10–20.7%), Sr-83 (0–0.05%), Sr-84 (35–48.5%), Sr-85 (16–25%), Sr-86 (12.5–23%), Sr-87 (0%), and Sr-88 (0–10%). The purified strontium contained mass amounts of Sr-82, Sr-84, Sr-85, Sr-86, and Sr-88 in abundances not associated with natural abundance, and 90% of the strontium was produced by the proton irradiation. A comparison of ICP-OES and method B for the analysis of Sr-82 indicated analysis by ICP-OES would be easier to determine total mass of strontium and comply with regulatory requirements. An ICP-OES analytical method for Sr-82 analysis was established and validated according to regulatory guidelines.« less

  8. Inhibition of adipose tissue PPARγ prevents increased adipocyte expansion after lipectomy and exacerbates a glucose-intolerant phenotype.

    PubMed

    Booth, A D; Magnuson, A M; Cox-York, K A; Wei, Y; Wang, D; Pagliassotti, M J; Foster, M T

    2017-04-01

    Adipose tissue plays a fundamental role in glucose homeostasis. For example, fat removal (lipectomy, LipX) in lean mice, resulting in a compensatory 50% increase in total fat mass, is associated with significant improvement in glucose tolerance. This study was designed to further examine the link between fat removal, adipose tissue compensation and glucose homeostasis using a peroxisome proliferator-activated receptor γ (PPAR γ; activator of adipogenesis) knockout mouse. The study involved PPARγ knockout (FKOγ) or control mice (CON), subdivided into groups that received LipX or Sham surgery. We reasoned that as the ability of adipose tissue to expand in response to LipX would be compromised in FKOγ mice, so would improvements in glucose homeostasis. In CON mice, LipX increased total adipose depot mass (~60%), adipocyte number (~45%) and changed adipocyte distribution to smaller cells. Glucose tolerance was improved (~30%) in LipX CON mice compared to Shams. In FKOγ mice, LipX did not result in any significant changes in adipose depot mass, adipocyte number or distribution. LipX FKOγ mice were also characterized by reduction of glucose tolerance (~30%) compared to shams. Inhibition of adipose tissue PPARγ prevented LipX-induced increases in adipocyte expansion and produced a glucose-intolerant phenotype. These data support the notion that adipose tissue expansion is critical to maintain and/or improvement in glucose homeostasis. © 2016 John Wiley & Sons Ltd.

  9. Screen time, cardiorespiratory fitness and adiposity among school-age children from Monteria, Colombia.

    PubMed

    Arango, Carlos M; Parra, Diana C; Gómez, Luis F; Lema, Lucía; Lobelo, Felipe; Ekelund, Ulf

    2014-09-01

    To explore the association between electronic media exposure (television viewing time, personal computer/video game use, total screen time), and waist circumference and body mass index, and study whether this association is independent of cardiorespiratory fitness, in a representative sample of adolescents from Montería, Colombia. Cross-sectional study analyzing data from 546 students aged 11-18 years, from fourteen randomly selected schools. Z-scores for WC and BMI were calculated. The physical activity module of the Global School Health Survey 2007 was used to determine EME, and the shuttle run test was used to assess CRF. Linear regression models adjusted by age, school location, physical activity level, type of institution (public or private), consumption of sweetened beverages, fast food, and fried food were used. Among boys, independently of cardiorespiratory fitness, high television viewing time (≥ 2 h/day) (β=+0.22; p<0.02), was positively associated with waist circumference. High total screen time (>3h/day) was positively associated with waist circumference (β=+0.34; p<0.01), and body mass index (β=+0.39; p<0.01). Among girls, sedentary behavior was not associated with adiposity, but cardiorespiratory fitness (β=-0.04; p<0.02) was negatively associated with body mass index. These findings support the evidence on the negative impact of excessive electronic media exposure and low cardiorespiratory fitness, and highlight the need for interventions and prevention strategies. Copyright © 2013 Sports Medicine Australia. All rights reserved.

  10. Using vadose zone data and spatial statistics to assess the impact of cultivated land and dairy waste lagoons on groundwater contamination

    NASA Astrophysics Data System (ADS)

    Baram, S.; Ronen, Z.; Kurtzman, D.; Peeters, A.; Dahan, O.

    2013-12-01

    Land cultivation and dairy waste lagoons are considered to be nonpoint and point sources of groundwater contamination by chloride (Cl-) and nitrate (NO3-). The objective of this work is to introduce a methodology to assess the past and future impacts of such agricultural activities on regional groundwater quality. The method is based on mass balances and on spatial statistical analysis of Cl- and NO3-concentration distributions in the saturated and unsaturated zones. The method enables quantitative analysis of the relation between the locations of pollution point sources and the spatial variability in Cl- and NO3- concentrations in groundwater. The method was applied to the Beer-Tuvia region, Israel, where intensive dairy farming along with land cultivation has been practiced for over 50 years above the local phreatic aquifer. Mass balance calculations accounted for the various groundwater recharge and abstraction sources and sinks in the entire region. The mass balances showed that leachates from lagoons and the cultivated land have contributed 6.0 and 89.4 % of the total mass of Cl- added to the aquifer and 12.6 and 77.4 % of the total mass of NO3-. The chemical composition of the aquifer and vadose zone water suggested that irrigated agricultural activity in the region is the main contributor of Cl- and NO3- to the groundwater. A low spatial correlation between the Cl- and NO3- concentrations in the groundwater and the on-land location of the dairy farms strengthened this assumption, despite the dairy waste lagoon being a point source for groundwater contamination by Cl- and NO3-. Results demonstrate that analyzing vadose zone and groundwater data by spatial statistical analysis methods can significantly contribute to the understanding of the relations between groundwater contaminating sources, and to assessing appropriate remediation steps.

  11. Physical Activity Producing Low, but Not Medium or Higher, Vertical Impacts Is Inversely Related to BMI in Older Adults: Findings From a Multicohort Study

    PubMed Central

    Elhakeem, Ahmed; Hannam, Kimberly; Deere, Kevin C; Hartley, April; Clark, Emma M; Moss, Charlotte; Edwards, Mark H; Dennison, Elaine; Gaysin, Tim; Kuh, Diana; Wong, Andrew; Cooper, Cyrus; Cooper, Rachel; Tobias, Jon H

    2018-01-01

    Abstract Background High impact physical activity (PA) is thought to improve skeletal health, but its relation to other health outcomes are unclear. We investigated associations between PA impact magnitude and body mass index (BMI) in older adults. Methods Data were taken from the Cohort for Skeletal Health in Bristol and Avon (COSHIBA), Hertfordshire Cohort Study, and MRC National Survey of Health and Development. Vertical acceleration peaks from 7-day hip-worn accelerometer recordings were used to classify PA as low (0.5 < g < 1.0g), medium (1 < g < 1.5g), or higher (≥1.5g) impact. Cohort-specific associations of low, medium, and higher impact PA with BMI were examined using linear regressions and estimates combined using random-effects meta-analysis. Results A total of 1182 participants (mean age = 72.7 years, 68% female) were included. Low, medium, and higher impact PA were inversely related to BMI in initial models. After adjustment for confounders and other impacts, low, but not medium or higher, impacts were inversely related to BMI (−0.31, p < .001: overall combined standard deviation change in BMI per doubling in the number of low impacts). In adjusted analyses of body composition measured by dual-energy X-ray absorptiometry in COSHIBA, low, but not medium or higher, impacts were inversely related to total body fat mass (−0.19, p < .001) and android:gynoid fat mass ratio (−0.16, p = .01), whereas high impact PA was weakly and positively associated with lean mass (0.05, p = .06). Conclusions Greater exposure to PA producing low magnitude vertical impacts was associated with lower BMI and fat mass at older age. Low impact PA may help reduce obesity risk in older adults. PMID:29028919

  12. Three-Compartment Body Composition in Academy and Senior Rugby League Players.

    PubMed

    Till, Kevin; Jones, Ben; O'Hara, John; Barlow, Matthew; Brightmore, Amy; Lees, Matthew; Hind, Karen

    2016-03-01

    To compare the body size and 3-compartment body composition between academy and senior professional rugby league players using dual-energy X-ray absorptiometry (DXA). Academy (age 18.1 ± 1.1 y, n = 34) and senior (age 26.2 ± 4.6 y, n = 63) rugby league players received 1 total-body DXA scan. Height, body mass, and body-fat percentage alongside total and regional fat mass, lean mass, and bone mineral content (BMC) were compared. Independent t tests with Cohen d effect sizes and multivariate analysis of covariance (MANCOVA), controlling for height and body mass, with partial eta-squared (η2) effect sizes, were used to compare total and regional body composition. Senior players were taller (183.2 ± 5.8 vs 179.2 ± 5.7 cm, P = .001, d = 0.70) and heavier (96.5 ± 9.3 vs 86.5 ± 9.0 kg, P < .001, d = 1.09) with lower body-fat percentage (16.3 ± 3.7 vs 18.0 ± 3.7%, P = .032, d = 0.46) than academy players. MANCOVA identified significant overall main effects for total and regional body composition between academy and senior players. Senior players had lower total fat mass (P < .001, η2 = 0.15), greater total lean mass (P < .001, η2 = 0.14), and greater total BMC (P = .001, η2 = 0.12) than academy players. For regional sites, academy players had significantly greater fat mass at the legs (P < .001, η2 = 0.29) than senior players. The lower age, height, body mass, and BMC of academy players suggest that these players are still developing musculoskeletal characteristics. Gradual increases in lean mass and BMC while controlling fat mass is an important consideration for practitioners working with academy rugby league players, especially in the lower body.

  13. Relationship between body composition and vertical ground reaction forces in obese children when walking.

    PubMed

    Villarrasa-Sapiña, Israel; Serra-Añó, Pilar; Pardo-Ibáñez, Alberto; Gonzalez, Luis-Millán; García-Massó, Xavier

    2017-01-01

    Obesity is now a serious worldwide challenge, especially in children. This condition can cause a number of different health problems, including musculoskeletal disorders, some of which are due to mechanical stress caused by excess body weight. The aim of this study was to determine the association between body composition and the vertical ground reaction force produced during walking in obese children. Sixteen children participated in the study, six females and ten males [11.5 (1.2) years old, 69.8 (15.5) kg, 1.56 (0.09) m, and 28.36 (3.74) kg/m 2 of body mass index (BMI)]. Total weight, lean mass and fat mass were measured by dual-energy X-ray absorptiometry and vertical forces while walking were obtained by a force platform. The vertical force variables analysed were impact and propulsive forces, and the rate of development of both. Multiple regression models for each vertical force parameter were calculated using the body composition variables as input. The impact force regression model was found to be positively related to the weight of obese children and negatively related to lean mass. The regression model showed lean mass was positively related to the propulsive rate. Finally, regression models for impact and propulsive force showed a direct relationship with body weight. Impact force is positively related to the weight of obese children, but lean mass helps to reduce the impact force in this population. Exercise could help obese persons to reduce their total body weight and increase their lean mass, thus reducing impact forces during sports and other activities. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Physical activity, nutritional status, and dietary habits of students of a medical university.

    PubMed

    Grygiel-Górniak, Bogna; Tomczak, Andrzej; Krulikowska, Natalia; Przysławski, Juliusz; Seraszek-Jaros, Agnieszka; Kaczmarek, Elżbieta

    Nutritional habits and physical activity influence the health status of young adults. In this study, we engaged a group of 151 students from a medical university (90 female and 61 male subjects). Anthropometric parameters, dietary habits (a 7-day dietary recall), and level of physical activity were measured. It was found that the daily food rations of female (F) and male (M) students were improperly balanced and characterized by high amount of total and animal protein, phosphorus, vitamin A, cholesterol, and insufficient intake of carbohydrates, dietary fiber, and vitamin C. Female subjects consumed low amounts of total fat and calcium. The intake of protein (total and animal), fat, phosphorus, and cholesterol correlated with higher body mass. The physical activity of the students was found to be higher than the average physical activity of the European Union populations, and a general tendency of lowering level of physical activity with age was observed. Students with the highest level of physical activity (MET > 1500) consumed lower amounts of simple carbohydrates (galactose and saccharose) when compared to students with lower physical activity (MET < 600, p  < 0.05). Therefore, this study concluded that the dietary habits should be modified to prevent the development of diet-dependent diseases. Various forms of physical activity should be proposed to students and they should be encouraged to participate in high level of physical activity so as to promote good health status.

  15. Antioxidative and in vitro antiproliferative activity of Arctium lappa root extracts

    PubMed Central

    2011-01-01

    Background Arctium lappa, known as burdock, is widely used in popular medicine for hypertension, gout, hepatitis and other inflammatory disorders. Pharmacological studies indicated that burdock roots have hepatoprotective, anti-inflammatory, free radical scavenging and antiproliferative activities. The aim of this study was to evaluate total phenolic content, radical scavenging activity by DPPH and in vitro antiproliferative activity of different A. lappa root extracts. Methods Hot and room temperature dichloromethanic, ethanolic and aqueous extracts; hydroethanolic and total aqueous extract of A. lappa roots were investigated regarding radical scavenging activity by DPPH, total phenolic content by Folin-Ciocalteau method and antiproliferative in vitro activity was evaluated in human cancer cell lines. The hydroethanolic extract analyzed by high-resolution electrospray ionization mass spectroscopy. Results Higher radical scavenging activity was found for the hydroethanolic extract. The higher phenolic contents were found for the dichloromethane, obtained both by Soxhlet and maceration extraction and hydroethanolic extracts. The HRESI-MS demonstrated the presence of arctigenin, quercetin, chlorogenic acid and caffeic acid compounds, which were identified by comparison with previous data. The dichloromethane extracts were the only extracts that exhibited activity against cancer cell lines, especially for K562, MCF-7 and 786-0 cell lines. Conclusions The hydroethanolic extracts exhibited the strongest free radical scavenging activity, while the highest phenolic content was observed in Soxhlet extraction. Moreover, the dichloromethanic extracts showed selective antiproliferative activity against K562, MCF-7 and 786-0 human cancer cell lines. PMID:21429215

  16. Antioxidative and in vitro antiproliferative activity of Arctium lappa root extracts.

    PubMed

    Predes, Fabricia S; Ruiz, Ana L T G; Carvalho, João E; Foglio, Mary A; Dolder, Heidi

    2011-03-23

    Arctium lappa, known as burdock, is widely used in popular medicine for hypertension, gout, hepatitis and other inflammatory disorders. Pharmacological studies indicated that burdock roots have hepatoprotective, anti-inflammatory, free radical scavenging and antiproliferative activities. The aim of this study was to evaluate total phenolic content, radical scavenging activity by DPPH and in vitro antiproliferative activity of different A. lappa root extracts. Hot and room temperature dichloromethanic, ethanolic and aqueous extracts; hydroethanolic and total aqueous extract of A. lappa roots were investigated regarding radical scavenging activity by DPPH, total phenolic content by Folin-Ciocalteau method and antiproliferative in vitro activity was evaluated in human cancer cell lines. The hydroethanolic extract analyzed by high-resolution electrospray ionization mass spectroscopy. Higher radical scavenging activity was found for the hydroethanolic extract. The higher phenolic contents were found for the dichloromethane, obtained both by Soxhlet and maceration extraction and hydroethanolic extracts. The HRESI-MS demonstrated the presence of arctigenin, quercetin, chlorogenic acid and caffeic acid compounds, which were identified by comparison with previous data. The dichloromethane extracts were the only extracts that exhibited activity against cancer cell lines, especially for K562, MCF-7 and 786-0 cell lines. The hydroethanolic extracts exhibited the strongest free radical scavenging activity, while the highest phenolic content was observed in Soxhlet extraction. Moreover, the dichloromethanic extracts showed selective antiproliferative activity against K562, MCF-7 and 786-0 human cancer cell lines. © 2011 Predes et al; licensee BioMed Central Ltd.

  17. International perspectives on the physical inactivity crisis--structural solutions over evidence generation?

    PubMed

    Bauman, Adrian; Finegood, Diane T; Matsudo, Victor

    2009-10-01

    Many programs to increase physical activity have been evaluated in developed countries, where 'leisure time physical activity' is the most frequent domain for interventions. In developing countries, and also with reference to global obesity prevention, different kinds of interventions targeting 'total physical activity' are needed. This requires efforts across agencies and sectors, and in the domains of work, active transport, reduced sitting time, as well as leisure time physical activity promotion. In considering possible solutions, this commentary examined the use of complex systems, where integrated efforts across sectors and agencies might, in combination, contribute to increasing total physical activity. The key sets of actions required globally to increase physical activity were, in our opinion, [i] efforts to disseminate individual-level behavior change programs to reach much larger populations rather than volunteers, [ii] social marketing and mass communication campaigns to change social norms in the community and among professionals and policymakers, [iii] efforts to influence the social and physical environment to make them more conducive to physical activity, and [iv] the development and implementation of national physical activity plans and strategies, with sufficient timelines and resources to achieve measurable change.

  18. Invited article: Time accurate mass flow measurements of solid-fueled systems.

    PubMed

    Olliges, Jordan D; Lilly, Taylor C; Joslyn, Thomas B; Ketsdever, Andrew D

    2008-10-01

    A novel diagnostic method is described that utilizes a thrust stand mass balance (TSMB) to directly measure time-accurate mass flow from a solid-fuel thruster. The accuracy of the TSMB mass flow measurement technique was demonstrated in three ways including the use of an idealized numerical simulation, verifying a fluid mass calibration with high-speed digital photography, and by measuring mass loss in more than 30 hybrid rocket motor firings. Dynamic response of the mass balance was assessed through weight calibration and used to derive spring, damping, and mass moment of inertia coefficients for the TSMB. These dynamic coefficients were used to determine the mass flow rate and total mass loss within an acrylic and gaseous oxygen hybrid rocket motor firing. Intentional variations in the oxygen flow rate resulted in corresponding variations in the total propellant mass flow as expected. The TSMB was optimized to determine mass losses of up to 2.5 g and measured total mass loss to within 2.5% of that calculated by a NIST-calibrated digital scale. Using this method, a mass flow resolution of 0.0011 g/s or 2% of the average mass flow in this study has been achieved.

  19. Invited Article: Time accurate mass flow measurements of solid-fueled systems

    NASA Astrophysics Data System (ADS)

    Olliges, Jordan D.; Lilly, Taylor C.; Joslyn, Thomas B.; Ketsdever, Andrew D.

    2008-10-01

    A novel diagnostic method is described that utilizes a thrust stand mass balance (TSMB) to directly measure time-accurate mass flow from a solid-fuel thruster. The accuracy of the TSMB mass flow measurement technique was demonstrated in three ways including the use of an idealized numerical simulation, verifying a fluid mass calibration with high-speed digital photography, and by measuring mass loss in more than 30 hybrid rocket motor firings. Dynamic response of the mass balance was assessed through weight calibration and used to derive spring, damping, and mass moment of inertia coefficients for the TSMB. These dynamic coefficients were used to determine the mass flow rate and total mass loss within an acrylic and gaseous oxygen hybrid rocket motor firing. Intentional variations in the oxygen flow rate resulted in corresponding variations in the total propellant mass flow as expected. The TSMB was optimized to determine mass losses of up to 2.5 g and measured total mass loss to within 2.5% of that calculated by a NIST-calibrated digital scale. Using this method, a mass flow resolution of 0.0011 g/s or 2% of the average mass flow in this study has been achieved.

  20. Determination of the polyphenolic content of a Capsicum annuum L. extract by liquid chromatography coupled to photodiode array and mass spectrometry detection and evaluation of its biological activity.

    PubMed

    Mokhtar, Meriem; Soukup, Jan; Donato, Paola; Cacciola, Francesco; Dugo, Paola; Riazi, Ali; Jandera, Pavel; Mondello, Luigi

    2015-01-01

    The present study was aimed to investigate the polyphenolic profile of a pepper (Capsicum annuum L.) extract from Algeria and evaluate its biological activity. The total polyphenol content of the extract was determined as 1.373 mg of gallic acid equivalents (±0.0046), whereas the flavonoids were determined as 0.098 mg of quercetin (±0.0015). The determination of the complete polyphenolic profile of the extract was achieved by liquid chromatography with an RP-amide column in combination with photodiode array and mass spectrometry detection through an electrospray ionization interface. A total of 18 compounds were identified, of which five were reported for the first time in the sample tested. Quercetin rhamnoside was the most abundant compound (82.6 μg/g of fresh pepper) followed by quercetin glucoside (19.86 μg/g). The antioxidant activity and antimicrobial effects were also determined. For the antimicrobial tests assessed against Gram-positive and Gram-negative bacteria, kaempferol showed the strongest inhibitory effect followed by quercetin and caffeic acids. In the study of the cytotoxicity of the extract, the cancer cells (U937) were more affected than the normal cells (peripheral blood mononucleated cells), with more than 62% inhibition at the highest concentration. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Physical Activity Energy Expenditure and Sarcopenia in Black South African Urban Women.

    PubMed

    Kruger, Herculina S; Havemann-Nel, Lize; Ravyse, Chrisna; Moss, Sarah J; Tieland, Michael

    2016-03-01

    Black women are believed to be genetically less predisposed to age-related sarcopenia. The objective of this study was to investigate lifestyle factors associated with sarcopenia in black South African (SA) urban women. In a cross-sectional study, 247 women (mean age 57 y) were randomly selected. Anthropometric and sociodemographic variables, dietary intakes, and physical activity were measured. Activity was also measured by combined accelerometery/heart rate monitoring (ActiHeart), and HIV status was tested. Dual energy x-ray absorptiometry was used to measure appendicular skeletal mass (ASM). Sarcopenia was defined according to a recently derived SA cutpoint of ASM index (ASM/height squared) < 4.94 kg/m(2). In total, 8.9% of the women were sarcopenic, decreasing to 8.1% after exclusion of participants who were HIV positive. In multiple regressions with ASM index, grip strength, and gait speed, respectively, as dependent variables, only activity energy expenditure (β = .27) was significantly associated with ASM index. Age (β = -.50) and activity energy expenditure (β = .17) were significantly associated with gait speed. Age (β = -.11) and lean mass (β = .21) were significantly associated with handgrip strength. Sarcopenia was prevalent among these SA women and was associated with low physical activity energy expenditure.

  2. Correlates of physical fitness and activity in Taiwanese children

    PubMed Central

    Chen, J.-L.; Unnithan, V.; Kennedy, C.; Yeh, C.-H.

    2010-01-01

    Aim This cross-sectional study examined factors related to children’s physical fitness and activity levels in Taiwan. Methods A total of 331 Taiwanese children, aged 7 and 8, and their mothers participated in the study. Children performed physical fitness tests, recorded their physical activities during two weekdays and completed self-esteem questionnaires. Research assistants measured the children’s body mass and stature. Mothers completed demographic, parenting style and physical activity questionnaires. Results Attending urban school, lower body mass index (BMI), older age and better muscular endurance contributed to the variance in better aerobic capacity, and attending rural school and better aerobic capacity contributed to the variance in better muscular endurance in boys. Attending urban school, lower BMI and better athletic competence contributed to the variance in better aerobic capacity, and younger age, rural school and higher household income contributed to the variance in better flexibility in girls. Conclusion Despite the limitations of the study, with many countries and regions, including Taiwan, now emphasizing the importance of improving physical fitness and activity in children, an intervention that is gender-, geographically, and developmentally appropriate can improve the likelihood of successful physical fitness and activity programmes. PMID:18275540

  3. Cytotoxic and apoptotic activities of black widow spiderling extract against HeLa cells

    PubMed Central

    Peng, Xiaozhen; Dai, Zhipan; Lei, Qian; Liang, Long; Yan, Shuai; Wang, Xianchun

    2017-01-01

    Black widow spiders contain toxic components not only in the venom glands but also in other parts of the spider body, including the legs and abdomen. Additionally, both the eggs and newborn spiderlings of the black widow spider contain venom. It is important to investigate their potential effects on cancer cells. In the present study, the effects of newborn black widow spiderling extract on human HeLa cells were evaluated in vitro. When applied at different concentrations, the total extract decreased HeLa cell viability in a dose-dependent manner, with an IC50 value of 158 µg/ml. Flow cytometry indicated that treatment of HeLa cells with the total extract of the spiderlings induced apoptosis in HeLa cells in a dose-dependent manner and led to cell cycle arrest in the S-phase. Additionally, application of the total extract at different concentrations increased apoptosis-related caspase 3 activity in a dose-dependent manner. HeLa cells treated with the total extract appeared to be morphologically changed, exhibiting membrane blebbing, nuclear fragmentation and condensation of chromatin. Further separation and activity screening demonstrated that the cytotoxic and apoptotic activities of the total extract were attributable mainly to its high molecular mass proteins, one of which was purified and characterized to determine its anti-tumor activities on HeLa cells. The results of the present study therefore have expanded understanding regarding the effect of spider toxins on cancer cells and suggested that components of black widow spiderlings may be developed as a promising novel agent to treat cancer. PMID:28587399

  4. Cytotoxic and apoptotic activities of black widow spiderling extract against HeLa cells.

    PubMed

    Peng, Xiaozhen; Dai, Zhipan; Lei, Qian; Liang, Long; Yan, Shuai; Wang, Xianchun

    2017-06-01

    Black widow spiders contain toxic components not only in the venom glands but also in other parts of the spider body, including the legs and abdomen. Additionally, both the eggs and newborn spiderlings of the black widow spider contain venom. It is important to investigate their potential effects on cancer cells. In the present study, the effects of newborn black widow spiderling extract on human HeLa cells were evaluated in vitro . When applied at different concentrations, the total extract decreased HeLa cell viability in a dose-dependent manner, with an IC 50 value of 158 µg/ml. Flow cytometry indicated that treatment of HeLa cells with the total extract of the spiderlings induced apoptosis in HeLa cells in a dose-dependent manner and led to cell cycle arrest in the S-phase. Additionally, application of the total extract at different concentrations increased apoptosis-related caspase 3 activity in a dose-dependent manner. HeLa cells treated with the total extract appeared to be morphologically changed, exhibiting membrane blebbing, nuclear fragmentation and condensation of chromatin. Further separation and activity screening demonstrated that the cytotoxic and apoptotic activities of the total extract were attributable mainly to its high molecular mass proteins, one of which was purified and characterized to determine its anti-tumor activities on HeLa cells. The results of the present study therefore have expanded understanding regarding the effect of spider toxins on cancer cells and suggested that components of black widow spiderlings may be developed as a promising novel agent to treat cancer.

  5. 40 CFR 63.7941 - How do I conduct a performance test, design evaluation, or other type of initial compliance...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... vent; Ei, Eo = Mass rate of total organic compounds (TOC) (minus methane and ethane) or total HAP, from... reduction for all affected process vents, percent Ei = Mass rate of TOC (minus methane and ethane) or total... uncontrolled vents, as calculated in this section, kilograms TOC per hour or kilograms HAP per hour; Eo = Mass...

  6. The relations between sleep, time of physical activity, and time outdoors among adult women

    PubMed Central

    Godbole, Suneeta; Natarajan, Loki; Full, Kelsie; Hipp, J. Aaron; Glanz, Karen; Mitchell, Jonathan; Laden, Francine; James, Peter; Quante, Mirja; Kerr, Jacqueline

    2017-01-01

    Physical activity and time spent outdoors may be important non-pharmacological approaches to improve sleep quality and duration (or sleep patterns) but there is little empirical research evaluating the two simultaneously. The current study assesses the role of physical activity and time outdoors in predicting sleep health by using objective measurement of the three variables. A convenience sample of 360 adult women (mean age = 55.38 ±9.89 years; mean body mass index = 27.74 ±6.12) was recruited from different regions of the U.S. Participants wore a Global Positioning System device and ActiGraph GT3X+ accelerometers on the hip for 7 days and on the wrist for 7 days and 7 nights to assess total time and time of day spent outdoors, total minutes in moderate-to-vigorous physical activity per day, and 4 measures of sleep health, respectively. A generalized mixed-effects model was used to assess temporal associations between moderate-to-vigorous physical activity, outdoor time, and sleep at the daily level (days = 1931) within individuals. There was a significant interaction (p = 0.04) between moderate-to-vigorous physical activity and time spent outdoors in predicting total sleep time but not for predicting sleep efficiency. Increasing time outdoors in the afternoon (versus morning) predicted lower sleep efficiency, but had no effect on total sleep time. Time spent outdoors and the time of day spent outdoors may be important moderators in assessing the relation between physical activity and sleep. More research is needed in larger populations using experimental designs. PMID:28877192

  7. The relations between sleep, time of physical activity, and time outdoors among adult women.

    PubMed

    Murray, Kate; Godbole, Suneeta; Natarajan, Loki; Full, Kelsie; Hipp, J Aaron; Glanz, Karen; Mitchell, Jonathan; Laden, Francine; James, Peter; Quante, Mirja; Kerr, Jacqueline

    2017-01-01

    Physical activity and time spent outdoors may be important non-pharmacological approaches to improve sleep quality and duration (or sleep patterns) but there is little empirical research evaluating the two simultaneously. The current study assesses the role of physical activity and time outdoors in predicting sleep health by using objective measurement of the three variables. A convenience sample of 360 adult women (mean age = 55.38 ±9.89 years; mean body mass index = 27.74 ±6.12) was recruited from different regions of the U.S. Participants wore a Global Positioning System device and ActiGraph GT3X+ accelerometers on the hip for 7 days and on the wrist for 7 days and 7 nights to assess total time and time of day spent outdoors, total minutes in moderate-to-vigorous physical activity per day, and 4 measures of sleep health, respectively. A generalized mixed-effects model was used to assess temporal associations between moderate-to-vigorous physical activity, outdoor time, and sleep at the daily level (days = 1931) within individuals. There was a significant interaction (p = 0.04) between moderate-to-vigorous physical activity and time spent outdoors in predicting total sleep time but not for predicting sleep efficiency. Increasing time outdoors in the afternoon (versus morning) predicted lower sleep efficiency, but had no effect on total sleep time. Time spent outdoors and the time of day spent outdoors may be important moderators in assessing the relation between physical activity and sleep. More research is needed in larger populations using experimental designs.

  8. Size-resolved measurements of mixing state and cloud-nucleating ability of aerosols in Nanjing, China

    NASA Astrophysics Data System (ADS)

    Ma, Yan; Li, Shizheng; Zheng, Jun; Khalizov, Alexei; Wang, Xing; Wang, Zhen; Zhou, Yaoyao

    2017-09-01

    An integrated aerosol analytical system was deployed in Nanjing, a megacity in the Yangtze River Delta, to measure size-resolved aerosol mixing states, effective densities, cloud condensation nucleus (CCN) activities, and chemical composition in August 2013. It was found that aerosols were predominantly internally mixed. The average effective densities were 1.38 ± 0.09, 1.48 ± 0.08, and 1.53 ± 0.07 g cm-3 for 50, 80, and 120 nm particles, respectively. Although black carbon (BC) represented only 0.3%, 1.6%, and 3.3% of the particle mass, on average, it was present in 7%, 38%, and 47% of the total particle number concentration at 50, 80, and 120 nm, respectively, indicating that BC particles may contribute significantly to the total atmospheric aerosol population. Externally mixed BC was only occasionally observed with an effective density of 0.67-0.97 g cm-3. Aerosols sampled generally exhibited a relatively high CCN activity and hygroscopicity (κ = 0.35 ± 0.13). Both newly formed particles and freshly emitted BC particles were observed to age rapidly from photochemical processes, with a significant enhancement in the particle CCN activity and an increase in the effective density. Aerosols influenced by four different air masses presented similar CCN activation, indicating that CCN activation would be primarily dependent on the particle size rather than the particle origin (and hence original composition). Our results suggest that under highly active photochemical conditions as encountered in this study, particles from both local sources and regional transport can be rapidly converted into efficient CCN by photochemical aging, thereby making important contributions to the atmospheric CCN budget and exerting profound implications on aerosol indirect climate forcing.

  9. The total rate of mass return to the interstellar medium from red giants and planetary nebulae

    NASA Technical Reports Server (NTRS)

    Knapp, G. R.; Rauch, K. P.; Wilcots, E. M.

    1990-01-01

    High luminosity post main sequence stars are observed to be losing mass in large amounts into the interstellar medium. The various methods used to estimate individual and total mass loss rates are summarized. Current estimates give MT 0.3 - 0.6 solar mass per year for the whole Galaxy.

  10. Autonomous motivation and quality of life as predictors of physical activity in patients with schizophrenia.

    PubMed

    Costa, Raquel; Bastos, Tânia; Probst, Michel; Seabra, André; Vilhena, Estela; Corredeira, Rui

    2018-02-08

    Being physically active is a complex behaviour in patients with schizophrenia. Several factors were identified as barriers to achieving active behaviours in this population. Therefore, the purpose of this study was to investigate among a number of barriers what predicts the most on physical activity (PA) in patients with schizophrenia. A total of 114 patients (28♀) with schizophrenia were included. Body mass index (BMI) was calculated. Autonomous and controlled motivation (Behavioural Regulation in Exercise Questionnaire - 3), self-esteem (Rosenberg Self-esteem scale), quality of life (World Health Organization Quality of Life Scale - Brief version) and functional exercise capacity (6-minute walk test - 6MWT) were evaluated. Multiple Regression Analysis was applied to assess the effect of these variables on Total PA per week (International Physical Activity Questionnaire - short version). Autonomous motivation and domains of quality of life were positively correlated with Total PA per week. Stepwise multiple regression analyses showed that of all the candidate factors to predict PA, autonomous motivation and global domain of quality of life were found as significant predictors. Our findings help to understand the importance of autonomous motivation and quality of life for PA in patients with schizophrenia. Knowledge about these predictors may provide guidance to improve PA behaviour in this population.

  11. Factors influencing dust exposure: finishing activities in drywall construction.

    PubMed

    Simmons, Catherine E; Jones, Rachael M; Boelter, Fred W

    2011-05-01

    Sanding drywall joint compound is a dusty construction activity. We studied potential factors influencing exposure to respirable and total dust for sanders and bystanders in the area of drywall joint compound finishing in 17 test events within a room-scale isolation chamber. We found the air change rate to be negatively correlated with dust C(twa) both in the sander's personal breathing zone and surrounding area. We could not conclude that sanding tool type systematically influences dust C(twa), but the use of 80-grit abrasive was associated with the highest dust C(twa). We found respirable dusts were uniformly dispersed 1-8.2 m from sanding activities at a fixed location. As anticipated, both respirable and total dust C(twa) in the sander's personal breathing zone are higher than in the surrounding area. The respirable fraction of the total dust mass C(twa) was greater in the surrounding area than in the sander's personal breathing zone. Respirable dust concentrations measured in real time increased over the duration of sanding, exhibiting a temporal trend that is similar to that predicted by the well-mixed box model with contaminant removal by mechanical ventilation only, and continuous emission. Dust concentrations returned to pre-activity (background) levels 2-4 hr after cessation of the sanding activity.

  12. Ideal cardiovascular health and its association with sedentary behaviour and fitness in psychiatric patients. The PsychiActive project.

    PubMed

    Bueno-Antequera, J; Oviedo-Caro, M Á; Munguía-Izquierdo, D

    2018-06-10

    Ideal cardiovascular health (CVH) was defined as meeting ideal levels of 4 health behaviours (smoking, body mass index, physical activity, and diet) and 3 biological factors (blood pressure, total cholesterol, and glucose) and is inversely related to cardiovascular disease and mortality. However, the prevalence of ideal CVH in patients with severe mental illness and the possible independent associations of sedentary behaviour and fitness with CVH score are unexplored. This study included 142 (34 women) outpatients with severe mental illness (primarily schizophrenia, n = 92). CVH was evaluated according to the American Heart Association guidelines. Sedentary behaviour, cardiorespiratory fitness, and muscular strength were measured by an activity-monitor, the 6-min walk test, and handgrip dynamometry. Cardiorespiratory fitness and strength values were combined in a composite fitness score. The prevalence of ideal CVH was: non-smoking (47.9%), body mass index (16.9), physical activity (83.1%), diet (10.4%), blood pressure (40.4%), total cholesterol (62.9%), and plasma glucose (66.7%). Low levels of sedentary behaviour and high cardiorespiratory, strength, and composite fitness score were associated with meeting the ideal threshold in most CVH metrics and having higher global CVH score; however, only cardiorespiratory and composite fitness score remained significantly related to global CVH score independent of sedentary behaviour and multiple confounders. Patients with severe mental illness generally have low prevalence of ideal CVH metrics, especially diet and body mass index. Additionally, our findings suggest the need or considering cardiorespiratory fitness, regardless of sedentary behaviour, to promote ideal CVH in this population. Copyright © 2018 The Italian Society of Diabetology, the Italian Society for the Study of Atherosclerosis, the Italian Society of Human Nutrition, and the Department of Clinical Medicine and Surgery, Federico II University. Published by Elsevier B.V. All rights reserved.

  13. Variations in thermospheric composition: A model based on mass-spectrometer and satellite-drag data

    NASA Technical Reports Server (NTRS)

    Jacchia, L. G.

    1973-01-01

    The seasonal-latitudinal and the diurnal variations of composition observed by mass spectrometers on the OGO 6 satellite are represented by two simple empirical formulae, each of which uses only one numerical parameter. The formulae are of a very general nature and predict the behavior of these variations at all heights and for all levels of solar activity; they yield a satisfactory representation of the corresponding variations in total density as derived from satellite drag. It is suggested that a seasonal variation of hydrogen might explain the abnormally low hydrogen densities at high northern latitudes in July 1964.

  14. Acoustic emission of rock mass under the constant-rate fluid injection

    NASA Astrophysics Data System (ADS)

    Shadrin Klishin, AV, VI

    2018-03-01

    The authors study acoustic emission in coal bed and difficult-to-cave roof under injection of fluid by pumps at a constant rate. The functional connection between the roof hydrofracture length and the total number of AE pulses is validated, it is also found that the coal bed hydroloosening time, injection rate and time behavior of acoustic emission activity depend on the fluid injection volume required until the fluid breakout in a roadway through growing fractures. In the formulas offered for the practical application, integral parameters that characterize permeability and porosity of rock mass and process parameters of the technology are found during test injection.

  15. Body composition is associated with physical activity in daily life as measured using a triaxial accelerometer in both men and women.

    PubMed

    den Hoed, M; Westerterp, K R

    2008-08-01

    Activity-related energy expenditure is the most variable component of total energy expenditure and thus an important determinant of energy balance. To determine whether body composition is related to physical activity in both men and women. A total of 134 healthy participants were recruited (80 women, 54 men; aged 21+/-2 years; body mass index, 22.0+/-2.4). Physical activity was measured for a period of 2 weeks using a triaxial accelerometer for movement registration (Tracmor). Percentage body fat (%BF) was determined by underwater weighing and deuterium dilution according to Siri's three-compartment model. The participant characteristics-body mass, height and gender together explained a substantial part of the variation in %BF (R(2)=0.75, SEE=4.0%). Adding physical activity to the model increased the explained variation in %BF with 4% (R(2)=0.79, SEE=3.7%, P<0.001). Taking seasonality into account by adding the number of daylight hours as an independent variable further increased the explained variation with 1% (R(2)=0.80, SEE=3.7%, P<0.05). In analogy, the association was evaluated for both genders separately. In women, %BF and physical activity were significantly associated (P<0.001). In men, %BF was only associated with physical activity when seasonality was taken into account as well (P<0.05). This probably resulted from men participating more in season bound sports, because an association was found without adjusting for seasonality when only men with a consistent year-round participation in sports were considered. Evidence was found for an association between body composition and physical activity in both genders. A consistent year-round degree of physical activity appears to be a prerequisite to reveal the association. Moreover, Tracmor-assessed physical activity improves the estimate of %BF when a participant's characteristics are taken into account.

  16. A combined A431 cell membrane chromatography and online high performance liquid chromatography/mass spectrometry method for screening compounds from total alkaloid of Radix Caulophylli acting on the human EGFR.

    PubMed

    Sun, Meng; Ren, Jing; Du, Hui; Zhang, Yanmin; Zhang, Jie; Wang, Sicen; He, Langchong

    2010-10-15

    We have developed an online analytical method that combines A431 cell membrane chromatography (A431/CMC) with high performance liquid chromatography and mass spectrometry (LC/MS) for identifying active components from Radix Caulophylli acting on human EGFR. Retention fractions on A431/CMC model were captured onto an enrichment column and the components were directly analyzed by combining a 10-port column switcher with an LC/MS system for separation and preliminary identification. Using Sorafenib tosylate as a positive control, taspine and caulophine from Radix Caulophylli were identified as the active molecules which could act on the EGFR. This A431/CMC-online-LC/MS method can be applied for screening active components acting on EGFR from traditional Chinese medicines exemplified by Radix Caulophylli and will be of great utility in drug discovery using natural medicinal herbs as a source of novel compounds. Copyright © 2010 Elsevier B.V. All rights reserved.

  17. Long-term effect of exercise on bone mineral density and body composition in post-menopausal ex-elite athletes: a retrospective study.

    PubMed

    Andreoli, A; Celi, M; Volpe, S L; Sorge, R; Tarantino, U

    2012-01-01

    The aim of this retrospective study was to determine the long-term effect of exercise on bone mineral density (BMD), bone mineral content (BMC) and body composition (BC) in post-menopausal women who were elite athletes during their youth compared with sedentary controls. It is a retrospective study and carried out in an outpatient clinic. A total of 48 post-menopausal women (54-73 years of age) were enrolled. Ex-elite athletes with long-term (>20 years) histories of significant training and performance were divided into two groups: weight-bearing sports (runners, n=12) and non-weight-bearing sports (swimmers, n=12). The athletes were age matched with sedentary controls (n=24). BMD, BMC and BC were measured using dual-energy X-ray absorptiometry. Healthcare and sport activity histories were evaluated using a questionnaire. No significant differences were found with regard to body weight, height, body mass index and hours of activity between the two groups of athletes. There were no significant differences in activity levels between athletes and controls at the time of this study. BMD and BMC were not significantly different between athletes; they were significantly higher in athletes than in controls (P<0.001). Although the ex-athletes did not significantly differ in BC, left and right lean arm mass and arm BMD were significantly higher in swimmers than in runners (P<0.0001). The high level of physical activity observed in female athletes is associated with improved muscle mass, BMD and BMC, and physical activity during youth seems to have a beneficial effect on bone mass and helps to prevent bone loss due to aging.

  18. Measures of physical activity and their correlates: the Swedish National March Cohort.

    PubMed

    Lagerros, Ylva Trolle; Bellocco, Rino; Adami, Hans-Olov; Nyrén, Olof

    2009-01-01

    We compared the results of self-estimates of physical activity obtained with a novel instrument (the Energy Expenditure Questionnaire, EEQ) to those obtained from questions typically asked in epidemiological investigations (reference method) in a cohort of 42,150 Swedish men and women, aged 18-94. In the EEQ, participants were asked to report total physical activity by estimating the total time during a typical day and night spent on different physical activity intensity levels from the lowest (corresponding to lying in bed, 0.9 Metabolic Energy Turnover; MET) to the highest, (exceeding the intensity of to shovelling snow by hand, i.e., >6 MET). As a comparison, they also estimated hours per week devoted to household chores, commuting and leisure time physical activities classified as; light, moderate and heavy. The average physical activity estimated with the EEQ was 1.36 MET or 32.6 METh/day or 2,341 kcal/day. In comparison, physical activity estimated with the reference method represented no more than 17% of this amount. The Spearman's correlation coefficient between the two measures was 0.26. Using EEQ, men reported significantly more physical activity than women (mean = 36.3 vs. 30.6 METh/day). Body mass index (BMI) > or = 25, education > or = 12 years, and age > or = 60 years were significantly associated with lower physical activity. Questions focusing on leisure time exercise and a few other selected activities provide estimates of activity that correlate poorly with self-reported total energy output from all physical activity and inactivity. Investigators need to be more explicit about which component of activity they investigate.

  19. Vertical and lateral distribution of fallout 137Cs and soil properties along representative toposequences of central Rif, Morocco.

    PubMed

    Mesrar, Haytam; Sadiki, Abdelhamid; Faleh, Ali; Quijano, Laura; Gaspar, Leticia; Navas, Ana

    2017-04-01

    The purpose of this study is to understand and quantify the relationships between current 137 Cs inventories and the soil properties and the physiographic characteristics. A total of 36 cores were taken in seven transects with different slopes, lithology and land use. The analysis focused on the 137 Cs mass activity as well as inventories and its relationship with soil properties as grain size and organic matter. The mass activity of 137 Cs and the inventories varied between 3.6 and 63.7 Bq kg -1 and between 521.7 and 3304.4 Bq m -2 , respectively. At uncultivated soils, high concentrations of 137 Cs are located in the top 10 cm and decreased exponentially in depth. Cultivated soils record disturbed and heterogeneous 137 Cs profiles with values of mass activity and inventories up to 38.7 Bq kg -1 and 2510.8 Bq m -2 , respectively. The 137 Cs inventories were significantly higher in uncultivated soils (mean: 2086.9 Bq m -2 ) compared to cultivated soils (mean: 1397.1 Bq m -2 ). The 137 Cs mass activity showed a significant positive correlation with organic matter, silt and clay, but it was negatively correlated with sand and pH respectively. High levels of 137 Cs were found at altitudes between 500 m and 640 m a.s.l, and at slopes from 8° to 11°, as well as in dense scrub land and Fersialitic soils. A principal component analysis showed that more than 86.7% of the variance in 137 Cs mass activity was explained by the organic matter content and the land use. The results of this study provide insights into the effects of soil properties and physiographic factors on the behaviour of 137 Cs in soils of Mediterranean environments of North Africa and strengthen the reliability of this radioisotope as an erosion tracer. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Physical activity is related to lower levels of pain, fatigue and depression in individuals with spinal-cord injury: a correlational study.

    PubMed

    Tawashy, A E; Eng, J J; Lin, K H; Tang, P F; Hung, C

    2009-04-01

    This was a prospective cross-sectional study for people with chronic spinal cord injury (SCI). To (1) evaluate the intensity level and nature of physical activity in community-dwelling individuals living with SCI, and (2) explore the relation between descriptive individual variables (for example, lesion level), secondary complications and participation in physical activity. Urban community setting. A total of 49 subjects with SCI who used a manual wheelchair for primary mode of mobility (mean years since injury, 11.8; mean age, 43.7 years; 67% paraplegia) completed the physical activity recall assessment for people with SCI (PARA-SCI). Approximately 50% of reported physical activity among individuals with SCI is due to activities of daily living. The amount of physical activity was not related to lesion level, age, body mass index or waistline size. Greater heavy-intensity activity was related to lower levels of pain and fatigue and higher levels of self-efficacy, whereas higher amounts of mild-intensity activity and total activity were related to less depressive symptoms. Activities of daily living are a large component for physical activity among individuals with SCI. It appears that greater physical activity is associated with less secondary complications (pain, fatigue and depression) in individuals with SCI.

  1. Dynamical mass ejection from the merger of asymmetric binary neutron stars: Radiation-hydrodynamics study in general relativity

    NASA Astrophysics Data System (ADS)

    Sekiguchi, Yuichiro; Kiuchi, Kenta; Kyutoku, Koutarou; Shibata, Masaru; Taniguchi, Keisuke

    2016-06-01

    We perform neutrino radiation-hydrodynamics simulations for the merger of asymmetric binary neutron stars in numerical relativity. Neutron stars are modeled by soft and moderately stiff finite-temperature equations of state (EOS). We find that the properties of the dynamical ejecta such as the total mass, neutron richness profile, and specific entropy profile depend on the mass ratio of the binary systems for a given EOS in a unique manner. For a soft EOS (SFHo), the total ejecta mass depends weakly on the mass ratio, but the average of electron number per baryon (Ye ) and specific entropy (s ) of the ejecta decreases significantly with the increase of the degree of mass asymmetry. For a stiff EOS (DD2), with the increase of the mass asymmetry degree, the total ejecta mass significantly increases while the average of Ye and s moderately decreases. We find again that only for the SFHo, the total ejecta mass exceeds 0.01 M⊙ irrespective of the mass ratio chosen in this paper. The ejecta have a variety of electron number per baryon with an average approximately between Ye˜0.2 and ˜0.3 irrespective of the EOS employed, which is well suited for the production of the rapid neutron capture process heavy elements (second and third peaks), although its averaged value decreases with the increase of the degree of mass asymmetry.

  2. Optimizing the Space Transportation System

    DTIC Science & Technology

    1982-12-01

    the entire gamut of inclinations and altitudes. The Shuttle payload mass and the total Station, OTV and Shuttle propellant mass required in orbit are...military satellites across the entire gamut of inclinations and altitudes. The total Station, OTV, Shuttle propellant and Shuttle payload mass required in

  3. Size resolved airborne particulate polysaccharides in summer high Arctic

    NASA Astrophysics Data System (ADS)

    Leck, C.; Gao, Q.; Mashayekhy Rad, F.; Nilsson, U.

    2013-04-01

    Size-resolved aerosol samples for subsequent determination of polysaccharides (monosaccharides in combined form) were collected in air over the central Arctic Ocean during the biologically most active period between the late summer melt season and into the transition to autumn freeze-up. The analysis was carried out using liquid chromatography coupled with highly selective and sensitive tandem mass spectrometry. Polysaccharides were detected in all sizes ranging from 0.035 to 10 μm in diameter with distinct features of heteropolysaccharides, enriched in xylose, glucose + mannose as well as a substantial fraction of deoxysugars. Polysaccharides containing deoxysugars showed a bimodal structure with about 60% of their mass found in the Aitken mode over the pack ice area. Pentose (xylose) and hexose (glucose + mannose) showed a weaker bimodal character and were largely found in the coarse mode in addition to a minor fraction apportioned in the sub-micrometer size range. The concentration of total hydrolysable neutral sugars (THNS) in the samples collected varied over 3 orders of magnitude (1 to 692 pmol m-3) in the super-micrometer size fraction and to a lesser extent in sub-micrometer particles (4 to 88 pmol m-3). Lowest THNS concentrations were observed in air masses that had spent more than 5 days over the pack ice. Within the pack ice area, about 53% (by mass) of the total mass of polysaccharides were found in sub-micrometer particles. The relative abundance of sub-micrometer polysaccharides was closely related to the length of time that the air mass spent over pack ice, with highest fraction (> 90%) observed for > 7 days of advection. The ambient aerosol particles collected onboard ship showed similar monosaccharide composition, compared to particles generated experimentally in situ at the open lead site. This supports the existence of a primary source of particulate polysaccharides from open leads by bubble bursting at the air-sea interface. We speculate that the presence of biogenic polysaccharides, due to their surface active and hygroscopic nature, could play a potential role as cloud condensation nuclei in the pristine high Arctic.

  4. Sex-specific energetics of Pacific walruses (Odobenus rosmarus divergens) during the nursing interval

    USGS Publications Warehouse

    Noren, Shawn R.; Udevitz, Mark S.; Jay, Chadwick V.

    2016-01-01

    Habitat use and activity patterns of Pacific walruses (Odobenus rosmarus divergens) have changed with climate-induced reductions in sea ice. Increases in the time active in water could result in negative energy balance, precluding females from sustaining lactation, which could impact population demographics. Little is known about lactation costs in walruses. We examined the energetics of 0–2-yr-old walrus calves by using Bayesian hierarchical models based on longitudinal husbandry records of growth (n = 6 females and 7 males) and caloric intake (n = 5 females and 6 males) as a proxy for maternal lactation costs. Males and females had similar growth patterns; mean mass increased from 68 kg at birth to 301 kg by 2 yr. Females had a 2,000 kcal kg−1 higher mass storage (growth) cost than males; females typically synthesize and deposit greater amounts of adipose, which is more energy dense than lean tissue. In contrast, males had higher metabolic (basal and activity) costs, ranging from 600 to 1,800 kcal d−1 greater than similarly sized females; males are typically leaner, and muscle is more metabolically active than adipose. Yet total daily energy requirements (storage plus metabolic components) were similar across sexes, summing to approximately 190,000 kcal over the first month postpartum. Based on these estimates and assuming that 8,103 kcal is recovered from 1 kg of mass loss in adult female walruses, suckling calves could deplete 23 kg of their mother’s body mass over the first month after parturition if none of the lactation costs is met through ingested prey.

  5. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    PubMed

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  6. Mass Profile Decomposition of the Frontier Fields Cluster MACS J0416-2403: Insights on the Dark-matter Inner Profile

    NASA Astrophysics Data System (ADS)

    Annunziatella, M.; Bonamigo, M.; Grillo, C.; Mercurio, A.; Rosati, P.; Caminha, G.; Biviano, A.; Girardi, M.; Gobat, R.; Lombardi, M.; Munari, E.

    2017-12-01

    We present a high-resolution dissection of the two-dimensional total mass distribution in the core of the Hubble Frontier Fields galaxy cluster MACS J0416.1‑2403, at z = 0.396. We exploit HST/WFC3 near-IR (F160W) imaging, VLT/Multi Unit Spectroscopic Explorer spectroscopy, and Chandra data to separate the stellar, hot gas, and dark-matter mass components in the inner 300 kpc of the cluster. We combine the recent results of our refined strong lensing analysis, which includes the contribution of the intracluster gas, with the modeling of the surface brightness and stellar mass distributions of 193 cluster members, of which 144 are spectroscopically confirmed. We find that, moving from 10 to 300 kpc from the cluster center, the stellar to total mass fraction decreases from 12% to 1% and the hot gas to total mass fraction increases from 3% to 9%, resulting in a baryon fraction of approximatively 10% at the outermost radius. We measure that the stellar component represents ∼30%, near the cluster center, and 15%, at larger clustercentric distances, of the total mass in the cluster substructures. We subtract the baryonic mass component from the total mass distribution and conclude that within 30 kpc (∼3 times the effective radius of the brightest cluster galaxy) from the cluster center the surface mass density profile of the total mass and global (cluster plus substructures) dark-matter are steeper and that of the diffuse (cluster) dark-matter is shallower than an NFW profile. Our current analysis does not point to a significant offset between the cluster stellar and dark-matter components. This detailed and robust reconstruction of the inner dark-matter distribution in a larger sample of galaxy clusters will set a new benchmark for different structure formation scenarios.

  7. Correlated Flare and CME Energies for the October/November 2003 Events

    NASA Technical Reports Server (NTRS)

    Dennis, Brian R.; Haga, Leah; Medlin, Drew; Tolbert, A. Kimberly

    2006-01-01

    We find a strong correlation between the kinetic energies (KEs) of the coronal mass ejections (CMEs) and the radiated energies of the associated solar flares for the events that occurred during the period of intense solar activity between 18 October and 08 November 2003. CME start times, speeds, mass, and KEs were taken from Gopalswamy et al. (2005), who used SOHO/LASCO observations. The GOES observations of the associated flares were analyzed to find the peak SXR flux, the radiated energy in SXRs (L(sub sxr)), and the radiated energy from the SXR emitting plasma across all wavelengths (L(sub hot)). RHESSI observations were also used to find the energy in non-thermal electrons, ions, and the plasma thermal energy for some events. For two events, SORCE/TIM observations of the total solar irradiance during a flare were also available to give the total radiated flare energy (L(sub total)). We find that the total flare energies of the larger events are of the same order of magnitude as the CME KE with a stronger correlation than has been found in the past for other time intervals. The following rule-of-thumb (good to an order of magnitude for the larger events} can be used to relate flare and CME energies: CME KE l(sub total) 10 L(sub hot) 100 L(sub SXR).

  8. Search for supersymmetry in events with at least one photon, missing transverse momentum, and large transverse event activity in proton-proton collisions at $$ \\sqrt{s}=13 $$ TeV

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Sirunyan, A. M.; Tumasyan, A.; Adam, W.

    A search for physics beyond the standard model in final states with at least one photon, large transverse momentum imbalance, and large total transverse event activity is presented. Such topologies can be produced in gauge-mediated supersymmetry models in which pair-produced gluinos or squarks decay to photons and gravitinos via short-lived neutralinos. The data sample corresponds to an integrated luminosity of 35.9 fb –1 of proton-proton collisions at √s = 13 TeV recorded by the CMS experiment at the LHC in 2016. No significant excess of events above the expected standard model background is observed. The data are interpreted in simplifiedmore » models of gluino and squark pair production, in which gluinos or squarks decay via neutralinos to photons. In conclusion, gluino masses of up to 1.50-2.00 TeV and squark masses up to 1.30-1.65 TeV are excluded at 95% confidence level, depending on the neutralino mass and branching fraction.« less

  9. Detecting Extracellular Carbonic Anhydrase Activity Using Membrane Inlet Mass Spectrometry

    PubMed Central

    Delacruz, Joannalyn; Mikulski, Rose; Tu, Chingkuang; Li, Ying; Wang, Hai; Shiverick, Kathleen T.; Frost, Susan C.; Horenstein, Nicole A.; Silverman, David N.

    2010-01-01

    Current research into the function of carbonic anhydrases in cell physiology emphasizes the role of membrane-bound carbonic anhydrases, such as carbonic anhydrase IX that has been identified in malignant tumors and is associated with extracellular acidification as a response to hypoxia. We present here a mass spectrometric method to determine the extent to which total carbonic anhydrase activity is due to extracellular carbonic anhydrase in whole cell preparations. The method is based on the biphasic rate of depletion of 18O from CO2 measured by membrane inlet mass spectrometry. The slopes of the biphasic depletion are a sensitive measure of the presence of carbonic anhydrase outside and inside of the cells. This property is demonstrated here using suspensions of human red cells in which external carbonic anhydrase was added to the suspending solution. It is also applied to breast and prostate cancer cells which both express exofacial carbonic anhydrase IX. Inhibition of external carbonic anhydrase is achieved by use of a membrane impermeant inhibitor that was synthesized for this purpose, p-aminomethylbenzenesulfonamide attached to a polyethyleneglycol polymer. PMID:20417171

  10. Search for supersymmetry in events with at least one photon, missing transverse momentum, and large transverse event activity in proton-proton collisions at √{s}=13 TeV

    NASA Astrophysics Data System (ADS)

    Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Dragicevic, M.; Erö, J.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rabady, D.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Strauss, J.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Moortgat, S.; Moreels, L.; Olbrechts, A.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Karapostoli, G.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Randle-conde, A.; Seva, T.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Zhang, F.; Cimmino, A.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caudron, A.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Jafari, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Vidal Marono, M.; Wertz, S.; Beliy, N.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Custódio, A.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Santoro, A.; Sznajder, A.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Fernandez Perez Tomei, T. R.; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Stoykova, S.; Sultanov, G.; Dimitrov, A.; Glushkov, I.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhao, J.; Ban, Y.; Chen, G.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; Ellithi Kamel, A.; Khalil, S.; Mohamed, A.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Pekkanen, J.; Voutilainen, M.; Härkönen, J.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Lehti, S.; Lindén, T.; Luukka, P.; Tuominen, E.; Tuominiemi, J.; Tuovinen, E.; Talvitie, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Givernaud, A.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Regnard, S.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Toriashvili, T.; Tsamalaidze, Z.; Autermann, C.; Beranek, S.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Verlage, T.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Olschewski, M.; Padeken, K.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Lingemann, J.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Gizhko, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kalogeropoulos, A.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Placakyte, R.; Raspereza, A.; Roland, B.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Spannagel, S.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Bein, S.; Blobel, V.; Centis Vignali, M.; Draeger, A. R.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marchesini, I.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanelderen, L.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Freund, B.; Friese, R.; Giffels, M.; Gilbert, A.; Haitz, D.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Giakoumopoulou, V. A.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Evangelou, I.; Foudas, C.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Csanad, M.; Filipovic, N.; Pasztor, G.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Vesztergombi, G.; Zsigmond, A. J.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Bhawandeep, U.; Chawla, R.; Dhingra, N.; Kalsi, A. K.; Kaur, A.; Kaur, M.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Sharma, V.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy, D.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Parida, B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Caputo, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Robutti, E.; Tosi, S.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Esposito, M.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lanza, G.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Boletti, A.; Checchia, P.; De Castro Manzano, P.; Dorigo, T.; Dosselli, U.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Margoni, M.; Meneguzzo, A. T.; Pantano, D.; Passaseo, M.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Simonetto, F.; Torassa, E.; Ventura, S.; Zanetti, M.; Zotto, P.; Zumerle, G.; Braghieri, A.; Fallavollita, F.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Lariccia, P.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Bernardini, J.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Martini, L.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Del Re, D.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Ravera, F.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Choi, M.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Ryu, G.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Md Ali, M. A. B.; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Romanowska-Rybinska, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Calpas, B.; Di Francesco, A.; Faccioli, P.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chistov, R.; Danilov, M.; Parygin, P.; Philippov, D.; Polikarpov, S.; Tarkovskii, E.; Zhemchugov, E.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Dubinin, M.; Dudko, L.; Ershov, A.; Gribushin, A.; Klyukhin, V.; Kodolova, O.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Petrushanko, S.; Savrin, V.; Snigirev, A.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Krychkine, V.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Escalante Del Valle, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Garcia-Abia, P.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; de Trocóniz, J. F.; Missiroli, M.; Moran, D.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Suárez Andrés, I.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Di Marco, E.; Dobson, M.; Dorney, B.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gill, K.; Glege, F.; Gulhan, D.; Gundacker, S.; Guthoff, M.; Harris, P.; Hegeman, J.; Innocente, V.; Janot, P.; Karacheban, O.; Kieseler, J.; Kirschenmann, H.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Veres, G. I.; Verweij, M.; Wardle, N.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Bachmair, F.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zagozdzinska, A.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Ngadiuba, J.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Seitz, C.; Zucchetta, A.; Candelise, V.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Miñano Moya, M.; Paganis, E.; Psallidas, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Adiguzel, A.; Bakirci, M. N.; Boran, F.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Eskut, E.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Ozturk, S.; Polatoz, A.; Sunar Cerci, D.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Bilin, B.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Grynyov, B.; Levchuk, L.; Sorokin, P.; Aggleton, R.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Grimes, M.; Heath, G. P.; Heath, H. F.; Jacob, J.; Kreczko, L.; Lucas, C.; Newbold, D. M.; Paramesvaran, S.; Poll, A.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Bell, K. W.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Bainbridge, R.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Symonds, P.; Teodorescu, L.; Turner, M.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Mao, Z.; Narain, M.; Piperov, S.; Sagir, S.; Syarif, R.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Gardner, M.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Squires, M.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Jandir, P.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Shrinivas, A.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Macneill, I.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Simon, S.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; George, C.; Golf, F.; Gouskos, L.; Gran, J.; Heller, R.; Incandela, J.; Mullin, S. D.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bendavid, J.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Maruyama, S.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Das, S.; Field, R. D.; Furic, I. K.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Rank, D.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Royon, C.; Sanders, S.; Schmitz, E.; Stringer, R.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Toda, S.; Rebassoo, F.; Wright, D.; Anelli, C.; Baden, A.; Baron, O.; Belloni, A.; Calvert, B.; Eno, S. C.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lai, Y. S.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Alyari, M.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Nash, D.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Pollack, B.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Smith, G.; Taroni, S.; Wayne, M.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Puigh, D.; Winer, B. L.; Wulsin, H. W.; Benaglia, A.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Folgueras, S.; Gutay, L.; Jha, M. K.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Schulte, J. F.; Sun, J.; Wang, F.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Adair, A.; Akgun, B.; Chen, Z.; Ecklund, K. M.; Geurts, F. J. M.; Guilbaud, M.; Li, W.; Michlin, B.; Northup, M.; Padley, B. P.; Roberts, J.; Rorie, J.; Tu, Z.; Zabel, J.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Foerster, M.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Sun, X.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Sturdy, J.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Pierro, G. A.; Polese, G.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.

    2017-12-01

    A search for physics beyond the standard model in final states with at least one photon, large transverse momentum imbalance, and large total transverse event activity is presented. Such topologies can be produced in gauge-mediated supersymmetry models in which pair-produced gluinos or squarks decay to photons and gravitinos via short-lived neutralinos. The data sample corresponds to an integrated luminosity of 35.9 fb-1 of proton-proton collisions at √{s}=13 TeV recorded by the CMS experiment at the LHC in 2016. No significant excess of events above the expected standard model background is observed. The data are interpreted in simplified models of gluino and squark pair production, in which gluinos or squarks decay via neutralinos to photons. Gluino masses of up to 1.50-2.00 TeV and squark masses up to 1.30-1.65 TeV are excluded at 95% confidence level, depending on the neutralino mass and branching fraction.

  11. Search for supersymmetry in events with at least one photon, missing transverse momentum, and large transverse event activity in proton-proton collisions at $$ \\sqrt{s}=13 $$ TeV

    DOE PAGES

    Sirunyan, A. M.; Tumasyan, A.; Adam, W.; ...

    2017-12-28

    A search for physics beyond the standard model in final states with at least one photon, large transverse momentum imbalance, and large total transverse event activity is presented. Such topologies can be produced in gauge-mediated supersymmetry models in which pair-produced gluinos or squarks decay to photons and gravitinos via short-lived neutralinos. The data sample corresponds to an integrated luminosity of 35.9 fb –1 of proton-proton collisions at √s = 13 TeV recorded by the CMS experiment at the LHC in 2016. No significant excess of events above the expected standard model background is observed. The data are interpreted in simplifiedmore » models of gluino and squark pair production, in which gluinos or squarks decay via neutralinos to photons. In conclusion, gluino masses of up to 1.50-2.00 TeV and squark masses up to 1.30-1.65 TeV are excluded at 95% confidence level, depending on the neutralino mass and branching fraction.« less

  12. lmplementing lifestyle change through phone-based motivational interviewing in rural-based women with previous gestational diabetes mellitus.

    PubMed

    Reinhardt, Judith A; van der Ploeg, Hidde P; Grzegrzulka, Richard; Timperley, Jennifer G

    2012-04-01

    Substantial numbers of women with past gestational diabetes mellitus (GDM) develop type 2 diabetes mellitus (T2DM). In northern New South Wales 23% of women attending diabetes services between 2007 and 2010 with T2DM previously had GDM. This study investigated whether phone-based lifestyle education using motivational interviewing resulted in positive lifestyle change post GDM for women in a large rural area. Thirty-eight women were recruited to this pilot study following GDM diagnosis and randomly allocated to either the control or intervention group. Following baseline assessment, the intervention group received a 6-month phone-based motivational interviewing program, and access to usual care. The control group received usual care only. Measures were collected at baseline (6 weeks postnatal), and at 6 months follow-up. Outcome measures included body mass index, diet, and physical activity. At follow-up, the intervention group compared to the control group significantly reduced total fat intake by -19 g/d (95%CI: -37 to -1), total carbohydrate intake by -42 g/d (95%CI: -82 to -1), and glycaemic load by -26 units (95%CI: -48 to -4). These women also increased leisure physical activity compared to the control group by 11 min/d (95%CI: 1 to 22); no significant change in total physical activity levels occurred. At follow-up, body mass index in the intervention group improved by -1.5 kg/m2 (95%CI: -2.8 to -0.1) compared to the control group. The intervention group showed positive trends across lifestyle variables compared to the control group. Further large-scale research on the effectiveness of phone-based lifestyle counselling following GDM is warranted.

  13. A novel inversion method to calculate the mass fraction of coated refractory black carbon using a centrifugal particle mass analyzer and single particle soot photometer

    NASA Astrophysics Data System (ADS)

    Irwin, M.; Broda, K.; Olfert, J. S.; Schill, G. P.; McMeeking, G. R.; Schnitzler, E.; Jäger, W.

    2016-12-01

    Refractory black carbon (rBC) has important atmospheric impacts due to its ability to absorb light, and its interactions with light are partly governed by the acquisition of coatings or other mixing processes. Here, a novel inversion method is presented which derives the mass fraction of coated rBC using a coupled centrifugal particle mass analyzer (CPMA) and single particle soot photometer (SP2). The CPMA selects particles of a known mass-­to-­charge ratio, and the SP2 detects the mass of rBC in each individual particle. The results of the inversion are the simultaneous number distributions of both rBC mass and total particle mass. Practically, the distribution can be integrated to find properties of the total aerosol population, for example, i) mass fraction of coating and ii) mass of coating on a particle of known total mass. This was demonstrated via smog chamber experiments. Initially, particles in the chamber were pure rBC, produced from a methane burner and passed through a diffusion dryer and thermal denuder. An organic (non-rBC) coating was then grown onto the aerosol over several hours via photooxidation with p-xylene. The CPMA-SP2 coupled system sampled the aerosol over the reaction period as the coating grew. The CPMA was sequentially stepped over a mass range from 0.3 to 28 fg and the SP2 measured the mass of rBC in each individual CPMA-classified particle. The number and mass distributions were constructed using the inversion. As expected, the mass and number distributions of rBC and total mass were equivalent for uncoated particles. As the non-rBC coating thickness increased over time, a shift in the number distribution towards higher total mass was observed. At the end of the experiment, fresh rBC (i.e. uncoated, bare particles) was injected into the chamber, creating an external mixture of coated and uncoated particles. This external mixture was clearly resolved in the number distribution of rBC and total particle mass. It is expected that the CPMA-SP2 methodology and inversion technique would be useful for field measurements where the rBC mass fraction, and mixing state of rBC-containing particles, could be accurately measured continuously. This methodology is not limited to evaluating coating mass—unlike SP2 only methods, it gives an unambiguous measure of any non-rBC material mixed with the particle.

  14. Cardiovascular risk determination: discrepancy between total cholesterol evaluation and two compound laboratory indices in Norway.

    PubMed Central

    Berg, J E; Høstmark, A T

    1994-01-01

    OBJECTIVE--To compare group classification of cardiovascular risk by two compound laboratory indices with classification according to the serum total cholesterol concentration alone. DESIGN--Healthy employees were defined as low and high cardiovascular risk subjects according to their total cholesterol concentration or two compound indices of blood lipid components-the total cholesterol: high density lipoprotein (HDL) cholesterol ratio and an atherogenic index defined as ([total cholesterol-HDL cholesterol]*[apolipoprotein B])/([HDL cholesterol]*[apolipoprotein A-I]). Cut off values to distinguish between low and high risk subjects were as follows: total cholesterol 6.5 mmol/l, HDL cholesterol 0.9 mmol/l, apolipoprotein A = 1.8 g/l, and apolipoprotein B = 1.3 g/l. These gave total: HDL cholesterol ratio and atherogenic index cut off values of 7.2 and 4.5 respectively. SETTING--An occupational health service in a non-manufacturing company in Norway. PARTICIPANTS--A total of 112 male and 117 female employees. The mean body mass index values were 25.6 and 23.6 kg/m2 and the mean ages 39.8 and 40.1 years in men and women respectively. Those with cardiovascular, diabetic, or renal diseases were excluded. MEAN OUTCOME MEASURES--Serum total cholesterol, HDL cholesterol, apolipoproteins A-I and B, lipid peroxidation, blood pressure, smoking, physical activity, and fruit, vegetables, and salt in the diet were determined. RESULTS--The cut off values allocated 19%, 7%, and 40% as high risk subjects according to total cholesterol, total: HDL cholesterol, and the atherogenic index respectively. The mean age was two to four years higher in the high risk groups. Cardiovascular risk in siblings and no reported physical activity were more prevalent in those high risk groups defined by the compound indices than by total cholesterol alone, as was a high body mass index and a measure of lipid peroxidation. Grouping according to total cholesterol failed to allocate heavy smokers mainly to the high risk group. Diet variables did not demarcate clearly between indices. CONCLUSIONS--There is considerable variability in classification into high and low risk subjects when using the total cholesterol concentration alone compared with compound risk indices. Smoking was more prevalent in the high risk groups defined by the compound indices than by total cholesterol. These findings call for caution when total cholesterol is used to estimate cardiovascular risk in epidemiological studies, and even more so at individual counselling in occupational or primary health care settings. PMID:7964330

  15. A randomized, double-blind, placebo-controlled clinical trial on the treatment of vitamin D insufficiency in postmenopausal women

    PubMed Central

    Hansen, Karen E.; Johnson, R. Erin; Chambers, Kaitlin R.; Johnson, Michael G.; Lemon, Christina C.; Thuy Vo, Tien Nguyen; Marvdashti, Sheeva

    2015-01-01

    Importance Experts debate optimal 25(OH)D levels for musculoskeletal health. Objective To compare effects of placebo, low-dose and high-dose vitamin D on one-year changes in total fractional calcium absorption, bone mineral density, Timed-Up-and-Go and 5-sit-to-stand tests and muscle mass in postmenopausal women with vitamin D insufficiency. Design Randomized, double-blind, placebo-controlled, clinical trial conducted from May 2010 to August 2014. Setting Single-center trial conducted in Madison, Wisconsin. Participants 230 postmenopausal women ≤75 years old with baseline 25(OH)D levels 14-27 ng/mL and no osteoporosis. Intervention Three arms included daily white and twice monthly yellow placebo (n=76), daily 800 IU vitamin D3 and twice monthly yellow placebo (n=76), and daily white placebo and twice monthly 50,000 IU vitamin D3 (n=79). The high-dose vitamin D regimen achieved and maintained 25(OH)D levels ≥30 ng/mL. Main Outcome Measures One year change in total fractional calcium absorption using two stable isotopes, bone mineral density and muscle mass using dual energy x-ray absorptiometry, Timed-Up-and-Go and 5-Sit-to-Stand tests, functional status (Health Assessment Questionnaire) and physical activity (Physical Activity Scale for the Elderly), with Benjamini-Hochberg correction of p-values to control the false discovery rate. Results After controlling for baseline absorption, calcium absorption increased 1% (10 mg/day) in the high-dose arm, but decreased by 2% in low-dose (p=0.005 vs. high-dose) and by 1.3% placebo (p=0.03 vs. high-dose) arms. We found no between-arm changes in spine, mean total hip, mean femoral neck or total body bone mineral density, trabecular bone score, muscle mass, 5-sit-to-stand or Timed-Up-and-Go test scores. Likewise, we found no between-arm differences for numbers of falls, number of fallers, physical activity or functional status. Conclusion and Relevance High-dose vitamin D therapy increased calcium absorption, but the effect was small and did not translate into beneficial effects on bone mineral density, muscle function, muscle mass or falls. We found no data to support experts’ recommendations to maintain serum 25(OH)D levels ≥30 ng/mL in postmenopausal women. Instead, we found that low and high-dose vitamin D were equivalent to placebo, in their effects on bone and muscle outcomes in this cohort of postmenopausal women with 25(OH)D levels <30 ng/mL. ClinicalTrials.gov.Identifier:NCT00933244 PMID:26237520

  16. Prompt and delayed NAA techniques for the characterization of specimen bank materials.

    PubMed

    Rossbach, M; Stoeppler, M; Byrne, A R

    1993-11-01

    The combined application of instrumental-, radiochemical- and prompt gamma neutron activation analysis to two spruce shoot materials from the German Environmental Specimen Bank (ESB) resulted in information on 50 elements, covering more than 50% of the total mass. Comparison of the element concentrations in the 'fingerprint' mode clearly indicated a different status of heavy metal pollution at the two distinct collecting sites.

  17. Guaiacol peroxidase zymography for the undergraduate laboratory.

    PubMed

    Wilkesman, Jeff; Castro, Diana; Contreras, Lellys M; Kurz, Liliana

    2014-01-01

    This laboratory exercise presents a novel way to introduce undergraduate students to the specific detection of enzymatic activity by electrophoresis. First, students prepare a crude peroxidase extract and then analyze the homogenate via electrophoresis. Zymography, that is, a SDS-PAGE method to detect enzyme activity, is used to specifically detect peroxidase activity and furthermore, to analyze the total protein profile. After the assay, students may estimate the apparent molecular mass of the enzyme and discuss its structure. After the 4-h experiment, students gain knowledge concerning biological sample preparation, gel preparation, electrophoresis, and the importance of specific staining procedures for the detection of enzymatic activity. Copyright © 2014 The International Union of Biochemistry and Molecular Biology.

  18. Active Videogames and Weight Management: Is There a Future?

    PubMed

    Maddison, Ralph; Jull, Andrew; Marsh, Samantha; Direito, Artur; Mhurchu, Cliona Ni

    2013-06-01

    We evaluated the effects of an active videogame (AVG) intervention (Sony [Tokyo, Japan] PlayStation(®) EyeToy(®)) compared with non-AVGs on body composition, physical activity, sedentary behavior, and snack food consumption among overweight 10-12-year-old children over 24 weeks. Our research showed a treatment effect on body mass index and percentage body fat in favor of the intervention group. There was no difference between groups for total physical activity levels, but there was an increase in self-reported AVG play and reductions in non-AVG play and snack food consumption in the intervention group. Research is needed to determine how to augment the effects observed in this study.

  19. Effects of dietary protein on the composition of weight loss in post-menopausal women.

    PubMed

    Gordon, M M; Bopp, M J; Easter, L; Miller, G D; Lyles, M F; Houston, D K; Nicklas, B J; Kritchevsky, S B

    2008-10-01

    To determine whether a hypocaloric diet higher in protein can prevent the loss of lean mass that is commonly associated with weight loss. An intervention study comparing a hypocaloric diet moderately high in protein to one lower in protein. Study measurements were taken at the Wake Forest University General Clinical Research Center (GCRC) and Geriatric Research Center (GRC). Twenty-four post-menopausal, obese women (mean age = 58 +/- 6.6 yrs; mean BMI = 33.0 +/- 3.6 kg/m2). Two 20-week hypocaloric diets (both reduced by 2800 kcal/wk) were compared: one maintaining dietary protein intake at 30% of total energy intake (1.2-1.5 g/kg/d; HI PROT), and the other maintaining dietary protein intake at 15% of total energy (0.5-0.7 g/kg/d; LO PROT). The GCRC metabolic kitchen provided lunch and dinner meals which the women picked up 3 days per week and ate outside of the clinic. Body composition, including total body mass, total lean mass, total fat mass, and appendicular lean mass, assessed by dual energy x-ray absorptiometry, was measured before and after the diet interventions. The HI PROT group lost 8.4 +/- 4.5 kg and the LO PROT group lost 11.4 +/- 3.8 kg of body weight (p = 0.11). The mean percentage of total mass lost as lean mass was 17.3% +/- 27.8% and 37.5% +/- 14.6%, respectively (p = 0.03). Maintaining adequate protein intake may reduce lean mass losses associated with voluntary weight loss in older women.

  20. Quantification of differences between occupancy and total monitoring periods for better assessment of exposure to particles in indoor environments

    NASA Astrophysics Data System (ADS)

    Wierzbicka, A.; Bohgard, M.; Pagels, J. H.; Dahl, A.; Löndahl, J.; Hussein, T.; Swietlicki, E.; Gudmundsson, A.

    2015-04-01

    For the assessment of personal exposure, information about the concentration of pollutants when people are in given indoor environments (occupancy time) are of prime importance. However this kind of data frequently is not reported. The aim of this study was to assess differences in particle characteristics between occupancy time and the total monitoring period, with the latter being the most frequently used averaging time in the published data. Seven indoor environments were selected in Sweden and Finland: an apartment, two houses, two schools, a supermarket, and a restaurant. They were assessed for particle number and mass concentrations and number size distributions. The measurements using a Scanning Mobility Particle Sizer and two photometers were conducted for seven consecutive days during winter in each location. Particle concentrations in residences and schools were, as expected, the highest during occupancy time. In the apartment average and median PM2.5 mass concentrations during the occupancy time were 29% and 17% higher, respectively compared to total monitoring period. In both schools, the average and medium values of the PM2.5 mass concentrations were on average higher during teaching hours compared to the total monitoring period by 16% and 32%, respectively. When it comes to particle number concentrations (PNC), in the apartment during occupancy, the average and median values were 33% and 58% higher, respectively than during the total monitoring period. In both houses and schools the average and median PNC were similar for the occupancy and total monitoring periods. General conclusions on the basis of measurements in the limited number of indoor environments cannot be drawn. However the results confirm a strong dependence on type and frequency of indoor activities that generate particles and site specificity. The results also indicate that the exclusion of data series during non-occupancy periods can improve the estimates of particle concentrations and characteristics suitable for exposure assessment, which is crucial for estimating health effects in epidemiological and toxicological studies.

  1. Marine biogenic sources of organic nitrogen and water-soluble organic aerosols over the western North Pacific in summer

    NASA Astrophysics Data System (ADS)

    Miyazaki, Y.; Kawamura, K.; Sawano, M.

    2009-12-01

    Size-segregated aerosol samples of organic nitrogen (ON) as well as water-soluble organic compounds were obtained over the western North Pacific in the summer of 2008. Mass contributions of organics to the total aerosol mass were 20-40% in the supermicron mode and 45-60% in the submicron mode. ON as well as diacids and water-soluble organic carbon (WSOC) showed bimodal size distributions over the remote ocean, where high values of chlorophyll-a concentrations and depth-integrated primary production were observed. The ON concentrations increased with increasing biogenic tracer compounds such as methanesulfuric acid (MSA) and azelaic acid (C9). The average concentrations of ON and organic carbon (OC) in aerosols more influenced by marine biological activity were found to be about two times greater than those in biologically less influenced aerosols. These results provide evidence of marine biogenic sources of ON as well as OC. An average ON/OC ratio in biologically more influenced aerosols was as high as 0.49±0.11, which is higher than that in biologically less influenced aerosols (0.35±0.10). This result indicates that organic aerosol in this region is enriched in organic nitrogen, which linked to oceanic biological activity and comparable in magnitude to the marine biogenic OC source. We discuss possible processes for primary and secondary production of ON and OC in these samples, and stable nitrogen and carbon isotope ratios for total nitrogen (TN) and total carbon (TC).

  2. Effects of voluntary exercise on spontaneous physical activity and food consumption in mice: Results from an artificial selection experiment.

    PubMed

    Copes, Lynn E; Schutz, Heidi; Dlugosz, Elizabeth M; Acosta, Wendy; Chappell, Mark A; Garland, Theodore

    2015-10-01

    We evaluated the effect of voluntary exercise on spontaneous physical activity (SPA) and food consumption in mice from 4 replicate lines bred for 57 generations for high voluntary wheel running (HR) and from 4 non-selected control (C) lines. Beginning at ~24 days of age, mice were housed in standard cages or in cages with attached wheels. Wheel activity and SPA were monitored in 1-min intervals. Data from the 8th week of the experiment were analyzed because mice were sexually mature and had plateaued in body mass, weekly wheel running distance, SPA, and food consumption. Body mass, length, and masses of the retroperitoneal fat pad, liver, and heart were recorded after the 13th week. SPA of both HR and C mice decreased with wheel access, due to reductions in both duration and average intensity of SPA. However, total activity duration (SPA+wheel running; min/day) was ~1/3 greater when mice were housed with wheels, and food consumption was significantly increased. Overall, food consumption in both HR and C mice was more strongly affected by wheel running than by SPA. Duration of wheel running had a stronger effect than average speed, but the opposite was true for SPA. With body mass as a covariate, chronic wheel access significantly reduced fat pad mass and increased heart mass in both HR and C mice. Given that both HR and C mice housed with wheels had increased food consumption, the energetic cost of wheel running was not fully compensated by concomitant reductions in SPA. The experiment demonstrates that both duration and intensity of both wheel running and SPA were significant predictors of food consumption. This sort of detailed analysis of the effects of different aspects of physical activity on food consumption has not previously been reported for a non-human animal, and it sets the stage for longitudinal examination of energy balance and its components in rodent models. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Athletic Activity and Hormone Concentrations in High School Female Athletes

    PubMed Central

    Wojtys, Edward M.; Jannausch, Mary L.; Kreinbrink, Jennifer L.; Harlow, Siobán D.; Sowers, MaryFran R.

    2015-01-01

    Context: Physical activity may affect the concentrations of circulating endogenous hormones in female athletes. Understanding the relationship between athletic and physical activity and circulating female hormone concentrations is critical. Objective: To test the hypotheses that (1) the estradiol-progesterone profile of high school adolescent girls participating in training, conditioning, and competition would differ from that of physically inactive, age-matched adolescent girls throughout a 3-month period; and (2) athletic training and conditioning would alter body composition (muscle, bone), leading to an increasingly greater lean–body-mass to fat–body-mass ratio with accompanying hormonal changes. Design: Cohort study. Settings: Laboratory and participants' homes. Patients or Other Participants: A total of 106 adolescent girls, ages 14–18 years, who had experienced at least 3 menstrual cycles in their lifetime. Main Outcome Measure(s): Participants were prospectively monitored throughout a 13-week period, with weekly physical activity assessments and 15 urine samples for estrogen, luteinizing hormone, creatinine, and progesterone concentrations. Each girl underwent body-composition measurements before and after the study period. Results: Seventy-four of the 98 girls (76%) who completed the study classified themselves as athletes. Body mass index, body mass, and fat measures remained stable, and 17 teenagers had no complete menstrual cycle during the observation period. Mean concentrations of log(estrogen/creatinine) were slightly greater in nonathletes who had cycles of <24 or >35 days. Mean log(progesterone/creatinine) concentrations in nonathletes were less in the first half and greater in the second half of the cycle, but the differences were not statistically significant. Conclusions: A moderate level of athletic or physical activity did not influence urine concentrations of estrogen, progesterone, or luteinizing hormones. However, none of the participants achieved high levels of physical activity. A significant number (17%) of girls in both activity groups were amenorrheic during the 3-month study period. PMID:25329345

  4. Knee alignment can help predict sedentary behaviour in children: a pilot study.

    PubMed

    Shultz, S P; Kagawa, M; Fink, P W; Hills, A P

    2014-10-01

    The purpose of this pilot study was to introduce knee alignment as a potential predictor of sedentary activity levels in boys and girls. Dual energy x-ray absorptiometry (DXA) and anthropometric assessment were conducted on 47 children (21 boys and 26 girls; 5-14 y) and their gender-matched parent. Body Mass Index (BMI) and abdominal-to-height ratio were calculated. Lower extremity alignment was determined by anatomic tibiofemoral angle (TFA) measurements from DXA images. Time spent in moderate-to-vigorous physical activity and sedentary activities were obtained from a parent-reported questionnaire. Stepwise multiple regression analyses identified anthropometric, musculoskeletal, and activity factors of parents and children for predicting total time spent in sedentary behaviour. Weight, total sedentary time of parents and TFA are moderate predictors of sedentary behaviour in children (R2=0.469). When stratifying for gender, TFA and total sedentary time of the parent, as well as waist circumference, are the most useful predictors of sedentary behaviour in boys (R2=0.648). However, weight is the only predictor of sedentary behaviour in girls (R2=0.479). Negative associations between TFA and sedentary behaviour indicate that even slight variations in musculoskeletal alignment may influence a child's motivation to be physically active. Although growth and development is complicated by many potentialities, this pilot study suggests that orthopaedic factors should also be considered when evaluating physical activity in children.

  5. The release of alginate lyase from growing Pseudomonas syringae pathovar phaseolicola

    NASA Technical Reports Server (NTRS)

    Ott, C. M.; Day, D. F.; Koenig, D. W.; Pierson, D. L.

    2001-01-01

    Pseudomonas syringae pathovar phaseolicola, which produces alginate during stationary growth phase, displayed elevated extracellular alginate lyase activity during both mid-exponential and late-stationary growth phases of batch growth. Intracellular activity remained below 22% of the total activity during exponential growth, suggesting that alginate lyase has an extracellular function for this organism. Extracellular enzyme activity in continuous cultures, grown in either nutrient broth or glucose-simple salts medium, peaked at 60% of the washout rate, although nutrient broth-grown cultures displayed more than twice the activity per gram of cell mass. These results imply that growth rate, nutritional composition, or both initiate a release of alginate lyase from viable P. syringae pv. phaseolicola, which could modify its entrapping biofilm.

  6. Objectively measured physical activity and bone strength in 9-year-old boys and girls.

    PubMed

    Sardinha, Luís B; Baptista, Fátima; Ekelund, Ulf

    2008-09-01

    The purpose of this work was to analyze the relationship between intensity and duration of physical activity and composite indices of femoral neck strength and bone-mineral content of the femoral neck, lumbar spine, and total body. Physical activity was assessed by accelerometry in 143 girls and 150 boys (mean age: 9.7 years). Measurement of bone-mineral content, femoral neck bone-mineral density, femoral neck width, hip axis length, and total body fat-free mass was performed with dual-energy radiograph absorptiometry. Compressive [(bone-mineral density x femoral neck width/weight)] and bending strength [(bone-mineral density x femoral neck width(2))/(hip axis length x weight)] express the forces that the femoral neck has to withstand in weight bearing, whereas impact strength [(bone-mineral density x femoral neck width x hip axis length)/(height x weight)] expresses the energy that the femoral neck has to absorb in an impact from standing height. Analysis of covariance (fat-free mass and age adjusted) showed differences between boys and girls of approximately 9% for compressive, 10% for bending, and 9% for impact strength. Stepwise regression analysis using time spent at sedentary, light, moderate, and vigorous physical activity as predictors revealed that vigorous physical activity explained 5% to 9% of femoral neck strength variable variance in both genders, except for bending strength in boys, and approximately 1% to 3% of total body and femoral neck bone-mineral content variance. Vigorous physical activity was then used to categorize boys and girls into quartiles. Pairwise comparison indicated that boys in the third and fourth quartiles (accumulation of >26 minutes/day) demonstrated higher compressive (11%-12%), bending (10%), and impact (14%) strength than boys in the first quartile. In girls, comparison revealed a difference between the fourth (accumulation of >25 minutes/day) and first quartiles for bending strength (11%). We did not observe any relationship between physical activity and lumbar spine strength. Femoral neck strength is higher in boys than girls. Vigorous intensity emerged as the main physical activity predictor of femoral neck strength but did not explain gender differences. Daily vigorous physical activity for at least approximately 25 minutes seems to improve femoral neck bone health in children.

  7. Gender differences in leisure-time versus non-leisure-time physical activity among Saudi adolescents.

    PubMed

    Al-Sobayel, Hana; Al-Hazzaa, Hazzaa M; Abahussain, Nanda A; Qahwaji, Dina M; Musaiger, Abdulrahman O

    2015-01-01

    The aim of the study was to examine the gender differences and predictors of leisure versus non-leisure time physical activities among Saudi adolescents aged 14-19 years. The multistage stratified cluster random sampling technique was used. A sample of 1,388 males and 1,500 females enrolled in secondary schools in three major cities in Saudi Arabia was included. Anthropometric measurements were performed and Body Mass Index was calculated. Physical activity, sedentary behaviours and dietary habits were measured using a self-reported validated questionnaire. The total time spent in leisure and non-leisure physical activity per week was 90 and 77 minutes, respectively. The males spent more time per week in leisure-time physical activities than females. Females in private schools spent more time during the week in leisure-time physical activities, compared to females in Stateschools. There was a significant difference between genders by obesity status interaction in leisure-time physical activity. Gender, and other factors, predicted total duration spent in leisure-time and non-leisure-time physical activity. The study showed that female adolescents are much less active than males, especially in leisure-time physical activities. Programmes to promote physical activity among adolescents are urgently needed, with consideration of gender differences.

  8. Comparative Evaluation of Raw and Ripe Fruits of Forsythia suspensa by HPLC-ESI-MS/MS Analysis and Anti-Microbial Assay.

    PubMed

    Qu, Jialin; Yan, Xinjia; Li, Chunyan; Wen, Jing; Lu, Chongning; Ren, Jungang; Peng, Ying; Song, Shaojiang

    2017-04-01

    A multi-component quantification fingerprint based on high-performance liquid chromatography coupled with electrospray ionization tandem mass spectrometry technique has been established for the comparative analysis of raw and ripe fruits of Forsythia suspensa originated from different provinces. Eighteen bioactive constituents including three phenylethanoid glycosides derivatives, six phenolic acids, three flavonoids, four phenylpropanoids, one fatty acid and one terpenoid were identified and quantified. Total contents of phenylethanoid glycosides, phenylpropanoids and flavonoids from raw samples were found much higher than those from ripe samples, while total content of phenolic acids showed a contrary tendency. Moreover, the anti-microbial activities were comparatively assayed for the first time using five different bacterial strains. Results revealed a positive relationship between contents of total phenolic and anti-microbial activity. The results obtained in the present study may provide useful information for future utilization of F. suspensa. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. 40 CFR 86.156-98 - Calculations; refueling test.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... of the net hydrocarbon mass change and methanol mass change (if applicable) in the enclosure is used... methanol (if applicable) concentrations in ppm carbon, initial and final enclosure ambient temperatures... standard shall be computed by dividing the total refueling mass emissions by the total gallons of fuel...

  10. Effect of maximal oxygen uptake and different forms of physical training on serum lipoproteins.

    PubMed

    Schnabel, A; Kindermann, W

    1982-01-01

    260 well trained male sportsmen between 17 and 30 years of age participating in a variety of events were examined for total serum cholesterol and lipoprotein cholesterol and compared with 37 moderately active leisure-time sportsmen and 20 sedentary controls of similar ages and sex. Lipoprotein cholesterol distribution was determined by quantitative electrophoresis. Mean HDL-cholesterol increased progressively from the mean of the sedentary control to the mean of the long-distance runners, indicating a graded effect of physical activity on HDL-cholesterol. In all sporting groups mean LDL-cholesterol tended to be lower than in the controls, no association between LDL-cholesterol and form of training being apparent. Except for the long-distance runners, all sporting groups tended to be lower in total cholesterol than the controls. The HDL-/total cholesterol and LDL/HDL ratios yielded a better discrimination between the physically active and inactive than the HDL-cholesterol alone. Significant positive correlations with maximal oxygen uptake and roentgenologically determined heart volume were found for HDL-cholesterol and HDL-/total cholesterol, and negative ones for LDL/HDL. Differences in the regressions among subsets made up of sporting groups under different physical demands suggest a positive relationship between lipoprotein distribution and the magnitude of the trained muscle mass.

  11. Convergent validity of a questionnaire for assessing physical activity in Spanish adolescents with overweight.

    PubMed

    Martínez-Gómez, David; Gómez-Martínez, Sonia; Wärnberg, Julia; Welk, Gregory J; Marcos, Ascensión; Veiga, Oscar L

    2011-01-15

    To evaluate the convergent validity of the PAQ-A for assessing physical activity (PA) in overweight (including obese) adolescents. Two hundred and three Spanish adolescents (96 females), aged 13-17 years, were selected for this study. Levels of PA were self-reported by 3-day activity diary, activity rating and PAQ-A. Adolescents wore the ActiGraph accelerometer for 7 days. Overweight was classified according to International Obesity Task Force age- and sex-specific body mass index cut offs. Fifty-four (33 male and 21 female) adolescents (27%) were classified as overweight or obese. The PAQ-A was moderately related in the overweight adolescent group to an activity rating (ρ=0.52), total PA and moderate-to-vigorous PA assessed by activity monitor (ρ=0.52 and 0.43) and total PA and moderate-to-vigorous PA assessed by activity diary (ρ=0.32 and 0.47). There were no significant differences in the correlation coefficients between non-overweight and overweight adolescents. The PAQ-A shows a reasonable validity for assessing PA in Spanish overweight adolescents. Copyright © 2010 Elsevier España, S.L. All rights reserved.

  12. The role of lean body mass and physical activity in bone health in children.

    PubMed

    Baptista, Fátima; Barrigas, Carlos; Vieira, Filomena; Santa-Clara, Helena; Homens, Pedro Mil; Fragoso, Isabel; Teixeira, Pedro J; Sardinha, Luís B

    2012-01-01

    In the context of physical education curricula, markers of physical fitness (e.g., aerobic capacity, muscular strength, flexibility, and body mass index or body fat) are usually evaluated in reference to health standards. Despite their possible mediating role in the relationship between weight-bearing or muscle forces and features of bone tissue, these attributes of fitness may not be the most relevant to predict skeletal health. It is therefore important to analyze the relative contribution of these factors to the variability in bone tissue of different parts of the skeleton, and to analyze it by gender, as sensitivity to mechanical loading can diverge for boys and girls. We compared the effects of habitual physical activity (PA) and lean mass, as surrogates of weight-bearing and muscle forces, and of physical fitness (aerobic and muscle capacity of lower and upper limbs) on bone mineral content (BMC) and size of total body, lumbar spine, femoral neck, and 1/3 radius in 53 girls and 64 boys from 7.9 to 9.7 years of age. After controlling for bone age, body mass, body height, and calcium intake, lean mass was the most important predictor of bone size and/or mineral in both genders (p < 0.05), while habitual weight-bearing PA positively influenced BMC in boys (p < 0.05). The effect of muscle in bone was not determined by PA and fitness score did not explain bone variability. Femoral neck was the bone site more closely associated with mechanical loading factors; boys with a PA > 608 counts/min/day (~105 min/day of moderate and vigorous intensity) showed 13-20% more BMC than those with less physical activity, and girls with a lean mass >19 kg showed 12-19% more BMC than those with less lean mass. These findings suggest that lean mass was the most important predictor of bone size and/or mineralization in both genders, while habitual weight-bearing PA appears to positively impact on bone mineral in prepubertal boys and that both lean mass and PA need to be considered in physical education curricula and other health-enhancing programs.

  13. Aerobic activated sludge transformation of vincristine and identification of the transformation products.

    PubMed

    Kosjek, Tina; Negreira, Noelia; Heath, Ester; López de Alda, Miren; Barceló, Damià

    2018-01-01

    This study aims to identify (bio)transformation products of vincristine, a plant alkaloid chemotherapy drug. A batch biotransformation experiment was set-up using activated sludge at two concentration levels with and without the addition of a carbon source. Sample analysis was performed on an ultra-high performance liquid chromatograph coupled to a high-resolution hybrid quadrupole-Orbitrap tandem mass spectrometer. To identify molecular ions of vincristine transformation products and to propose molecular and chemical structures, we performed data-dependent acquisition experiments combining full-scan mass spectrometry data with product ion spectra. In addition, the use of non-commercial detection and prediction algorithms such as MZmine 2 and EAWAG-BBD Pathway Prediction System, was proven to be proficient for screening for transformation products in complex wastewater matrix total ion chromatograms. In this study eleven vincristine transformation products were detected, nine of which were tentatively identified. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Antimicrobial activity of the essential oil obtained from roots and chemical composition of the volatile constituents from the roots, stems, and leaves of Ballota nigra from Serbia.

    PubMed

    Vukovic, Nenad; Sukdolak, Slobodan; Solujic, Slavica; Niciforovic, Neda

    2009-04-01

    The chemical composition of essential oils obtained from the roots, stems, and leaves of Ballota nigra, growing in Serbia, was investigated by gas chromatography/mass spectrometry analyses. Kovats indices, mass spectra, and standard compounds were used to identify a total of 115 individual compounds. The plant produces two types of essential oils. Oils derived from stems and leaves were sesquiterpene rich (78.17% and 88.40%, respectively), containing principally beta-caryophyllene, germacrene D, and alpha-humulene, present in appreciable amounts. In contrast, oil derived from the root was dominated by p-vinylguiacol (9.24%), borneol (7.51%), myrtenol (7.13%), trans-pinocarveol (5.22%), pinocarvone (4.37%), 2-methyl-3-phenylpropanal (4.32%), and p-cymen-8-ol (4.30%). Essential oil obtained from the roots was evaluated for the antimicrobial activity against seven bacterial species and one fungi.

  15. Long Work Hours and Adiposity Among Police Officers in a US Northeast City

    PubMed Central

    Gu, Ja K.; Charles, Luenda E.; Burchfiel, Cecil M.; Fekedulegn, Desta; Sarkisian, Khachatur; Andrew, Michael E.; Ma, Claudia; Violanti, John M.

    2015-01-01

    Objective To investigate the associations between long work hours and adiposity measures in police officers. Methods Participants included 408 officers from the Buffalo Cardio-Metabolic Occupational Police Stress study who were examined between 2004 and 2009. Total work hours were abstracted from payroll records and questionnaires. Analysis of variance and covariance models were used. Results Among male officers who worked the midnight shift, mean values of waist circumference and body mass index increased with longer work hours after adjustment for age, physical activity, energy intake, sleep duration, smoking status, police rank, activities after work (eg, child/family care, sports), and household income. Adiposity measures were not associated with work hours among women on any shift. Conclusion Working longer hours was significantly associated with larger waist circumferences and higher body mass index among male police officers working the midnight shift. PMID:23013913

  16. Copper sulphate (CuSO4) toxicity on tissue phosphatases activity and carbohydrates turnover in Achatina fulica.

    PubMed

    Ramalingam, K; Indra, D

    2002-04-01

    A time course study on the sublethal toxicity of CuSO4 on tissue carbohydrate metabolites level and their phosphatases activity in Achatina fulica revealed differential response. The levels of total carbohydrates and glycogen in the body mass muscle, foot muscle and hemolymph revealed their involvement in the endogenous derivation of energy during stress. The same metabolites in digestive gland revealed its importance to reproduction and development. The lactate accumulated in all the tissues implied the mechanism of CuSO4 toxicosis in the metabolic acidosis. The decrease of pyruvate in foot muscle, body mass muscle and hemolymph inferred the preponderance of glycolysis in energy derivation. In contrast, the pyruvate concentration in digestive gland revealed its differential response in the stress metabolic sequence of changes, as a unique tissue. The lactate/pyruvate ratio and the calcium content in tissues constitute direct evidences for the snails adaptation to toxic stress.

  17. The relationship between objectively assessed physical activity and bone health in older adults differs by sex and is mediated by lean mass.

    PubMed

    McMillan, L B; Aitken, D; Ebeling, P; Jones, G; Scott, D

    2018-03-12

    Relationships between objectively assessed free-living physical activity (PA) and changes in bone health over time are poorly understood in older adults. This study suggests these relationships are sex-specific and that body composition may influence the mechanical loading benefits of PA. To investigate associations of objectively assessed PA and bone health in community-dwelling older adults. This secondary analysis of a subset of the Tasmanian Older Adult Cohort study included participants with PA assessed utilising ActiGraph GT1M accelerometers over 7 days (N = 209 participants, 53% female; mean ± SD age 64.5 ± 7.2 years). Steps/day and PA intensity were estimated via established thresholds. Bone mineral content (BMC) was acquired at the total hip, lumbar spine, legs and whole body by DXA at baseline and approximately 2.2 years later. Relationships between PA and BMC were assessed by multivariable linear regression analyses adjusted for age, smoking status, height and total lean mass. Men with above-median total hip BMC completed significantly less steps per day, but there was no significant difference in PA intensity compared with those with below-median BMC. There were no significant differences in PA in women stratified by median BMC. In women, steps/day were positively associated with leg BMC (B = 0.178; P = 0.017), and sedentary behaviour was negatively associated with leg BMC (- 0.165; 0.016) at baseline. After adjustment for confounders including lean mass and height, higher sedentary behaviour at baseline was associated with declines in femoral neck BMC (- 0.286; 0.011) but also with increases in pelvic BMC (0.246; 0.030) in men and increases in total hip BMC (0.215; 0.032) in women, over 2.2 years. No other significant longitudinal associations were observed after adjustment for body composition. Associations of accelerometer-determined sedentary behaviour and PA with bone health in older adults differ by sex and anatomical site and are mediated by body composition.

  18. In situ chemical composition measurement of individual cloud residue particles at a mountain site, southern China

    NASA Astrophysics Data System (ADS)

    Lin, Qinhao; Zhang, Guohua; Peng, Long; Bi, Xinhui; Wang, Xinming; Brechtel, Fred J.; Li, Mei; Chen, Duohong; Peng, Ping'an; Sheng, Guoying; Zhou, Zhen

    2017-07-01

    To investigate how atmospheric aerosol particles interact with chemical composition of cloud droplets, a ground-based counterflow virtual impactor (GCVI) coupled with a real-time single-particle aerosol mass spectrometer (SPAMS) was used to assess the chemical composition and mixing state of individual cloud residue particles in the Nanling Mountains (1690 m a. s. l. ), southern China, in January 2016. The cloud residues were classified into nine particle types: aged elemental carbon (EC), potassium-rich (K-rich), amine, dust, Pb, Fe, organic carbon (OC), sodium-rich (Na-rich) and Other. The largest fraction of the total cloud residues was the aged EC type (49.3 %), followed by the K-rich type (33.9 %). Abundant aged EC cloud residues that mixed internally with inorganic salts were found in air masses from northerly polluted areas. The number fraction (NF) of the K-rich cloud residues increased within southwesterly air masses from fire activities in Southeast Asia. When air masses changed from northerly polluted areas to southwesterly ocean and livestock areas, the amine particles increased from 0.2 to 15.1 % of the total cloud residues. The dust, Fe, Pb, Na-rich and OC particle types had a low contribution (0.5-4.1 %) to the total cloud residues. Higher fraction of nitrate (88-89 %) was found in the dust and Na-rich cloud residues relative to sulfate (41-42 %) and ammonium (15-23 %). Higher intensity of nitrate was found in the cloud residues relative to the ambient particles. Compared with nonactivated particles, nitrate intensity decreased in all cloud residues except for dust type. To our knowledge, this study is the first report on in situ observation of the chemical composition and mixing state of individual cloud residue particles in China.

  19. Total molecular gas masses of Planck - Herschel selected strongly lensed hyper luminous infrared galaxies

    NASA Astrophysics Data System (ADS)

    Harrington, K. C.; Yun, M. S.; Magnelli, B.; Frayer, D. T.; Karim, A.; Weiß, A.; Riechers, D.; Jiménez-Andrade, E. F.; Berman, D.; Lowenthal, J.; Bertoldi, F.

    2018-03-01

    We report the detection of CO(1-0) line emission from seven Planck and Herschel selected hyper luminous ({L_{IR (8-1000{μ m})} > 10^{13} L_{⊙}) infrared galaxies with the Green Bank Telescope (GBT). CO(1-0) measurements are a vital tool to trace the bulk molecular gas mass across all redshifts. Our results place tight constraints on the total gas content of these most apparently luminous high-z star-forming galaxies (apparent IR luminosities of LIR > 1013 - 14 L⊙), while we confirm their predetermined redshifts measured using the Large Millimeter Telescope, LMT (zCO = 1.33-3.26). The CO(1-0) lines show similar profiles as compared to Jup = 2-4 transitions previously observed with the LMT. We report enhanced infrared to CO line luminosity ratios of < L_IR / L^' }_{CO(1-0)} > = 110 ± 22 L_{⊙} (K km s^{-1} pc^{-2})^{-1} compared to normal star-forming galaxies, yet similar to those of well-studied IR-luminous galaxies at high-z. We find average brightness temperature ratios of 〈 r21〉 = 0.93 (2 sources), 〈 r31〉 = 0.34 (5 sources), and 〈 r41〉 = 0.18 (1 source). The r31 and r41 values are roughly half the average values for SMGs. We estimate the total gas mass content as {μ M_{H2} = (0.9-27.2) × 10^{11} (α _CO/0.8) M_{⊙}, where μ is the magnification factor and αCO is the CO line luminosity to molecular hydrogen gas mass conversion factor. The rapid gas depletion times, < τ_depl > = 80} Myr, reveal vigorous starburst activity, and contrast the Gyr depletion time-scales observed in local, normal star-forming galaxies.

  20. Effect of Training Status on Oxygen Consumption in Women After Resistance Exercise.

    PubMed

    Benton, Melissa J; Waggener, Green T; Swan, Pamela D

    2016-03-01

    This study compared acute postexercise oxygen consumption in 11 trained women (age, 46.5 ± 1.6 years; body mass index [BMI], 28.4 ± 1.7 kg·m(-2) and 11 untrained women (age, 46.5 ± 1.5 years; BMI, 27.5 ± 1.5 kg·m(-2)) after resistance exercise (RE). Resistance exercise consisted of 3 sets of 8 exercises (8-12 repetitions at 50-80% 1 repetition maximum). Oxygen consumption (VO2 ml·min(-1)) was measured before and after (0, 20, 40, 60, 90, and 120 minutes) RE. Immediately after cessation of RE (time 0), oxygen consumption increased in both trained and untrained women and remained significantly above baseline through 60 minutes after exercise (p < 0.01). Total oxygen consumption during recovery was 31.3 L in trained women and 27.4 L in untrained women (p = 0.07). In trained women, total oxygen consumption was strongly related to absolute (kg) lean mass (r = 0.88; p < 0.001), relative (kilogram per square meter) lean mass (r = 0.91; p < 0.001), and duration of exercise (r = 0.68; p ≤ 0.05), but in untrained women, only training volume-load was related to total oxygen consumption (r = 0.67; p ≤ 0.05). In trained women, 86% of the variance in oxygen consumption was explained by lean mass and exercise duration, whereas volume-load explained 45% in untrained women. Our findings suggest that, in women, resistance training increases metabolic activity of lean tissue. Postexercise energy costs of RE are determined by the duration of stimulation provided by RE rather than absolute work (volume-load) performed. This phenomenon may be related to type II muscle fibers and increased protein synthesis.

  1. The association of change in physical activity and body weight in the regulation of total energy expenditure.

    PubMed

    Drenowatz, C; Hill, J O; Peters, J C; Soriano-Maldonado, A; Blair, S N

    2017-03-01

    The limited success in addressing the current obesity epidemic reflects the insufficient understanding of the regulation of energy balance. The present study examines the longitudinal association of body weight with physical activity (PA), total daily energy expenditure (TDEE) and total daily energy intake (TDEI). A total of 195 adults (52% male) between 21 and 35 years of age with no intention for weight loss were followed over a 2-year period. Body weight, fat mass and fat-free mass were measured every 3 months. Participants were stratified into three groups based on change in body weight using a 5% cutpoint. TDEE and time spent in different PA intensities were determined via a multisensor device at each measurement time. TDEI was calculated based on change in body composition and TDEE. At 2-year follow-up, 57% of the participants maintained weight, 14% lost weight and 29% gained weight. Average weight change was -6.9±3.4 and 7.1±3.6 kg in the weight-loss and weight-gain groups, respectively. Average TDEE and TDEI did not change significantly in any weight change group (P>0.16). Moderate-to-vigorous PA, however, increased significantly in the weight-loss group (35±49 min/day; P<0.01) and decreased in the weight-gain group (-35±46 min/day; P<0.01). Results of this observational study indicate an inverse association between body weight and PA to maintain a stable TDEE and allow for a stable TDEI over time. Sufficient PA levels, therefore, are an important contributor to weight loss maintenance.

  2. Physical Activity and Pediatric Obesity: A Quantile Regression Analysis

    PubMed Central

    Mitchell, Jonathan A.; Dowda, Marsha; Pate, Russell R.; Kordas, Katarzyna; Froberg, Karsten; Sardinha, Luís B.; Kolle, Elin; Page, Angela

    2016-01-01

    Purpose We aimed to determine if moderate-to-vigorous physical activity (MVPA) and sedentary behavior (SB) were independently associated with body mass index (BMI) and waist circumference (WC) in children and adolescents. Methods Data from the International Children’s Accelerometry Database (ICAD) were used to address our objectives (N=11,115; 6-18y; 51% female). We calculated age and gender specific body mass index (BMI) and waist circumference (WC) Z-scores and used accelerometry to estimate MVPA and total SB. Self-reported television viewing was used as a measure of leisure time SB. Quantile regression was used to analyze the data. Results MVPA and total SB were associated with lower and higher BMI and WC Z-scores, respectively. These associations were strongest at the higher percentiles of the Z-score distributions. After including MVPA and total SB in the same model the MVPA associations remained, but the SB associations were no longer present. For example, each additional hour per day of MVPA was not associated with BMI Z-score at the 10th percentile (b=-0.02, P=0.170), but was associated with lower BMI Z-score at the 50th (b=-0.19, P<0.001) and 90th percentiles (b=-0.41, P<0.001). More television viewing was associated with higher BMI and WC and the associations were strongest at the higher percentiles of the Z-score distributions, with adjustment for MVPA and total SB. Conclusions Our observation of stronger associations at the higher percentiles indicate that increasing MVPA and decreasing television viewing at the population-level could shift the upper tails of the BMI and WC frequency distributions to lower values, thereby lowering the number of children and adolescents classified as obese. PMID:27755284

  3. [Influence of hormonal contraceptives on indices of zinc homeostasis and bone remodeling in young adult women].

    PubMed

    Simões, Tania Mara Rodrigues; Zapata, Carmiña Lucía Vargas; Donangelo, Carmen Marino

    2015-09-01

    To investigate the influence of the use of oral hormonal contraceptive agents (OCA) on the biochemical indices related to metabolic zinc utilization and distribution, and to bone turnover in young adult women. Cross-sectional study. Blood and urine samples from non-users (-OCA; control; n=69) and users of hormonal contraceptives for at least 3 months (+OCA; n=62) were collected under controlled conditions. Indices of zinc homeostasis and of bone turnover were analyzed in serum or plasma (total, albumin-bound and α2-macroglobulin-bound zinc, albumin and total and bone alkaline phosphatase activity), in erythrocytes (zinc and metallothionein) and in urine (zinc, calcium and hydroxyproline). The habitual zinc and calcium intakes were evaluated by a food frequency questionnaire. Dietary zinc intake was similar in both groups and on average above recommended values, whereas calcium intake was similarly sub-adequate in +OCA and -OCA. Compared to controls, +OCA had lower concentrations of total and α2-macroglobulin-bound zinc (11 and 28.5%, respectively, p<0.001), serum albumin (13%, p<0.01), total and bone-specific alkaline phosphatase activity (13 and 18%, respectively, p<0.05), erythrocyte metallothionein (13%, p<0.01), and, urinary zinc (34%, p<0.05). OCA use decreases serum zinc, alters zinc distribution in major serum fractions with possible effects on tissue uptake, enhances zinc retention in the body and decreases bone turnover. Prolonged OCA use may lead to lower peak bone mass and/or to impaired bone mass maintenance in young women, particularly in those with marginal calcium intake. The observed OCA effects were more evident in women younger than 25 years and in nulliparous women, deserving special attention in future studies.

  4. Effects of Gymnastics Activities on Bone Accrual during Growth: A Systematic Review.

    PubMed

    Jürimäe, Jaak; Gruodyte-Raciene, Rita; Baxter-Jones, Adam D G

    2018-06-01

    The amount of bone gained during childhood and adolescence impacts greatly on lifetime skeletal health. The purpose of this review is to summarize current evidence of the effects of gymnastics activities on bone mineral accrual during growth and to describe possible factors that influence bone mineral gains. The PubMed and SportDiscus databases were searched, and a total of 24 articles met the selection criteria and were included in this review. Artistic and rhythmic gymnasts presented higher bone mineral density and content values compared to untrained controls, despite possible negative effects associated with hormonal levels, dietary restrictions and body fat. The results suggest that gymnasts had similar bone turnover values compared to untrained controls. High-intensity mechanical loading of gymnastics activity appears to increase bone development and counterbalance negative effects, such as later pubertal development, lower body fat mass and lower hormone levels. In conclusion, gymnasts present higher bone mineral values in comparison with untrained controls. The osteogenic effect of gymnastics athletic activity has a positive influence on bone mineral accrual and overcomes the possible negative influence of high athletic activity that may cause negative energy balance and low body fat mass which are associated with lower bone accrual.

  5. Mass balance of a highly active rock glacier during the period 1954 and 2016

    NASA Astrophysics Data System (ADS)

    Kellerer-Pirklbauer, Andreas; Kaufmann, Viktor; Rieckh, Matthias

    2017-04-01

    Active rock glaciers are creep phenomena of permafrost in high-relief terrain moving slowly downwards and are often characterised by distinct flow structures with ridges and furrows. Active rock glaciers consist of ice and rock material. The ice component might be either congelation (refreezing of liquid water) or sedimentary ('glacier') ice whereas the rock material might be either of periglacial or glacial origin. The formation period of rock glaciers lasts for centuries to millennia as judged from relative or absolute dating approaches. The input of ice and debris onto the rock glacier mass transport system over such long periods might change substantially over time. Long-term monitoring of mass transport, mass changes and nourishment processes of rock glaciers are rare. In this study we analysed on a decadal-scale mass transport (based on photogrammetric and geodetic data; series 1969-2016), mass changes (geodetically-based mass balance quantification; series 1954-2012), and mass input (based on optical data from an automatic digital camera; series 2006-2016) onto the Hinteres Langtal Rock Glacier. This rock glacier is 900 m long, up to 300 m wide, covers an area of 0.17 km2 and is one of the most active ones in the Eastern European Alps. Mass transport rates at the surface indicate relatively low mean annual surface velocities until the beginning of this millennium. A first peak in the horizontal surface velocity was reached in 2003/04 followed by a period of deceleration until 2007/08. Afterwards the rates increased again substantially from year to year with maximum values in 2014/15 (exceeding 6 m/a). This increase in surface velocities during the last decades was accompanied by crevasse formation and landslide activities at its front. Mass changes show for all six analysed periods between 1954 and 2012 a clear negative surface elevation change with mean annual values ranging from -0.016 to -0.058 m/a. This implies a total volume decrease of -435,895 m3 (averaging to -7515 m3/a) over the 58-year period at the rock glacier system. The only area of substantial surface elevation gain was during all periods the rock glacier front indicating a rock glacier advance. Mass input onto the rock glacier transport system was assessed analysing 2044 terrestrial images taken automatically between September 2006 and August 2016 from the main rooting zone of the rock glacier. Results indicate that neither snow and ice nor rock material have been transported in large quantities to the rock glacier system during the 10 year monitoring period. Notable mass movement events have been detected only six times. Perennial snow patches in the rooting zone of the rock glacier only survived on average every second summer. We conclude that the rates of rock glacier mass transport and volumetric losses of the rock glacier are far higher than debris and ice input. This rock glacier is clearly in a state of detachment from its nourishment area and prone to starvation which will eventually lead to rock glacier inactivation. This is a feasible fate for many currently active rock glaciers in the European Alps.

  6. The Role of Storage Lipids in the Relation between Fecundity, Locomotor Activity, and Lifespan of Drosophila melanogaster Longevity-Selected and Control Lines

    PubMed Central

    Nasiri Moghadam, Neda; Holmstrup, Martin; Manenti, Tommaso; Brandt Mouridsen, Marie; Pertoldi, Cino; Loeschcke, Volker

    2015-01-01

    The contribution of insect fat body to multiple processes, such as development, metamorphosis, activity, and reproduction results in trade-offs between life history traits. In the present study, age-induced modulation of storage lipid composition in Drosophila melanogaster longevity-selected (L) and non-selected control (C) lines was studied and the correlation between total body fat mass and lifespan assessed. The trade-offs between fecundity, locomotor activity, and lifespan were re-evaluated from a lipid-related metabolic perspective. Fewer storage lipids in the L lines compared to the C lines supports the impact of body fat mass on extended lifespan. The higher rate of fecundity and locomotor activity in the L lines may increase the lipid metabolism and enhance the lipolysis of storage lipids, reducing fat reserves. The correlation between neutral lipid fatty acids and fecundity, as well as locomotor activity, varied across age groups and between the L and C lines. The fatty acids that correlated with egg production were different from the fatty acids that correlated with locomotor activity. The present study suggests that fecundity and locomotor activity may positively affect the lifespan of D. melanogaster through the inhibition of fat accumulation. PMID:26115349

  7. The influence of dairy consumption and physical activity on ultrasound bone measurements in Flemish children.

    PubMed

    De Smet, Stephanie; Michels, Nathalie; Polfliet, Carolien; D'Haese, Sara; Roggen, Inge; De Henauw, Stefaan; Sioen, Isabelle

    2015-03-01

    The study's aim was to analyse whether children's bone status, assessed by calcaneal ultrasound measurements, is influenced by dairy consumption and objectively measured physical activity (PA). Moreover, the interaction between dairy consumption and PA on bone mass was studied. Participants of this cross-sectional study were 306 Flemish children (6-12 years). Body composition was measured with air displacement plethysmography (BodPod), dairy consumption with a Food Frequency Questionnaire, PA with an accelerometer (only in 234 of the 306 children) and bone mass with quantitative ultrasound, quantifying speed of sound (SOS), broadband ultrasound attenuation (BUA) and Stiffness Index (SI). Regression analyses were used to study the associations between dairy consumption, PA, SOS, BUA and SI. Total dairy consumption and non-cheese dairy consumption were positively associated with SOS and SI, but no significant association could be demonstrated with BUA. In contrast, milk consumption, disregarding other dairy products, had no significant effect on calcaneal bone measurements. PA [vigorous PA, moderate to vigorous physical activity (MVPA) and counts per minute] was positively associated and sedentary time was negatively associated with BUA and SI, but no significant influence on SOS could be detected. Dairy consumption and PA (sedentary time and MVPA) did not show any interaction influencing bone measurements. In conclusion, even at young age, PA and dairy consumption positively influence bone mass. Promoting PA and dairy consumption in young children may, therefore, maximize peak bone mass, an important protective factor against osteoporosis later in life.

  8. BL Lacertae: X-ray spectral evolution and a black-hole mass estimate

    NASA Astrophysics Data System (ADS)

    Titarchuk, Lev; Seifina, Elena

    2017-06-01

    We present an analysis of the spectral properties observed in X-rays from active galactic nucleus BL Lacertae using RXTE, Suzaku, ASCA, BeppoSAX, and Swift observations. The total time covered by these observations is approximately 20 yr. We show strong observational evidence that this source undergoes X-ray spectral transitions from the low hard state (LHS) through the intermediate state (IS) to the high soft state (HSS) during these observations. During the RXTE observations (1997-2001, 180 ks, for a total 145 datasets), the source was approximately 75%, 20% and only 5% of the time in the IS, LHS, and HSS, respectively. We also used Swift observations (470 datasets, for a total 800 ks), which occurred during 12 yr (2005-2016), the broadband (0.3-200 keV) data of BeppoSAX (1997-2000, 160 ks), and the low X-ray energy (0.3-10 keV) data of ASCA (1995-1999, 160 ks). Two observations of Suzaku (2006, 2013; 50 ks) in combinations with long-term RXTE and Swift data-sets fortunately allow us to describe all spectral states of BL Lac. The spectra of BL Lac are well fitted by the so-called bulk motion Comptonization (BMC) model for all spectral states. We have established the photon index saturation level, Γsat = 2.2 ± 0.1, in the Γ versus mass accretion rate (Ṁ) correlation. This Γ - Ṁ correlation allows us to estimate the black-hole (BH) mass in BL Lac to be MBH 3 × 107M⊙ for a distance of 300 Mpc. For the BH mass estimate, we use the scaling method taking stellar-mass Galactic BHs 4U 1543-47 and GX 339-4 as reference sources. The Γ - Ṁ correlation revealed in BL Lac is similar to those in a number of stellar-mass Galactic BHs and two recently studied intermediate-mass extragalactic BHs. It clearly shows the correlation along with the very extended Γ saturation at 2.2. This is robust observational evidence for the presence of a BH in BL Lac. We also reveal that the seed (disk) photon temperatures are relatively low, of order of 100 eV, which are consistent with a high BH mass in BL Lac. It is worthwhile to emphasize that we found particular events when X-ray emission anti-correlates with radio emission. This effect indicates that mass accretion rate (and thus X-ray radiation) is higher when the mass outflow is lower.

  9. Substantial Humic Acid Adsorption to Activated Carbon Air Cathodes Produces a Small Reduction in Catalytic Activity.

    PubMed

    Yang, Wulin; Watson, Valerie J; Logan, Bruce E

    2016-08-16

    Long-term operation of microbial fuel cells (MFCs) can result in substantial degradation of activated carbon (AC) air-cathode performance. To examine a possible role in fouling from organic matter in water, cathodes were exposed to high concentrations of humic acids (HA). Cathodes treated with 100 mg L(-1) HA exhibited no significant change in performance. Exposure to 1000 mg L(-1) HA decreased the maximum power density by 14% (from 1310 ± 30 mW m(-2) to 1130 ± 30 mW m(-2)). Pore blocking was the main mechanism as the total surface area of the AC decreased by 12%. Minimization of external mass transfer resistances using a rotating disk electrode exhibited only a 5% reduction in current, indicating about half the impact of HA adsorption was associated with external mass transfer resistance and the remainder was due to internal resistances. Rinsing the cathodes with deionized water did not restore cathode performance. These results demonstrated that HA could contribute to cathode fouling, but the extent of power reduction was relatively small in comparison to large mass of humics adsorbed. Other factors, such as biopolymer attachment, or salt precipitation, are therefore likely more important contributors to long-term fouling of MFC cathodes.

  10. Association between VDR and ESR1 gene polymorphisms with bone and obesity phenotypes in Chinese male nuclear families.

    PubMed

    Gu, Jie-mei; Xiao, Wen-jin; He, Jin-wei; Zhang, Hao; Hu, Wei-wei; Hu, Yun-qiu; Li, Miao; Liu, Yu-juan; Fu, Wen-zhen; Yu, Jin-bo; Gao, Gao; Yue, Hua; Ke, Yao-hua; Zhang, Zhen-lin

    2009-12-01

    The goal of this study was to determine whether polymorphisms in the vitamin D receptor (VDR) and estrogen receptor alpha (ESR1) genes are associated with variations of peak bone mineral density (BMD) and obesity phenotypes in young Chinese men. A total of 1215 subjects from 400 Chinese nuclear families were genotyped by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) and allele-specific multiple PCR (ASM-PCR) analysis at the ApaI, FokI, and CDX2 sites in the VDR gene and the PvuII and XbaI sites in the ESR1 gene. BMD at the lumbar spine and hip, total fat mass, and total lean mass were measured using dual energy X-ray absorptiometry. The associations between VDR and ESR1 gene polymorphisms with peak BMD, body mass index (BMI), total fat mass, total lean mass, and percentage fat mass (PFM) were determined using quantitative transmission disequilibrium tests (QTDTs). Using QTDTs, no significant within-family associations were obtained between genotypes or haplotypes of the VDR and ESR1 genes and peak BMD. For the obesity phenotypes, the within-family associations were significant between CDX2 genotypes and BMI (P=0.046), fat mass (P=0.004), and PFM (P=0.020). Further, PvuII was significantly associated with the variation of fat mass and PFM (P=0.002 and P=0.039, respectively). A subsequent 1000 permutations were in agreement with these within-family association results. Our findings showed that VDR and ESR1 polymorphisms were associated with total fat mass in young Chinese men, but we failed to find a significant association between VDR and ESR1 genotypes and peak BMD. These findings suggested that the VDR and ESR1 genes are quantitative trait loci (QTL) underlying fat mass variation in young Chinese men.

  11. Effects of lifestyle intervention on dietary intake, physical activity level, and gestational weight gain in pregnant women with different pre-pregnancy Body Mass Index in a randomized control trial.

    PubMed

    Hui, Amy Leung; Back, Lisa; Ludwig, Sora; Gardiner, Phillip; Sevenhuysen, Gustaaf; Dean, Heather J; Sellers, Elisabeth; McGavock, Jonathan; Morris, Margaret; Jiang, Depeng; Shen, Garry X

    2014-09-24

    The objectives of this study were to assess the efficacy of lifestyle intervention on gestational weight gain in pregnant women with normal and above normal body mass index (BMI) in a randomized controlled trial. A total of 116 pregnant women (<20 weeks of pregnancy) without diabetes were enrolled and 113 pregnant women completed the program. Participants were randomized into intervention and control groups. Women in the intervention group received weekly trainer-led group exercise sessions, instructed home exercise for 3-5-times/week during 20-36 weeks of gestation, and dietary counseling twice during pregnancy. Participants in the control group did not receive the intervention. All participants completed a physical activity questionnaire and a 3-day food record at enrolment and 2 months after enrolment. The participants in the intervention group with normal pre-pregnancy BMI (≤24.9 kg/M2, n = 30) had lower gestational weight gain (GWG), offspring birth weight and excessive gestational weight gain (EGWG) on pregnancy weight gain compared to the control group (n = 27, p < 0.05). Those weight related-changes were not detected between the intervention (n = 27) and control group (n = 29) in the above normal pre-pregnancy BMI participants. Intervention reduced total calorie, total fat, saturated fat and cholesterol intake were detected in women with normal or above normal pre-pregnancy BMI compared to the control group (p < 0.05 or 0.01). Increased physical activity and reduced carbohydrate intake were detected in women with normal (p < 0.05), but not above normal, pre-pregnancy BMI at 2 months after the onset of the intervention compared to the control group. The results of the present study demonstrated that the lifestyle intervention program decreased EGWG, GWG, offspring birth weight in pregnant women with normal, but not above normal, pre-pregnancy BMI, which was associated with increased physical activity and decreased carbohydrate intake. NCT00486629.

  12. Single-limb drop landing biomechanics in active individuals with and without a history of anterior cruciate ligament reconstruction: A total support analysis.

    PubMed

    Pozzi, Federico; Di Stasi, Stephanie; Zeni, Joseph A; Barrios, Joaquin A

    2017-03-01

    The purpose of this study was to characterize the magnitude and distribution of the total support moment during single-limb drop landings in individuals after anterior cruciate ligament reconstruction compared to a control group. Twenty participants after reconstruction and twenty control participants matched on sex, limb dominance and activity level were recruited. Motion analysis was performed during a single-limb drop landing task. Total support moment was determined by summing the internal extensor moments at the ankle, knee, and hip. Each relative joint contribution to the total support moment was calculated by dividing each individual contribution by the total support moment. Data were captured during a landing interval that started at initial contact and ended at the lowest vertical position of the pelvis. Data were then time-normalized and indexed at 25, 50, 75, and 100% of the landing interval. No between-group differences for total support moment magnitude were observed. At both 75% and 100% of the landing, the relative contribution of the knee joint was lower in those with a history of surgery (p<0.001). At the same instances, the relative contribution to the total support moment by the hip joint was greater in those with a history of surgery (p=0.004). In active participants after anterior cruciate ligament reconstruction, relative contributions to anti-gravity support of the center of mass shifted from the knee to the hip joint during single-limb landing, which became evident towards the end of the landing interval. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Evaporation of planetary atmospheres due to XUV illumination by quasars

    NASA Astrophysics Data System (ADS)

    Forbes, John C.; Loeb, Abraham

    2018-06-01

    Planetary atmospheres are subject to mass loss through a variety of mechanisms including irradiation by XUV photons from their host star. Here we explore the consequences of XUV irradiation by supermassive black holes as they grow by the accretion of gas in galactic nuclei. Based on the mass distribution of stars in galactic bulges and disks and the luminosity history of individual black holes, we estimate the probability distribution function of XUV fluences as a function of galaxy halo mass, redshift, and stellar component. We find that about 50% of all planets in the universe may lose a mass of hydrogen of ˜2.5 × 1019 g (the total mass of the Martian atmosphere), 10% may lose ˜5.1 × 1021 g (the total mass of Earth's atmosphere), and 0.2% may lose ˜1.4 × 1024 g (the total mass of Earth's oceans). The fractions are appreciably higher in the spheroidal components of galaxies, and depend strongly on galaxy mass, but only weakly on redshift.

  14. Galactic Dark Matter Halos and Globular Cluster Populations. III. Extension to Extreme Environments

    NASA Astrophysics Data System (ADS)

    Harris, William E.; Blakeslee, John P.; Harris, Gretchen L. H.

    2017-02-01

    The total mass {M}{GCS} in the globular cluster (GC) system of a galaxy is empirically a near-constant fraction of the total mass {M}h\\equiv {M}{bary}+{M}{dark} of the galaxy across a range of 105 in galaxy mass. This trend is radically unlike the strongly nonlinear behavior of total stellar mass M ⋆ versus M h . We discuss extensions of this trend to two more extreme situations: (a) entire clusters of galaxies and (b) the ultra-diffuse galaxies (UDGs) recently discovered in Coma and elsewhere. Our calibration of the ratio {η }M={M}{GCS}/{M}h from normal galaxies, accounting for new revisions in the adopted mass-to-light ratio for GCs, now gives {η }M=2.9× {10}-5 as the mean absolute mass fraction. We find that the same ratio appears valid for galaxy clusters and UDGs. Estimates of {η }M in the four clusters we examine tend to be slightly higher than for individual galaxies, but more data and better constraints on the mean GC mass in such systems are needed to determine if this difference is significant. We use the constancy of {η }M to estimate total masses for several individual cases; for example, the total mass of the Milky Way is calculated to be {M}h=1.1× {10}12 {M}⊙ . Physical explanations for the uniformity of {η }M are still descriptive, but point to a picture in which massive dense star clusters in their formation stages were relatively immune to the feedback that more strongly influenced lower-density regions where most stars form.

  15. Effect of High-Intensity Interval Training on Total, Abdominal and Visceral Fat Mass: A Meta-Analysis.

    PubMed

    Maillard, Florie; Pereira, Bruno; Boisseau, Nathalie

    2018-02-01

    High-intensity interval training (HIIT) is promoted as a time-efficient strategy to improve body composition. The aim of this meta-analysis was to assess the efficacy of HIIT in reducing total, abdominal, and visceral fat mass in normal-weight and overweight/obese adults. Electronic databases were searched to identify all related articles on HIIT and fat mass. Stratified analysis was performed using the nature of HIIT (cycling versus running, target intensity), sex and/or body weight, and the methods of measuring body composition. Heterogeneity was also determined RESULTS: A total of 39 studies involving 617 subjects were included (mean age 38.8 years ± 14.4, 52% females). HIIT significantly reduced total (p = 0.003), abdominal (p = 0.007), and visceral (p = 0.018) fat mass, with no differences between the sexes. A comparison showed that running was more effective than cycling in reducing total and visceral fat mass. High-intensity (above 90% peak heart rate) training was more successful in reducing whole body adiposity, while lower intensities had a greater effect on changes in abdominal and visceral fat mass. Our analysis also indicated that only computed tomography scan or magnetic resonance imaging showed significant abdominal and/or visceral fat-mass loss after HIIT interventions. HIIT is a time-efficient strategy to decrease fat-mass deposits, including those of abdominal and visceral fat mass. There was some evidence of the greater effectiveness of HIIT running versus cycling, but owing to the wide variety of protocols used and the lack of full details about cycling training, further comparisons need to be made. Large, multicenter, prospective studies are required to establish the best HIIT protocols for reducing fat mass according to subject characteristics.

  16. Physical Fitness and Metabolic Syndrome in Children with Repaired Congenital Heart Disease Compared with Healthy Children.

    PubMed

    Zaqout, Mahmoud; Vandekerckhove, Kristof; Michels, Nathalie; Bove, Thierry; François, Katrien; De Wolf, Daniel

    2017-12-01

    To determine whether children who underwent surgery for congenital heart disease (CHD) are as fit as their peers. We studied 66 children (6-14 years) who underwent surgery for ventricular septal defect (n = 19), coarctation of aorta (n = 10), tetralogy of Fallot (n = 15), and transposition of great arteries (n = 22); and 520 healthy children (6-12 years). All children performed physical fitness tests: cardiorespiratory fitness, muscular strength, balance, flexibility, and speed. Metabolic score was assessed through z-score standardization using 4 components: waist circumference, blood pressure, blood lipids, and insulin resistance. Assessment also included self-reported and accelerometer-measured physical activity. Linear regression analyses with group (CHD vs control) as a predictor were adjusted for age, body mass index, physical activity, and parental education. Measured physical activity level, body mass index, cardiorespiratory fitness, flexibility, and total metabolic score did not differ between children with CHD and controls, whereas reported physical activity was greater in the CHD group than control group. Boys with CHD were less strong in upper muscular strength, speed, and balance, whereas girls with CHD were better in lower muscular strength and worse in balance. High-density lipoprotein was greater in boys and girls with CHD, whereas boys with CHD showed unhealthier glucose homeostasis. Appropriate physical fitness was achieved in children after surgery for CHD, especially in girls. Consequently, children with CHD were not at increased total metabolic risk. Lifestyle counseling should be part of every patient interaction. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Response functions for computing absorbed dose to skeletal tissues from photon irradiation—an update

    NASA Astrophysics Data System (ADS)

    Johnson, Perry B.; Bahadori, Amir A.; Eckerman, Keith F.; Lee, Choonsik; Bolch, Wesley E.

    2011-04-01

    A comprehensive set of photon fluence-to-dose response functions (DRFs) is presented for two radiosensitive skeletal tissues—active and total shallow marrow—within 15 and 32 bone sites, respectively, of the ICRP reference adult male. The functions were developed using fractional skeletal masses and associated electron-absorbed fractions as reported for the UF hybrid adult male phantom, which in turn is based upon micro-CT images of trabecular spongiosa taken from a 40 year male cadaver. The new DRFs expand upon both the original set of seven functions produced in 1985, and a 2007 update calculated under the assumption of secondary electron escape from spongiosa. In this study, it is assumed that photon irradiation of the skeleton will yield charged particle equilibrium across all spongiosa regions at energies exceeding 200 keV. Kerma coefficients for active marrow, inactive marrow, trabecular bone and spongiosa at higher energies are calculated using the DRF algorithm setting the electron-absorbed fraction for self-irradiation to unity. By comparing kerma coefficients and DRF functions, dose enhancement factors and mass energy-absorption coefficient (MEAC) ratios for active marrow to spongiosa were derived. These MEAC ratios compared well with those provided by the NIST Physical Reference Data Library (mean difference of 0.8%), and the dose enhancement factors for active marrow compared favorably with values calculated in the well-known study published by King and Spiers (1985 Br. J. Radiol. 58 345-56) (mean absolute difference of 1.9 percentage points). Additionally, dose enhancement factors for active marrow were shown to correlate well with the shallow marrow volume fraction (R2 = 0.91). Dose enhancement factors for the total shallow marrow were also calculated for 32 bone sites representing the first such derivation for this target tissue.

  18. Association of physical activity with body mass index, waist circumference and incidence of obesity in older adults.

    PubMed

    Cárdenas Fuentes, Gabriela; Bawaked, Rowaedh Ahmed; Martínez González, Miguel Ángel; Corella, Dolores; Subirana Cachinero, Isaac; Salas-Salvadó, Jordi; Estruch, Ramón; Serra-Majem, Lluis; Ros, Emilio; Lapetra Peralta, José; Fiol, Miguel; Rekondo, Javier; Gómez-Gracia, Enrique; Tur Marí, Josep Antoni; Pinto Sala, Xavier; Babio, Nancy; Ortega, Carolina; Martínez, José Alfredo; Schröder, Helmut

    2018-03-15

    There is limited, and inconsistent, data on the prospective association between physical activity and surrogate markers of adiposity in older adults. We aim to determine the prospective association of leisure time physical activity (LTPA) with body mass index (BMI), waist circumference (WC) and the incidence of obesity. This prospective analysis included 7144 individuals with a mean age of 67 ± 6.2 years, from the PREvención con DIeta MEDiterránea (PREDIMED) study. BMI and WC were measured and LTPA was recorded using the Minnesota Leisure Time Physical Activity Questionnaire. Exposure and outcome variables were calculated as cumulative average of repeated measurements. Total LTPA was inversely associated (P < 0.001) with BMI and WC. The difference in BMI and WC between extreme quintiles of LTPA (Q1-Q5) was 2.1 kg/m2 (95% confidence interval (CI) 1.68; 2.49, P < 0.001) and 4.8 cm (CI 2.28; 7.25, P < 0.001), respectively. Low-intensity LTPA was inversely associated with BMI but not with WC, while moderate/vigorous LTPA showed an inverse relationship with BMI and WC. The hazard of general and abdominal obesity incidence decreased across quintiles of total and moderate/vigorous LTPA (P < 0.001 for both), whereas low-intensity LTPA was inversely associated with the incidence of general obesity (P < 0.001). LTPA was inversely associated with BMI, WC and incidence of general and abdominal obesity. The finding that low-intensity LTPA was inversely related to BMI and the incidence of obesity is of particular importance because this level of physical activity could be a feasible option for many older adults.

  19. Response functions for computing absorbed dose to skeletal tissues from photon irradiation--an update.

    PubMed

    Johnson, Perry B; Bahadori, Amir A; Eckerman, Keith F; Lee, Choonsik; Bolch, Wesley E

    2011-04-21

    A comprehensive set of photon fluence-to-dose response functions (DRFs) is presented for two radiosensitive skeletal tissues-active and total shallow marrow-within 15 and 32 bone sites, respectively, of the ICRP reference adult male. The functions were developed using fractional skeletal masses and associated electron-absorbed fractions as reported for the UF hybrid adult male phantom, which in turn is based upon micro-CT images of trabecular spongiosa taken from a 40 year male cadaver. The new DRFs expand upon both the original set of seven functions produced in 1985, and a 2007 update calculated under the assumption of secondary electron escape from spongiosa. In this study, it is assumed that photon irradiation of the skeleton will yield charged particle equilibrium across all spongiosa regions at energies exceeding 200 keV. Kerma coefficients for active marrow, inactive marrow, trabecular bone and spongiosa at higher energies are calculated using the DRF algorithm setting the electron-absorbed fraction for self-irradiation to unity. By comparing kerma coefficients and DRF functions, dose enhancement factors and mass energy-absorption coefficient (MEAC) ratios for active marrow to spongiosa were derived. These MEAC ratios compared well with those provided by the NIST Physical Reference Data Library (mean difference of 0.8%), and the dose enhancement factors for active marrow compared favorably with values calculated in the well-known study published by King and Spiers (1985 Br. J. Radiol. 58 345-56) (mean absolute difference of 1.9 percentage points). Additionally, dose enhancement factors for active marrow were shown to correlate well with the shallow marrow volume fraction (R(2) = 0.91). Dose enhancement factors for the total shallow marrow were also calculated for 32 bone sites representing the first such derivation for this target tissue.

  20. RESPONSE FUNCTIONS FOR COMPUTING ABSORBED DOSE TO SKELETAL TISSUES FROM PHOTON IRRADIATION – AN UPDATE

    PubMed Central

    Johnson, Perry; Bahadori, Amir; Eckerman, Keith; Lee, Choonsik; Bolch, Wesley E.

    2014-01-01

    A comprehensive set of photon fluence-to-dose response functions (DRFs) are presented for two radiosensitive skeletal tissues – active and total shallow marrow – within 15 and 32 bones sites, respectively, of the ICRP reference adult male. The functions were developed using fractional skeletal masses and associated electron absorbed fractions as reported for the UF hybrid adult male phantom, which in turn is based upon microCT images of trabecular spongiosa taken from a 40-year male cadaver. The new DRFs expand upon both the original set of seven functions produced in 1985, as well as a 2007 update calculated under the assumption of secondary electron escape from spongiosa. In the present study, it is assumed that photon irradiation of the skeleton will yield charged particle equilibrium across all spongiosa regions at energies exceeding 200 keV. Kerma factors for active marrow, inactive marrow, trabecular bone, and spongiosa at higher energies are calculated using the DRF algorithm setting the electron absorbed fraction for self-irradiation to unity. By comparing kerma factors and DRF functions, dose enhancement factors and mass energy-absorption coefficient (MEAC) ratios for active marrow to spongiosa were derived. These MEAC ratios compared well with those provided by the NIST Physical Reference Data Library (mean difference of 0.8%), and the dose enhancement factors for active marrow compared favorably with values calculated in the well-known study published by King and Spiers (1985) (mean absolute difference of 1.9 percentage points). Additionally, dose enhancement factors for active marrow were shown to correlate well with the shallow marrow volume fraction (R2 = 0.91). Dose enhancement factors for the total shallow marrow were also calculated for 32 bone sites PMID:21427484

  1. Variable Cold-Induced Brown Adipose Tissue Response to Thyroid Hormone Status

    PubMed Central

    Hasselgren, Per-Olof; Glasgow, Allison; Doyle, Ashley N.; Lee, Alice J.; Fox, Peter; Gautam, Shiva; Hennessey, James V.; Kolodny, Gerald M.

    2017-01-01

    Background: In addition to its role in adaptive thermogenesis, brown adipose tissue (BAT) may protect from weight gain, insulin resistance/diabetes, and metabolic syndrome. Prior studies have shown contradictory results regarding the influence of thyroid hormone (TH) levels on BAT volume and activity. The aim of this pilot study was to gain further insights regarding the effect of TH treatment on BAT function in adult humans by evaluating the BAT mass and activity prospectively in six patients, first in the hypothyroid and then in the thyrotoxic phase. Methods: The study subjects underwent 18F-fluorodeoxyglucose positron emission tomography/computed tomography (PET/CT) scanning after cold exposure to measure BAT mass and activity while undergoing treatment for differentiated thyroid cancer, first while hypothyroid following TH withdrawal at the time of the radioactive iodine treatment and then three to six months after starting TH suppressive treatment when they were iatrogenically thyrotoxic. Thermogenic and metabolic parameters were measured in both phases. Results: All study subjects had detectable BAT under cold stimulation in both the hypothyroid and thyrotoxic state. The majority but not all (4/6) subjects showed an increase in detectable BAT volume and activity under cold stimulation between the hypothyroid and thyrotoxic phase (total BAT volume: 72.0 ± 21.0 vs. 87.7 ± 16.5 mL, p = 0.25; total BAT activity 158.1 ± 72.8 vs. 189.0 ± 55.5 SUV*g/mL, p = 0.34). Importantly, circulating triiodothyronine was a stronger predictor of energy expenditure changes compared with cold-induced BAT activity. Conclusions: Iatrogenic hypothyroidism lasting two to four weeks does not prevent cold-induced BAT activation, while the use of TH to induce thyrotoxicosis does not consistently increase cold-induced BAT activity. It remains to be determined which physiological factors besides TH play a role in regulating BAT function. PMID:27750020

  2. Variable Cold-Induced Brown Adipose Tissue Response to Thyroid Hormone Status.

    PubMed

    Gavrila, Alina; Hasselgren, Per-Olof; Glasgow, Allison; Doyle, Ashley N; Lee, Alice J; Fox, Peter; Gautam, Shiva; Hennessey, James V; Kolodny, Gerald M; Cypess, Aaron M

    2017-01-01

    In addition to its role in adaptive thermogenesis, brown adipose tissue (BAT) may protect from weight gain, insulin resistance/diabetes, and metabolic syndrome. Prior studies have shown contradictory results regarding the influence of thyroid hormone (TH) levels on BAT volume and activity. The aim of this pilot study was to gain further insights regarding the effect of TH treatment on BAT function in adult humans by evaluating the BAT mass and activity prospectively in six patients, first in the hypothyroid and then in the thyrotoxic phase. The study subjects underwent 18F-fluorodeoxyglucose positron emission tomography/computed tomography (PET/CT) scanning after cold exposure to measure BAT mass and activity while undergoing treatment for differentiated thyroid cancer, first while hypothyroid following TH withdrawal at the time of the radioactive iodine treatment and then three to six months after starting TH suppressive treatment when they were iatrogenically thyrotoxic. Thermogenic and metabolic parameters were measured in both phases. All study subjects had detectable BAT under cold stimulation in both the hypothyroid and thyrotoxic state. The majority but not all (4/6) subjects showed an increase in detectable BAT volume and activity under cold stimulation between the hypothyroid and thyrotoxic phase (total BAT volume: 72.0 ± 21.0 vs. 87.7 ± 16.5 mL, p = 0.25; total BAT activity 158.1 ± 72.8 vs. 189.0 ± 55.5 SUV*g/mL, p = 0.34). Importantly, circulating triiodothyronine was a stronger predictor of energy expenditure changes compared with cold-induced BAT activity. Iatrogenic hypothyroidism lasting two to four weeks does not prevent cold-induced BAT activation, while the use of TH to induce thyrotoxicosis does not consistently increase cold-induced BAT activity. It remains to be determined which physiological factors besides TH play a role in regulating BAT function.

  3. Association of regional body composition with bone mineral density in HIV-infected and HIV-uninfected women: women's interagency HIV study.

    PubMed

    Sharma, Anjali; Tian, Fang; Yin, Michael T; Keller, Marla J; Cohen, Mardge; Tien, Phyllis C

    2012-12-01

    To understand how regional body composition affects bone mineral density (BMD) in HIV-infected and HIV-uninfected women. Dual energy x-ray absorptiometry was used to measure regional lean and fat mass and BMD at lumbar spine (LS), total hip (TH), and femoral neck (FN) in 318 HIV-infected and 122 HIV-uninfected Women's Interagency HIV Study participants at baseline and 2 and 5 years later. Total lean and fat mass were measured using bioimpedance analysis. Multivariate marginal linear regression models assessed the association of HIV status and body composition on BMD change. Compared with HIV-uninfected women, HIV-infected women were older (44 vs. 37 years), more likely to be Hepatitis C virus-infected (32% vs. 14%), and postmenopausal (26% vs. 3%) and had lower baseline total fat mass, trunk fat, and leg fat. In multivariate models, increased total lean mass was independently associated with increased BMD at LS, TH, and FN, and total fat mass was associated with increased BMD at TH and FN (all P < 0.05). When total fat was replaced in multivariate models with trunk fat and leg fat, increased trunk fat (and not leg fat) was associated with increased TH and FN BMD (P < 0.001). Total fat and lean mass are strong independent predictors of TH and FN BMD, and lean mass was associated with greater LS BMD. Regardless of HIV status, greater trunk fat (and not leg fat) was associated with increased TH and FN BMD, suggesting that weight-bearing fat may be a more important predictor of BMD in the hip.

  4. Predicting dementia in primary care patients with a cardiovascular health metric: a prospective population-based study.

    PubMed

    Hessler, Johannes Baltasar; Ander, Karl-Heinz; Brönner, Monika; Etgen, Thorleif; Förstl, Hans; Poppert, Holger; Sander, Dirk; Bickel, Horst

    2016-07-26

    Improving cardiovascular health possibly decreases the risk of dementia. Primary care practices offer a suitable setting for monitoring and controlling cardiovascular risk factors in the older population. The purpose of the study is to examine the association of a cardiovascular health metric including six behaviors and blood parameters with the risk of dementia in primary care patients. Participants (N = 3547) were insurants aged ≥55 of the largest German statutory health insurance company, who were enrolled in a six-year prospective population-based study. Smoking, physical activity, body mass index, blood pressure, total cholesterol, and fasting glucose were assessed by general practitioners at routine examinations. Using recommended cut-offs for each factor, the patients' cardiovascular health was classified as ideal, moderate, or poor. Behaviors and blood parameters sub-scores, as well as a total score, were calculated. Dementia diagnoses were retrieved from health insurance claims data. Results are presented as hazard ratios (HRs) and 95% confidence intervals (95% CIs). Over the course of the study 296 new cases of dementia occurred. Adjusted for age, sex, and education, current smoking (HR = 1.77, 95% CI 1.09-2.85), moderate (1.38, 1.05-1.81) or poor (1.81, 1.32-2.47) levels of physical activity, and poor fasting glucose levels (1.43, 1.02-2.02) were associated with an increased risk of dementia. Body mass index, blood pressure, and cholesterol were not associated with dementia. Separate summary scores for behaviors and blood values, as well as a total score showed no association with dementia. Sensitivity analyses with differently defined endpoints led to similar results. Due to complex relationships of body-mass index and blood pressure with dementia individual components cancelled each other out and rendered the sum-scores meaningless for the prediction of dementia.

  5. Overproduction of altered VLDL in an insulin-resistance rat model: Influence of SREBP-1c and PPAR-α.

    PubMed

    Lucero, Diego; Miksztowicz, Verónica; Macri, Vanesa; López, Gustavo H; Friedman, Silvia; Berg, Gabriela; Zago, Valeria; Schreier, Laura

    2015-01-01

    In insulin-resistance, VLDL presents alterations that increase its atherogenic potential. The mechanism by which insulin-resistance promotes the production of altered VLDL is still not completely understood. The aim of this study was to evaluate the relationship between the expression of sterol regulatory element binding protein 1c (SREBP-1c) and of peroxisome proliferator-activated receptor-α (PPAR-α), with the features of composition and size of VLDL in an insulin-resistance rat model induced by a sucrose rich diet (SRD). The study was conducted on 12 male Wistar rats (180g) receiving SRD (12 weeks) and 12 controls. Lipid profile, free fatty acids, glucose, and insulin were measured. Lipid content in liver and visceral fat were assessed. Isolated VLDL (d<1.006g/ml) was characterized by its chemical composition and size by HPLC. The respective hepatic expression of SREBP-1c and PPAR-α was determined (Western blot). As expected, SRD had elevated triglycerides (TG), free fatty acids and insulin levels, and decreased HDL-cholesterol (p<0.05), together with augmented hepatic and visceral fat (p<0.05). SRD showed higher VLDL total mass - with increased TG content - and predominance of large VLDL (p<0.05). SRD showed an increase in SREBP-1c (precursor and mature forms) and decreased PPAR-α expression (p<0.045). SREBP-1c forms were positively associated with VLDL total mass (p<0.04), VLDL-TG% (p<0.019), and large VLDL% (p<0.002). On the other hand, PPAR-α correlated negatively with VLDL total mass (p=0.05), VLDL-TG% (p=0.005), and large VLDL% (p=0.002). Insulin-resistance, by coordinated activation of SREBP-1c and reduction of PPAR-α, could promote the secretion of larger and TG over-enriched VLDL particles, with greater atherogenic capacity. Copyright © 2014 Sociedad Española de Arteriosclerosis. Published by Elsevier España. All rights reserved.

  6. Analysis and characterisation of phytochemicals in mulberry (Morus alba L.) fruits grown in Vojvodina, North Serbia.

    PubMed

    Natić, Maja M; Dabić, Dragana Č; Papetti, Adele; Fotirić Akšić, Milica M; Ognjanov, Vladislav; Ljubojević, Mirjana; Tešić, Živoslav Lj

    2015-03-15

    In this study, the polyphenolic profile of 11 Morus alba fruits grown in the Vojvodina region was investigated. Ultra high performance liquid chromatography (UHPLC) coupled with Linear Trap Quadrupole and OrbiTrap mass analyzer, and UHPLC coupled with a diode array detector and a triple-quadrupole mass spectrometer were used for the identification and quantification of the polyphenols, respectively. A total of 14 hydroxycinnamic acid esters, 13 flavonol glycosides, and 14 anthocyanins were identified in the extracts with different distributions and contents according to the sampling. The total phenolic content ranged from 43.84 to 326.29 mg GAE/100g frozen fruit. The radical scavenging capacity (50.18-86.79%), metal chelating ability (0.21-8.15%), ferric ion reducing power (0.03-38.45 μM ascorbic acid) and superoxide anion radical scavenging activity (16.53-62.83%) were assessed. The findings indicated that mulberry polyphenolics may act as potent superoxide anion radical scavengers and reducing agents. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Mass gathering medicine for the First East Asian Football Championship and the 24th European/South American Cup in Japan.

    PubMed

    Morimura, Naoto; Takahashi, Kohei; Katsumi, Atsushi; Koido, Yuichi; Sugimoto, Katsuhiko; Fuse, Akira; Ohta, Shoichi; Yamamoto, Yasuhiro; Sakamoto, Tetsuya

    2007-04-01

    It is very important to collect and accumulate data of same-type events from the point of view of appropriate preparedness for mass gathering medicine. On the basis of the experience of the 2002 FIFA World Cup Korea/Japan, the Japanese Association of Disaster Medicine organized the emergency medical assistance team during large football events. The objective was to analyze all clinical presentations available to the on-site physicians during this event. The total number of patients was 51 (patient presentation rate: 0.25/1000 spectators). Trauma, abdominal pain and common cold were the main pathologies encountered. Eight patients were transported to hospital. Forty-one patients (80.4% of total) were treated within the medical station and were not transported to hospital. These dispositions were considered to lighten the burden imposed on activities of local emergency medical services. Sharing databases with local medical services and surveying the outcome of patients are needed to allow patient presentation provision.

  8. Mass-Discrepancy Acceleration Relation: A Natural Outcome of Galaxy Formation in Cold Dark Matter Halos.

    PubMed

    Ludlow, Aaron D; Benítez-Llambay, Alejandro; Schaller, Matthieu; Theuns, Tom; Frenk, Carlos S; Bower, Richard; Schaye, Joop; Crain, Robert A; Navarro, Julio F; Fattahi, Azadeh; Oman, Kyle A

    2017-04-21

    We analyze the total and baryonic acceleration profiles of a set of well-resolved galaxies identified in the eagle suite of hydrodynamic simulations. Our runs start from the same initial conditions but adopt different prescriptions for unresolved stellar and active galactic nuclei feedback, resulting in diverse populations of galaxies by the present day. Some of them reproduce observed galaxy scaling relations, while others do not. However, regardless of the feedback implementation, all of our galaxies follow closely a simple relationship between the total and baryonic acceleration profiles, consistent with recent observations of rotationally supported galaxies. The relation has small scatter: Different feedback implementations-which produce different galaxy populations-mainly shift galaxies along the relation rather than perpendicular to it. Furthermore, galaxies exhibit a characteristic acceleration g_{†}, above which baryons dominate the mass budget, as observed. These observations, consistent with simple modified Newtonian dynamics, can be accommodated within the standard cold dark matter paradigm.

  9. Measuring the total and baryonic mass profiles of the very massive CASSOWARY 31 strong lens. A fossil system at z ≃ 0.7?

    NASA Astrophysics Data System (ADS)

    Grillo, C.; Christensen, L.; Gallazzi, A.; Rasmussen, J.

    2013-08-01

    We investigate the total and baryonic mass distributions in deflector number 31 (CSWA 31) of the Cambridge And Sloan Survey Of Wide ARcs in the skY (CASSOWARY). We confirm spectroscopically a four-image lensing system at redshift 1.4870 with Very Large Telescope/X-shooter observations. The lensed images are distributed around a bright early-type galaxy at redshift 0.683, surrounded by several smaller galaxies at similar photometric redshifts. We use available optical and X-ray data to constrain the deflector total, stellar and hot gas mass through, respectively, strong lensing, stellar population analysis and plasma modelling. We derive a total mass projected within the Einstein radius REin = 70 kpc of (40 ± 1) × 1012 M⊙, and a central logarithmic slope of -1.7 ± 0.2 for the total mass density. Despite a very high stellar mass and velocity dispersion of the central galaxy of (3 ± 1) × 1012 M⊙ and (450 ± 80) km s-1, respectively, the cumulative stellar-to-total mass profile of the deflector implies a remarkably low stellar mass fraction of 20 per cent (3-6 per cent) in projection within the central galaxy effective radius Re = 25 kpc (R = 100 kpc). We also find that the CSWA 31 deflector has properties suggesting it to be among the most distant and massive fossil systems studied so far. The unusually strong central dark matter dominance and the possible fossil nature of this system render it an interesting target for detailed tests of cosmological models and structure formation scenarios.

  10. Description of data base management systems activities

    NASA Technical Reports Server (NTRS)

    1983-01-01

    One of the major responsibilities of the JPL Computing and Information Services Office is to develop and maintain a JPL plan for providing computing services to the JPL management and administrative community that will lead to improved productivity. The CISO plan to accomplish this objective has been titled 'Management and Administrative Support Systems' (MASS). The MASS plan is based on the continued use of JPL's IBM 3032 Computer system for administrative computing and for the MASS functions. The current candidate administrative Data Base Management Systems required to support the MASS include ADABASE, Cullinane IDMS and TOTAL. Previous uses of administrative Data Base Systems have been applied to specific local functions rather than in a centralized manner with elements common to the many user groups. Limited capacity data base systems have been installed in microprocessor based office automation systems in a few Project and Management Offices using Ashton-Tate dBASE II. These experiences plus some other localized in house DBMS uses have provided an excellent background for developing user and system requirements for a single DBMS to support the MASS program.

  11. A Shuttle Upper Atmosphere Mass Spectrometer /SUMS/ experiment

    NASA Technical Reports Server (NTRS)

    Blanchard, R. C.; Duckett, R. J.; Hinson, E. W.

    1982-01-01

    A magnetic mass spectrometer is currently being adapted to the Space Shuttle Orbiter to provide repeated high altitude atmosphere data to support in situ rarefied flow aerodynamics research, i.e., in the high velocity, low density flight regime. The experiment, called Shuttle Upper Atmosphere Mass Spectrometer (SUMS), is the first attempt to design mass spectrometer equipment for flight vehicle aerodynamic data extraction. The SUMS experiment will provide total freestream atmospheric quantitites, principally total mass density, above altitudes at which conventional pressure measurements are valid. Experiment concepts, the expected flight profile, tradeoffs in the design of the total system and flight data reduction plans are discussed. Development plans are based upon a SUMS first flight after the Orbiter initial development flights.

  12. Comparison of methods for the measurement of body composition in overweight and obese Brazilian children and adolescents before and after a lifestyle modification program.

    PubMed

    Lyra, Arthur; Bonfitto, Alexandre José; Barbosa, Vera Lucia P; Bezerra, Ana Cristina; Longui, Carlos Alberto; Monte, Osmar; Kochi, Cristiane

    2015-01-01

    To compare the body composition of overweight children and adolescents by bioelectrical impedance analysis (BIA) and dual-energy X-ray absorptiometry (DXA) before and after physical activity program. One hundred and eleven patients with mean age (SD) of 12 (1.9) participated in the study. We assessed the weight, height, waist circumference (WC), and body composition by DXA and BIA. Patients underwent a program of diet and physical activity (1 h 30 min/day, 3 times a week for 3 months) and were evaluated before and after this period. Mean initial zBMI were 2.3 (0.5) and waist SDS 5.9 (1.8). Significant differences were observed when we compared the measurements taken by DXA and BIA, respectively: total body fat percentage (40 and 31.5) and fat-free mass (43.1 and 50.6 kg). Regarding the trunk fat by DXA, there was a positive correlation with the WC/height ratio (r = 0.65; p < 0.01). After the intervention period, we observed a reduction in the zBMI, waist SDS, and total body fat and increase of fat-free mass by DXA. BIA only detected reduction in fat. BIA underestimates the percentage of fat and overestimates fat-free mass in relation to DXA. There is positive correlation between trunk fat and the ratio WC/height. In addition, DXA detected changes in body composition induced by a short period of physical training, unlike BIA. © 2014 S. Karger AG, Basel.

  13. Protein energy malnutrition in severe alcoholic hepatitis: diagnosis and response to treatment. The VA Cooperative Study Group #275.

    PubMed

    Mendenhall, C L; Moritz, T E; Roselle, G A; Morgan, T R; Nemchausky, B A; Tamburro, C H; Schiff, E R; McClain, C J; Marsano, L S; Allen, J I

    1995-01-01

    Active nutrition therapy and the anabolic steroid oxandrolone (OX), in selected patients with severe alcoholic hepatitis, significantly improved liver status and survival. We report here on the changes in their nutritional parameters. Protein energy malnutrition (PEM) was evaluated and expressed as percent of low normal in 271 patients initially, at 1 month and at 3 months. Active therapy consisted of OX plus a high caloric food supplement vs a matching placebo and a low calorie supplement. PEM was present in every patient; mean PEM score 60% of low normal. Most of the parameters improved significantly from baseline on standard care; the largest improvement seen in visceral proteins, the smallest in fat stores (skinfold thickness). Total PEM score significantly correlated with 6 month mortality (p = .0012). Using logistic regression analysis, creatinine height index, hand grip strength and total peripheral blood lymphocytes were the best risk factors for survival. When CD lymphocyte subsets replaced total lymphocyte counts in the equation, CD8 levels became a significant risk factor (p = .004). Active treatment produced significant risk factor (p = .004). Active treatment produced significant improvements in those parameters related to total body and muscle mass (ie, mid arm muscle area, p = .02; creatinine height index, p = .03; percent ideal body weight, p = .04). Deterioration in nutritional parameters is a significant risk factor for survival in severe patients with alcoholic hepatitis. This deterioration is reversible with standard hospital care. Active therapy further improves creatinine height index, mid arm muscle area and total lymphocyte counts. Hence, these later parameters appear to be the best indicators for follow-up assessments.

  14. Giardia lamblia: identification of molecules that contribute to direct mast cell activation.

    PubMed

    Muñoz-Cruz, Samira; Gomez-García, Argelia; Matadamas-Martínez, Félix; Alvarado-Torres, Juan A; Meza-Cervantez, Patricia; Arriaga-Pizano, Lourdes; Yépez-Mulia, Lilián

    2018-06-02

    Mast cells play a central role in the early clearance of the intestinal parasite Giardia lamblia. In a previous study, we reported that G. lamblia live trophozoites or trophozoite-derived total soluble extract induced direct activation (IgE-independent) of mast cells and release of IL-6 and TNF-α. To identify the Giardia molecules and the mast cell receptors involved in this activation, trophozoite-derived total soluble proteins separated into three fractions (F1-F3) were evaluated for its ability to activate mast cells in vitro. F2 activated mast cells in a greater extent than F1 and F3. Furthermore, F2 induced the release of IL-6 and TNF-α by mast cells. TLR2 and TLR4 expression increased slightly after mast cell stimulation with either F2 or total soluble extract; however, these receptors were not involved in F2 or total soluble extract-induced proinflammatory cytokine production. Proteins present in F2 as unique and high-intensity bands identified by liquid chromatography coupled with tandem mass spectrometry, include molecules with important biological activities such as enolase and arginine deiminase (ADI). Recombinant ADI and enolase were tested for their ability to activate mast cells, but only ADI induced a significant release of IL-6 and TNF-α. ADI product, citrulline but not ammonium, also induced mast cell release of TNF-α. Interestingly, recombinant ADI still stimulated the secretion of TNF-α by mast cells in a arginine-free medium, although in a lower extend that in the presence of arginine, indicating that either ADI itself can stimulate mast cells or through its metabolic product, citrulline.

  15. Global Lightning Activity

    NASA Technical Reports Server (NTRS)

    Christian, Hugh J.

    2004-01-01

    Our knowledge of the global distribution of lightning has improved dramatically since the advent of spacebased lightning observations. Of major importance was the 1995 launch of the Optical Transient Detector (OTD), followed in 1997 by the launch of the Lightning Imaging Sensor (LIS). Together, these instruments have generated a continuous eight-year record of global lightning activity. These lightning observations have provided a new global perspective on total lightning activity. For the first time, total lightning activity (cloud-to-ground and intra-cloud) has been observed over large regions with high detection efficiency and accurate geographic location. This has produced new insights into lightning distributions, times of occurrence and variability. It has produced a revised global flash rate estimate (44 flashes per second) and has lead to a new realization of the significance of total lightning activity in severe weather. Accurate flash rate estimates are now available over large areas of the earth (+/- 72 deg. latitude). Ocean-land contrasts as a function of season are clearly reveled, as are orographic effects and seasonal and interannual variability. The space-based observations indicate that air mass thunderstorms, not large storm system dominate global activity. The ability of LIS and OTD to detect total lightning has lead to improved insight into the correlation between lightning and storm development. The relationship between updraft development and lightning activity is now well established and presents an opportunity for providing a new mechanism for remotely monitoring storm development. In this concept, lightning would serve as a surrogate for updraft velocity. It is anticipated that this capability could lead to significantly improved severe weather warning times and reduced false warning rates. This talk will summarize our space-based lightning measurements, will discuss how lightning observations can be used to monitor severe weather, and present a concept for continuous geostationary-based lightning observations.

  16. Emergency Preparedness in the Workplace: The Flulapalooza Model for Mass Vaccination.

    PubMed

    Swift, Melanie D; Aliyu, Muktar H; Byrne, Daniel W; Qian, Keqin; McGown, Paula; Kinman, Patricia O; Hanson, Katherine Louise; Culpepper, Demoyne; Cooley, Tamara J; Yarbrough, Mary I

    2017-09-01

    To explore whether an emergency preparedness structure is a feasible, efficient, and sustainable way for health care organizations to manage mass vaccination events. We used the Hospital Incident Command System to conduct a 1-day annual mass influenza vaccination event at Vanderbilt University Medical Center over 5 successive years (2011-2015). Using continuous quality improvement principles, we assessed whether changes in layout, supply management, staffing, and documentation systems improved efficiency. A total of 66 591 influenza vaccines were administered at 5 annual Flulapalooza events; 13 318 vaccines per event on average. Changes to the physical layout, staffing mix, and documentation processes improved vaccination efficiency 74%, from approximately 38 to 67 vaccines per hour per vaccinator, while reducing overall staffing needs by 38%. An unexpected finding was the role of social media in facilitating active engagement. Health care organizations can use a closed point-of-dispensing model and Hospital Incident Command System to conduct mass vaccination events, and can adopt the "Flulapalooza method" as a best practice model to enhance efficiency.

  17. New insights into the effects of irisin levels in HIV-infected subjects: correlation with adiposity, fat-free mass, and strength parameters.

    PubMed

    Trombeta, Joice Cristina Dos Santos; Prestes, Jonato; Nascimento, Dahan da Cunha; Tibana, Ramires Alsamir; Pereira, Guilherme Borges; Lima, Thiago da Rosa; Fraga, Géssica Alves; Vieira-Junior, Roberto Carlos; Voltarelli, Fabrício Azevedo

    2017-01-01

    Patients infected with the human immunodeficiency virus (HIV) have an increased risk of metabolic disorders and alterations on irisin levels. Therefore, the purpose of the current investigation was to quantify the circulating irisin concentration in HIV-infected subjects under highly active antiretroviral therapy and to determine possible correlations between irisin levels with fat mass, fat-free mass, body mass index (BMI), and muscle strength. Cross-sectional study of 10 men (36.7 ± 11.3 years) and 10 women (42.5 ± 10.3 years) infected with HIV, recruited from the Specialized Service Center in the State Center of Reference for High and Medium Complexity. Blood samples were collected to determine plasma irisin levels, glucose, HDL, total cholesterol, triglycerides, and LDL. Body composition (fat mass, fat-free mass) and anthropometrics (body mass index; BMI) were measured by bioelectrical impedance. Muscle strength was assessed using a mechanic hand dynamometer and one maximum repetition tests. Irisin levels correlated positively with fat mass (r = 0.67; p = 0.001) and BMI (r = 0.48; p = 0.036). In contrast, there was an inverse correlation between irisin levels and fat-free mass (r = -0.41; p = 0.008) and five strength parameters: right hand grip (r = -0.46; p = 0.044); left hand grip (r = -0.50; p = 0.027), relative hand grip (r = -0.79; p = 0.001), bench press (r = -0.58; p = 0.009), leg press (r = -0.40; p = 0.085), and biceps curl (r = -0.059; p = 0.009). Irisin levels correlated positively with body fat and negatively with fat-free mass and strength parameters in HIV-infected patients. Female patients infected with HIV receiving highly active antiretroviral therapy have higher levels of irisin compared with men in a similar circumstance.

  18. Glycosylated Porphyra-334 and Palythine-Threonine from the Terrestrial Cyanobacterium Nostoc commune

    PubMed Central

    Nazifi, Ehsan; Wada, Naoki; Yamaba, Minami; Asano, Tomoya; Nishiuchi, Takumi; Matsugo, Seiichi; Sakamoto, Toshio

    2013-01-01

    Mycosporine-like amino acids (MAAs) are water-soluble UV-absorbing pigments, and structurally different MAAs have been identified in eukaryotic algae and cyanobacteria. In this study novel glycosylated MAAs were found in the terrestrial cyanobacterium Nostoc commune (N. commune). An MAA with an absorption maximum at 334 nm was identified as a hexose-bound porphyra-334 derivative with a molecular mass of 508 Da. Another MAA with an absorption maximum at 322 nm was identified as a two hexose-bound palythine-threonine derivative with a molecular mass of 612 Da. These purified MAAs have radical scavenging activities in vitro, which suggests multifunctional roles as sunscreens and antioxidants. The 612-Da MAA accounted for approximately 60% of the total MAAs and contributed approximately 20% of the total radical scavenging activities in a water extract, indicating that it is the major water-soluble UV-protectant and radical scavenger component. The hexose-bound porphyra-334 derivative and the glycosylated palythine-threonine derivatives were found in a specific genotype of N. commune, suggesting that glycosylated MAA patterns could be a chemotaxonomic marker for the characterization of the morphologically indistinguishable N. commune. The glycosylation of porphyra-334 and palythine-threonine in N. commune suggests a unique adaptation for terrestrial environments that are drastically fluctuating in comparison to stable aquatic environments. PMID:24065157

  19. The polyphenolics and carbohydrates as indicators of botanical and geographical origin of Serbian autochthonous clones of red spice paprika.

    PubMed

    Mudrić, Sanja Ž; Gašić, Uroš M; Dramićanin, Aleksandra M; Ćirić, Ivanka Ž; Milojković-Opsenica, Dušanka M; Popović-Đorđević, Jelena B; Momirović, Nebojša M; Tešić, Živoslav Lj

    2017-02-15

    Spice peppers (Capsicum annuum L.) var. Lemeška and Lakošnička paprika were investigated to evaluate their polyphenolic and carbohydrate profiles and antioxidant activity. A total of forty-nine polyphenolics were identified using ultrahigh-performance liquid chromatography (UHPLC) coupled to LTQ OrbiTrap mass analyzer. Twenty-five of them were quantified using available standards, while the other compounds were confirmed by exact mass search of their deprotonated molecule [M-H](-) and its MS(4) fragmentation. Thirteen carbohydrates were quantified using high-performance anion exchange chromatography (HPAEC) with pulsed amperometric detection (PAD). Radical scavenging activity (RSA) ranged from 17.32 to 48.34mmol TE (Trolox equivalent)/kg DW (dry weight) and total phenolics content (TPC) was ranged between 7.03 and 14.92g GAE (gallic acid equivalents)/kg DW. To our best knowledge, five polyphenolic compounds were for the first time tentatively identified in paprika: 5-O-p-coumaroylquinic acid, luteolin 7-O-(2″-O-pentosyl-4″-O-hexosyl)hexoside, quercetin 3-O-(2″-O-hexosyl)rhamnoside, isorhamnetin 3-O-[6″-O-(5-hydroxyferuloyl)hexoside]-7-O-rhamnoside, and luteolin 7-O-[2″-O-(5'″-O-sinapoyl)pentosyl-6″-O-malonyl]hexoside. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Effect of two different hypocaloric diets in transaminases and insulin resistance in nonalcoholic fatty liver disease and obese patients.

    PubMed

    de Luis, D A; Aller, R; Izaola, O; Gonzalez Sagrado, M; Conde, R

    2010-01-01

    The aim of our study was to examine the changes in hypertransaminasemia after weight reduction in obese patients with and without NAFLD and the relation with insulin resistance. A population of 162 obese patients was randomly allocated to two groups: a) diet I (low fat) and b) diet II (low carbohydrate), dieting along 3 months. Patients were classified as group I (n=112) when serum ALT activity was normal or group II (NAFLD, n=30) when serum ALT activity was (>or=43 UI/L). In control group with diet I, BMI, weight, fat mass, waist to hip ratio, waist circumference, systolic pressure, total cholesterol, LDL cholesterol, HOMA and insulin levels decreased. In NAFLD group with diet I improved the same parameters and glucose, triglycerides, ALT, AST, gamaglutamine transferase levels, too. In control group with diet II, BMI, weight, fat mass, waist to hip ratio, waist circumference, systolic pressure, total cholesterol, LDL cholesterol, HOMA and insulin levels decreased. In NAFLD group with diet II improved the same parameters and glucose, triglycerides, ALT and gamaglutamine transferase levels, without statistical changes in AST. We showed that weight reduction secondary to two hypocaloric diets was associated with improvement in hipertransaminasemia and insulin resistance in NAFLD patients.

  1. Optimisation of Microwave-Assisted Extraction of Pomegranate (Punica granatum L.) Seed Oil and Evaluation 
of Its Physicochemical and Bioactive Properties

    PubMed Central

    Çavdar, Hasene Keskin; Gök, Uğur; Göğüş, Fahrettin

    2017-01-01

    Summary Pomegranate seed oil was extracted in a closed-vessel high-pressure microwave system. The characteristics of the obtained oil, such as fatty acid composition, free fatty acidity, total phenolic content, antioxidant activity and colour, were compared to those of the oil obtained by cold solvent extraction. Response surface methodology was applied to optimise extraction conditions: power (176–300 W), time (5–20 min), particle size (d=0.125–0.800 mm) and solvent to sample ratio (2:1, 6:1 and 10:1, by mass). The predicted highest extraction yield (35.19%) was obtained using microwave power of 220 W, particle size in the range of d=0.125–0.450 mm and solvent-to-sample ratio of 10:1 (by mass) in 5 min extraction time. Microwave-assisted solvent extraction (MASE) resulted in higher extraction yield than that of Soxhlet (34.70% in 8 h) or cold (17.50% in 8 h) extraction. The dominant fatty acid of pomegranate seed oil was punicic acid (86%) irrespective of the extraction method. Oil obtained by MASE had better physicochemical properties, total phenolic content and antioxidant activity than the oil obtained by cold solvent extraction. PMID:28559737

  2. NiCoO2 flowers grown on the aligned-flakes coated Ni foam for application in hybrid energy storage

    NASA Astrophysics Data System (ADS)

    Xu, Xiaoyang; Zhao, Huilin; Zhou, JingKuo; Xue, Ruinan; Gao, Jianping

    2016-10-01

    Many NiCoO2 flowers with an average diameter of about 4 μm were grown on the NiCoO2 flakes coated Ni foam (denoted as NiCoO2/Ni foam) through a simple hydrothermal method and confirmed by scanning and transmission electron microscopies, X-ray diffraction and X-ray photoelectron spectrum measurements. The NiCoO2/Ni foam with high specific area and porosity was directly used as the working electrode without any binders. The measured specific capacitance of NiCoO2 grown on Ni foam is 756 F/g at 0.75 A/g using a three-electrode setup in 1 M KOH. Considering the high capacity of NiCoO2 and the good stability of rGO, the NiCoO2/Ni foam//rGO hybrid supercapacitor combining NiCoO2/Ni foam and rGO shows very good properties, such as high specific capacitance (82 F/g at 2 A/g based on the total mass of active materials), high energy density (25.7 Wh/kg at 1500 W/kg based on the total mass of active materials), good stability (about 90% capacitance retention after 2000-cycle at 100 mV/s), and low charge ion transfer resistance.

  3. Relationships between global physical activity and bone mineral density in a group of male and female students.

    PubMed

    Pasqualini, Leonella; Leli, Christian; Ministrini, Stefano; Schillaci, Giuseppe; Zappavigna, Rosa M; Lombardini, Rita; Scarponi, Anna M; Mannarino, Elmo

    2017-03-01

    Peak of bone mass (PBM) is generally reached about the age of 18 both in boys and girls. Maximizing PBM during growth may contribute to fracture risk reduction in adulthood and in the elderly. The aim of our study was to evaluate the effects on bone mineral density (BMD) of global physical activity (PA), carried out in the past 15 years, in a population of 70 healthy, young male and female subjects aged 22 to 25. BMD of the lumbar spine and total hip was measured using dual-energy X-ray absorptiometry (DEXA); global PA, resulting from sports-related, occupational and commuting PA, was evaluated using validated questionnaires. Women spent more time than men both in sports-related, occupational and commuting PA in the age range between 10-15 years. In the female group global PA positively correlated with BMD of the lumbar spine (r=0.38; P=0.02) and the total hip (r=0.36; P=0.04) and BMD of the lumbar spine was independently predicted by global PA and Body Mass Index. Our retrospective cross-sectional study indicates that global PA, not only sports-related PA, performed during prepubertal age, is associated with a greater PBM in women.

  4. The effects of whey and soy proteins on growth performance, gastrointestinal digestion, and selected physiological responses in rats.

    PubMed

    Wróblewska, B; Juśkiewicz, J; Kroplewski, B; Jurgoński, A; Wasilewska, E; Złotkowska, D; Markiewicz, L

    2018-03-01

    The objective of this work was to identify the nutritional and physiological effects of commercial soy and whey protein preparations. Wistar rats were fed with soy (S), whey (W), or casein (C) preparations as the sole dietary protein source. The nitrogen balance, body composition, changes in caecal microbiota, mucosal and bacterial enzyme activities, and allergenic potential of the preparations were analysed. The whey diet elicited greater skeletal muscle anabolism than the soy diet. Rats from the S group had the lowest values of body weight, fat, and lean mass gain. Compared to casein, soy and whey preparations decreased the protein efficiency ratio, increased N in the urine, and triggered the reduction of ammonia levels in the caecum. Changes in β-glucuronidase and β-galactosidase activities in the small intestine, caecum, and colon between experimental groups were observed. Significant differences were noted in the total counts of anaerobic bacteria and sulphite reducing bacteria during soy and whey treatments. This probably affected the short chain fatty acid level in caecal digesta resulting in the lowest propionic acid and total putrefactive short chain fatty acid levels during S treatment. Generally, whey preparations are a good choice for rapid bodybuilding (skeletal muscles), whereas soy preparations are more helpful during mass reduction.

  5. Metabolic Profiling of Dendrobium officinale in Response to Precursors and Methyl Jasmonate

    PubMed Central

    Jiao, Chunyan; Song, Cheng; Zheng, Siyan; Zhu, Yingpeng; Jin, Qing; Cai, Yongping; Lin, Yi

    2018-01-01

    Alkaloids are the main active ingredients in the medicinal plant Dendrobium officinale. Based on the published genomic and transcriptomic data, a proposed terpenoid indole alkaloid (TIA) biosynthesis pathway may be present in D. officinale. In this study, protocorm-like bodies (PLBs) with a high-yielding production of alkaloids were obtained by the optimization of tryptophan, secologanin and methyl jasmonate (MeJA) treatment. The results showed that the total alkaloid content was 2.05 times greater than that of the control group when the PLBs were fed with 9 µM tryptophan, 6 µM secologanin and 100 µM MeJA after 36 days. HPLC analysis showed that strictosidine synthase (STR) activity also increased in the treated plants. A total of 78 metabolites were identified using gas chromatography-mass spectrometry (GC-MS) in combination with liquid chromatography-mass spectrometry (LC-MS) methods; 29 differential metabolites were identified according to the multivariate statistical analysis. Among them, carapanaubine, a kind of TIA, exhibited dramatically increased levels. In addition, a possible underlying process of the metabolic flux from related metabolism to the TIA biosynthetic pathway was enhanced. These results provide a comprehensive view of the metabolic changes related to alkaloid biosynthesis, especially TIA biosynthesis, in response to tryptophan, secologanin and MeJA treatment. PMID:29510516

  6. X-Ray Scaling Relations of Early-type Galaxies

    NASA Astrophysics Data System (ADS)

    Babyk, Iu. V.; McNamara, B. R.; Nulsen, P. E. J.; Hogan, M. T.; Vantyghem, A. N.; Russell, H. R.; Pulido, F. A.; Edge, A. C.

    2018-04-01

    X-ray luminosity, temperature, gas mass, total mass, and their scaling relations are derived for 94 early-type galaxies (ETGs) using archival Chandra X-ray Observatory observations. Consistent with earlier studies, the scaling relations, L X ∝ T 4.5±0.2, M ∝ T 2.4±0.2, and L X ∝ M 2.8±0.3, are significantly steeper than expected from self-similarity. This steepening indicates that their atmospheres are heated above the level expected from gravitational infall alone. Energetic feedback from nuclear black holes and supernova explosions are likely heating agents. The tight L X –T correlation for low-luminosity systems (i.e., below 1040 erg s‑1) are at variance with hydrodynamical simulations, which generally predict higher temperatures for low-luminosity galaxies. We also investigate the relationship between total mass and pressure, Y X = M g × T, finding M\\propto {Y}X0.45+/- 0.04. We explore the gas mass to total mass fraction in ETGs and find a range of 0.1%–1.0%. We find no correlation between the gas-to-total mass fraction with temperature or total mass. Higher stellar velocity dispersions and higher metallicities are found in hotter, brighter, and more massive atmospheres. X-ray core radii derived from β-model fitting are used to characterize the degree of core and cuspiness of hot atmospheres.

  7. VizieR Online Data Catalog: SDSS bulge, disk and total stellar mass estimates (Mendel+, 2014)

    NASA Astrophysics Data System (ADS)

    Mendel, J. T.; Simard, L.; Palmer, M.; Ellison, S. L.; Patton, D. R.

    2014-01-01

    We present a catalog of bulge, disk, and total stellar mass estimates for ~660000 galaxies in the Legacy area of the Sloan Digital Sky Survey Data (SDSS) Release 7. These masses are based on a homogeneous catalog of g- and r-band photometry described by Simard et al. (2011, Cat. J/ApJS/196/11), which we extend here with bulge+disk and Sersic profile photometric decompositions in the SDSS u, i, and z bands. We discuss the methodology used to derive stellar masses from these data via fitting to broadband spectral energy distributions (SEDs), and show that the typical statistical uncertainty on total, bulge, and disk stellar mass is ~0.15 dex. Despite relatively small formal uncertainties, we argue that SED modeling assumptions, including the choice of synthesis model, extinction law, initial mass function, and details of stellar evolution likely contribute an additional 60% systematic uncertainty in any mass estimate based on broadband SED fitting. We discuss several approaches for identifying genuine bulge+disk systems based on both their statistical likelihood and an analysis of their one-dimensional surface-brightness profiles, and include these metrics in the catalogs. Estimates of the total, bulge and disk stellar masses for both normal and dust-free models and their uncertainties are made publicly available here. (4 data files).

  8. The possibility of life proliferation from Enceladus

    NASA Astrophysics Data System (ADS)

    Czechowski, Leszek

    2016-07-01

    Enceladus is a medium sized icy satellite (MIS) of Saturn. MIS are built of mixtures of rocks and ices. According to [1]: "For life to have emerged […] on the early Earth, a sustained source of chemically transducible energy was essential. The serpentinization process is emerging as an increasingly likely source of that energy" (see also [2]). We consider here conditions for origin of life in the early Enceladus and later proliferation of the life. Mass of serpentinite: The serpentinization on the Earth is often considered with hydrothermal activity in neovolcanic zones along mid-oceanic spreading centers. However, only in small part the hydrothermal activity really occurs. A simple calculations (e.g. [3]) indicate that mass fraction of silicates in Enceladus is ~0.646, hence the total mass of its silicate is ~6.97 10^1^9 kg. [4] considered the process of differentiation and core forming in Enceladus. He found that the result of differentiation is a relatively cold core of loosely packed grains with water between them. The entire core of Enceladus was probably permeable. This could lead to formation of extensive hydrothermal convective systems. It indicates that total mass of serpententinized silicate in Enceladus could be larger than on the Earth. The evolution of temperature in the Enceladus interior for the first a few hundreds Myr is given in [4]. He found that the temperature allows for existing the life even in the center of the satellite. It is possible that for hundreds of Myr the conditions in Enceladus were more favorable for origin of life than on the Earth. Proliferation of life: The low gravity of the Enceladus and its volcanic activity make transport possible. Note that the low temperature of plumes from active region of Enceladus does not kill the organisms. The primitive bacteria could leave the Enceladus with volcanic jets in the same way as particles of the E ring. Other mechanisms could transport particles to terrestrial planets. Therefore it is possible that the Enceladus was a cradle of the life in the Solar System. References: [1] Russell, M. J., Hall, A. J., And Martin W. (2010). Geobiology (2010), 8, 355-371. [2] Izawa M.R.M. et al. (2010). Planet. Space Sci. 58, 583-591. [3] Abramov, O., Mojzsis, S.J., (2011) Icarus 213, 273-279. [4] Czechowski, L. (2014) Planet. Space Sci. 104, 185-199

  9. A randomized trial of adjunct testosterone for cancer‐related muscle loss in men and women

    PubMed Central

    Wright, Traver J.; Dillon, E. Lichar; Durham, William J.; Chamberlain, Albert; Randolph, Kathleen M.; Danesi, Christopher; Horstman, Astrid M.; Gilkison, Charles R.; Willis, Maurice; Richardson, Gwyn; Hatch, Sandra S.; Jupiter, Daniel C.; McCammon, Susan; Urban, Randall J.

    2018-01-01

    Abstract Background Cancer cachexia negatively impacts cancer‐related treatment options, quality of life, morbidity, and mortality, yet no established therapies exist. We investigated the anabolic properties of testosterone to limit the loss of body mass in late stage cancer patients undergoing standard of care cancer treatment. Methods A randomized, double‐blind, placebo‐controlled phase II clinical trial was undertaken to assess the potential therapeutic role of adjunct testosterone to limit loss of body mass in patients with squamous cell carcinoma of the cervix or head and neck undergoing standard of care treatment including chemotherapy and chemoradiation. Patients were randomly assigned in blocks to receive weekly injections of either 100 mg testosterone enanthate or placebo for 7 weeks. The primary outcome was per cent change in lean body mass, and secondary outcomes included assessment of quality of life, tests of physical performance, muscle strength, daily activity levels, resting energy expenditure, nutritional intake, and overall survival. Results A total of 28 patients were enrolled, 22 patients were studied to completion, and 21 patients were included in the final analysis (12 placebo, nine testosterone). Adjunct testosterone increased lean body mass by 3.2% (95% confidence interval [CI], 0–7%) whereas those receiving placebo lost 3.3% (95% CI, −7% to 1%, P = 0.015). Although testosterone patients maintained more favourable body condition, sustained daily activity levels, and showed meaningful improvements in quality of life and physical performance, overall survival was similar in both treatment groups. Conclusions In patients with advanced cancer undergoing the early phase of standard of care therapy, adjunct testosterone improved lean body mass and was also associated with increased quality of life, and physical activity compared with placebo. PMID:29654645

  10. Effects of an Encapsulated Fruit and Vegetable Juice Concentrate on Obesity-Induced Systemic Inflammation: A Randomised Controlled Trial

    PubMed Central

    Williams, Evan J.; Baines, Katherine J.; Berthon, Bronwyn S.; Wood, Lisa G.

    2017-01-01

    Phytochemicals from fruit and vegetables reduce systemic inflammation. This study examined the effects of an encapsulated fruit and vegetable (F&V) juice concentrate on systemic inflammation and other risk factors for chronic disease in overweight and obese adults. A double-blinded, parallel, randomized placebo-controlled trial was conducted in 56 adults aged ≥40 years with a body mass index (BMI) ≥28 kg/m2. Before and after eight weeks daily treatment with six capsules of F&V juice concentrate or placebo, peripheral blood gene expression (microarray, quantitative polymerase chain reaction (qPCR)), plasma tumour necrosis factor (TNF)α (enzyme-linked immunosorbent assay (ELISA)), body composition (Dual-energy X-ray absorptiometry (DEXA)) and lipid profiles were assessed. Following consumption of juice concentrate, total cholesterol, low-density lipoprotein (LDL) cholesterol and plasma TNFα decreased and total lean mass increased, while there was no change in the placebo group. In subjects with high systemic inflammation at baseline (serum C-reactive protein (CRP) ≥3.0 mg/mL) who were supplemented with the F&V juice concentrate (n = 16), these effects were greater, with decreased total cholesterol, LDL cholesterol and plasma TNFα and increased total lean mass; plasma CRP was unchanged by the F&V juice concentrate following both analyses. The expression of several genes involved in lipogenesis, the nuclear factor-κB (NF-κB) and 5′ adenosine monophosphate-activated protein kinase (AMPK) signalling pathways was altered, including phosphomevalonate kinase (PMVK), zinc finger AN1-type containing 5 (ZFAND5) and calcium binding protein 39 (CAB39), respectively. Therefore, F&V juice concentrate improves the metabolic profile, by reducing systemic inflammation and blood lipid profiles and, thus, may be useful in reducing the risk of obesity-induced chronic disease. PMID:28208713

  11. Serum CETP concentration is not associated with measures of body fat: The NEO study.

    PubMed

    Blauw, Lisanne L; de Mutsert, Renée; Lamb, Hildo J; de Roos, Albert; Rosendaal, Frits R; Jukema, J Wouter; Wang, Yanan; van Dijk, Ko Willems; Rensen, Patrick C N

    2016-03-01

    Adipose tissue has been postulated to contribute substantially to the serum cholesteryl ester transfer protein (CETP) pool. However, in a recent large cohort study waist circumference was not associated with plasma CETP. The aim of the present study was to further examine associations of accurate measures of body fat and body fat distribution with serum CETP concentration. In this cross-sectional analysis of the Netherlands Epidemiology of Obesity study, we examined in 6606 participants (aged 45-65 years) the associations of total body fat, body mass index (BMI), waist circumference, waist-to-hip ratio (WHR), abdominal subcutaneous (aSAT) and visceral adipose tissue (VAT) assessed with magnetic resonance imaging (n = 2547) and total and trunk fat mass assessed with dual-energy X-ray absorptiometry (n = 909) with serum CETP concentration. Regression models were adjusted for age, ethnicity, sex, dietary intake of fat and cholesterol, physical activity, smoking and menopausal status. Mean (SD) age was 56 (6) years and BMI 26.3 (4.4) kg/m(2), 56% were women. Mean serum CETP concentration was 2.47 μg/mL. The difference in serum CETP was 0.02 μg/mL (95%CI: -0.01, 0.05) per SD total body fat (8.7%), and 0.02 μg/mL (0.00, 0.04) per SD BMI (4.4 kg/m(2)). Similar associations around the null were observed for waist circumference, WHR, aSAT, VAT, total and trunk fat mass. In this population-based study, there was no evidence for clinically relevant associations between several measures of body fat and serum CETP concentration. This finding implies that adipose tissue does not contribute to the CETP pool in serum. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  12. Insights from Synthetic Star-forming Regions. II. Verifying Dust Surface Density, Dust Temperature, and Gas Mass Measurements With Modified Blackbody Fitting

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Koepferl, Christine M.; Robitaille, Thomas P.; Dale, James E., E-mail: koepferl@usm.lmu.de

    We use a large data set of realistic synthetic observations (produced in Paper I of this series) to assess how observational techniques affect the measurement physical properties of star-forming regions. In this part of the series (Paper II), we explore the reliability of the measured total gas mass, dust surface density and dust temperature maps derived from modified blackbody fitting of synthetic Herschel observations. We find from our pixel-by-pixel analysis of the measured dust surface density and dust temperature a worrisome error spread especially close to star formation sites and low-density regions, where for those “contaminated” pixels the surface densitiesmore » can be under/overestimated by up to three orders of magnitude. In light of this, we recommend to treat the pixel-based results from this technique with caution in regions with active star formation. In regions of high background typical in the inner Galactic plane, we are not able to recover reliable surface density maps of individual synthetic regions, since low-mass regions are lost in the far-infrared background. When measuring the total gas mass of regions in moderate background, we find that modified blackbody fitting works well (absolute error: + 9%; −13%) up to 10 kpc distance (errors increase with distance). Commonly, the initial images are convolved to the largest common beam-size, which smears contaminated pixels over large areas. The resulting information loss makes this commonly used technique less verifiable as now χ {sup 2} values cannot be used as a quality indicator of a fitted pixel. Our control measurements of the total gas mass (without the step of convolution to the largest common beam size) produce similar results (absolute error: +20%; −7%) while having much lower median errors especially for the high-mass stellar feedback phase. In upcoming papers (Paper III; Paper IV) of this series we test the reliability of measured star formation rate with direct and indirect techniques.« less

  13. Water-soluble ions and carbon content of size-segregated aerosols in New Delhi, India: direct and indirect influences of firework displays.

    PubMed

    Kumar, Pawan; Kumar, Rakesh; Yadav, Sudesh

    2016-10-01

    The particle size distribution and water-soluble inorganic ion (WSII) and carbonaceous species in size-segregated aerosols, Dp < 0.95, 0.95 < Dp < 1.5, 1.5 < Dp < 3.0, 3.0 < Dp < 7.2, and 7.2 < Dp < 10 μm, were investigated during Diwali firework displays in New Delhi, India. The firework activity had the maximum contribution to the mass loading of PM 0.95 (786 μg/m 3 ) followed by PM 0.95-1.5 (216 μg/m 3 ) with all other three fractions accounting to a total of 214 μg/m 3 . The percentage contributions of WSII to the total mass of aerosols were highest in first two size fractions (39 and 40 %, respectively), compared to other fractions. The firework marker ion (Mg 2+ , Cl - , and K + ) mass concentration shows higher values in PM 0.95 during Diwali compared to before Diwali period. The mass size distribution of particles, NH 4 + , K + , Cl - , SO 4 2- , Mg 2+ , and NO 3 - , also showed changes on the Diwali night compared to previous and after days. The high Cl - /Na + (5.6) and OC/EC (3.4) ratio of PM 0.95 can be used as the indicators of firework displays. The lowering of mixing height on Diwali night to 50 m compared to before (277 mts) and after (269 mts) Diwali period further concentrated the aerosols in ambient atmosphere. Therefore, the firework display not only released the gaseous or elemental constituent but also influenced the temperature profile and both put together result in high aerosol concentrations, WSII, OC, and BC contents in ambient atmosphere. The alveolar, respirable, and inhalable fractions accounted for 64.6, 90.8, and 97.8 %, respectively, of the total PM 10 mass. People stay exposed to such high pollution level in short span of 6-8 h and experience adverse health impacts due to high mass concentrations and the chemical components of fine aerosols.

  14. Oxidant production from source-oriented particulate matter - Part 1: Oxidative potential using the dithiothreitol (DTT) assay

    NASA Astrophysics Data System (ADS)

    Charrier, J. G.; Richards-Henderson, N. K.; Bein, K. J.; McFall, A. S.; Wexler, A. S.; Anastasio, C.

    2014-09-01

    Recent epidemiological evidence supports the hypothesis that health effects from inhalation of ambient particulate matter (PM) are governed by more than just the mass of PM inhaled. Both specific chemical components and sources have been identified as important contributors to mortality and hospital admissions, even when these endpoints are unrelated to PM mass. Sources may cause adverse health effects via their ability to produce reactive oxygen species, possibly due to the transition metal content of the PM. Our goal is to quantify the oxidative potential of ambient particle sources collected during two seasons in Fresno, CA using the dithiothreitol (DTT) assay. We collected PM from different sources or source combinations into different ChemVol (CV) samplers in real time using a novel source-oriented sampling technique based on single particle mass spectrometry. We segregated the particles from each source-oriented mixture into two size fractions - ultrafine (Dp ≤ 0.17 μm) and submicron fine (0.17 μm ≤ Dp ≤ 1.0 μm) - and measured metals and the rate of DTT loss in each PM extract. We find that the mass-normalized oxidative potential of different sources varies by up to a actor of 8 and that submicron fine PM typically has a larger mass-normalized oxidative potential than ultrafine PM from the same source. Vehicular Emissions, Regional Source Mix, Commute Hours, Daytime Mixed Layer and Nighttime Inversion sources exhibit the highest mass-normalized oxidative potential. When we apportion the volume-normalized oxidative potential, which also accounts for the source's prevalence, cooking sources account for 18-29% of the total DTT loss while mobile (traffic) sources account for 16-28%. When we apportion DTT activity for total PM sampled to specific chemical compounds, soluble copper accounts for roughly 50% of total air-volume-normalized oxidative potential, soluble manganese accounts for 20%, and other unknown species, likely including quinones and other organics, account for 30%. During nighttime, soluble copper and manganese largely explain the oxidative potential of PM, while daytime has a larger contribution from unknown (likely organic) species.

  15. In vitro antioxidant and, α-glucosidase inhibitory activities and comprehensive metabolite profiling of methanol extract and its fractions from Clinacanthus nutans.

    PubMed

    Alam, Md Ariful; Zaidul, I S M; Ghafoor, Kashif; Sahena, F; Hakim, M A; Rafii, M Y; Abir, H M; Bostanudin, M F; Perumal, V; Khatib, A

    2017-03-31

    This study was aimed to evaluate antioxidant and α-glucosidase inhibitory activity, with a subsequent analysis of total phenolic and total flavonoid content of methanol extract and its derived fractions from Clinacanthus nutans accompanied by comprehensive phytochemical profiling. Liquid-liquid partition chromatography was used to separate methanolic extract to get hexane, ethyl acetate, butanol and residual aqueous fractions. The total antioxidant activity was determined by 2,2-diphenyl-1-picrylhydrazy (DPPH) radical scavenging and ferric reducing antioxidant power assay (FRAP). The antidiabetic activity of methanol extract and its consequent fractions were examined by α-glucosidase inhibitory bioassay. The chemical profiling was carried out by gas chromatography coupled with quadrupole time-of-flight mass spectrometry (GC Q-TOF MS). The total yield for methanol extraction was (12.63 ± 0.98) % (w/w) and highest fractionated value found for residual aqueous (52.25 ± 1.01) % (w/w) as compared to the other fractions. Significant DPPH free radical scavenging activity was found for methanolic extract (63.07 ± 0.11) % and (79.98 ± 0.31) % for ethyl acetate fraction among all the fractions evaluated. Methanol extract was the most prominent in case of FRAP (141.89 ± 0.87 μg AAE/g) whereas most effective reducing power observed in ethyl acetate fraction (133.6 ± 0.2987 μg AAE/g). The results also indicated a substantial α-glucosidase inhibitory activity for butanol fraction (72.16 ± 1.0) % and ethyl acetate fraction (70.76 ± 0.49) %. The statistical analysis revealed that total phenolic and total flavonoid content of the samples had the significant (p < 0.05) impact on DPPH free radical scavenging and α-glucosidase inhibitory activity. Current results proposed the therapeutic potential of Clinacanthus nutans, especially ethyl acetate and butanol fraction as chemotherapeutic agent against oxidative related cellular damages and control the postprandial hyperglycemia. The phytochemical investigation showed the existence of active constituents in Clinacanthus nutans extract and fractions.

  16. Phytochemical composition and antioxidant capacity of Cordia dichotoma seeds.

    PubMed

    Tian, Shuge; Liu, Feng; Zhang, Xuejia; Upur, Halmuart

    2014-09-01

    This study aims to determine the phytochemical composition and antioxidant activity of air-dried Cordia dichotoma seeds. Total polyphenolic content was analyzed via the Folin-Ciocalteu method. Total triterpenoid content and amino acids was analyzed colorimetrically. The rosmarinic acid content was examined using high-performance liquid chromatography tandem mass spectrometry. The ethanolic extracts contained polyphenolic compounds (1.0%), triterpenoids (0.075%), amino acids (1.39%), and rosmarinic acid (0.0028%). The results from this study indicate that C. dichotoma seeds are a rich source of polyphenolic compounds and amino acids, which can be used for quality assessment. The ethanolic extract of C. dichotoma seeds has good antioxidant capacity.

  17. Studies on antioxidant activity, volatile compound and fatty acid composition of different parts of Glycyrrhiza echinata L.

    PubMed Central

    Çakmak, Yavuz Selim; Aktumsek, Abdurrahman; Duran, Ahmet

    2012-01-01

    The essential oil compound, fatty acid composition and the in vitro antioxidant activity of the root and aerial of Glycyrrhiza echinata L., a medicinal plant growing in Turkey, have been studied. The antioxidant capacity tests were designed to evaluate the antioxidant activities of methanol extracts. Total phenolic and flavonoid concentrations of each extract were also determined by using both Folin-Ciocalteu reagent and aluminum chloride. The aerial part was found to possess the highest total phenolic content (146.30 ± 4.58 mg GAE/g) and total antioxidant capacity (175.33 ± 3.98 mg AE/g). The essential oil from root and aerial parts was analyzed by gas chromatography mass spectroscopy (GC-MS) systems. The major components identified were n-hexadecanoic acid, hexahydro farnesyl acetone, α-caryophyllen, hexanal and phytol. In fatty acid profiles of plant, palmitic, stearic, oleic and linoleic acid were detected as the main components. The results of this study have shown that the extracts G. echinata are suitable as a natural antioxidant and food supplement source for pharmacological and food industries due to their beneficial chemical composition and antioxidant capacity. PMID:27418901

  18. A Motivational Model of Physical Education and Links to Enjoyment, Knowledge, Performance, Total Physical Activity and Body Mass Index

    PubMed Central

    Gråstén, Arto; Watt, Anthony

    2017-01-01

    The present paper examined the full sequence of the Hierarchical Model of Motivation in physical education (PE) including motivational climate, basic psychological needs, intrinsic motivation, and related links to contextual enjoyment, knowledge, performance, and total moderate to vigorous physical activity (MVPA). Gender differences and correlations with body mass index (BMI) were also analyzed. Cross-sectional data was represented by self-reports and objective assessments of 770 middle school students (52% of girls) in North-East Finland. The results showed that task-involving climate in girls’ PE classes was related to enjoyment and knowledge through physical competence and intrinsic motivation, whereas task-involving climate was associated with enjoyment and knowledge via competence and autonomy, and total MVPA via autonomy, intrinsic motivation, and knowledge within boys. This may indicate that girls and boys perceive PE classes in a different way. Graded PE assessments appeared to be essential in motivating both girls and boys to participate in greater total MVPA, whereas BMI was negatively linked with competence and social relatedness only among girls. Although, the current and previous empirical findings supported task-involving teaching methods in PE, in some cases, ego-involving climate should be considered. Therefore, both task- and ego-involving teaching practices can be useful ways of developing preferred behaviors in PE classes. Key points The present findings indicated that girls and boys perceive PE classes in a different way. Graded PE assessments appeared to be essential in motivating both girls and boys to participate in greater total MVPA, whereas BMI was negatively linked with competence and social relatedness only among girls. Although, the current and previous empirical findings supported task-involving teaching methods in PE, in some cases, ego-involving climate should be considered. Both task- and ego-involving teaching practices can be useful ways of developing preferred behaviors in PE classes. PMID:28912648

  19. Relationship of obesity with osteoporosis

    PubMed Central

    Zhao, Lan-Juan; Liu, Yong-Jun; Liu, Peng-Yuan; Hamilton, James; Recker, Robert R.; Deng, Hong-Wen

    2007-01-01

    Context The relationship between obesity and osteoporosis has been widely studied, and epidemiological evidence shows that obesity is correlated with increased bone mass. Previous analyses, however, did not control for the mechanical loading effects of total body weight on bone mass and may have generated a confounded or even biased relationship between obesity and osteoporosis. Objective To re-evaluate the relationship between obesity and osteoporosis by accounting for the mechanical loading effects of total body weight on bone mass. Methods We measured whole body fat mass, lean mass, percentage fat mass (PFM), body mass index (BMI), and bone mass in two large samples of different ethnicity: 1,988 unrelated Chinese subjects and 4,489 Caucasian subjects from 512 pedigrees. We first evaluated the Pearson correlations among different phenotypes. We then dissected the phenotypic correlations into genetic and environmental components, with bone mass unadjusted, or adjusted, for body weight. This allowed us to compare the results with and without controlling for mechanical loading effects of body weight on bone mass. Results In both Chinese and Caucasians, when the mechanical loading effect of body weight on bone mass was adjusted for, the phenotypic correlation (including its genetic and environmental components) between fat mass (or PFM) and bone mass was negative. Further multivariate analyses in subjects stratified by body weight confirmed the inverse relationship between bone mass and fat mass, after mechanical loading effects due to total body weight was controlled. Conclusions Increasing fat mass may not have a beneficial effect on bone mass. PMID:17299077

  20. Frequency, Type, and Volume of Leisure-Time Physical Activity and Risk of Coronary Heart Disease in Young Women.

    PubMed

    Chomistek, Andrea K; Henschel, Beate; Eliassen, A Heather; Mukamal, Kenneth J; Rimm, Eric B

    2016-07-26

    The inverse association between physical activity and coronary heart disease (CHD) risk has primarily been shown in studies of middle-aged and older adults. Evidence for the benefits of frequency, type, and volume of leisure-time physical activity in young women is limited. We conducted a prospective analysis among 97 230 women aged 27 to 44 years at baseline in 1991. Leisure-time physical activity was assessed biennially by questionnaire. Cox proportional hazards models were used to examine the associations between physical activity frequency, type, and volume, and CHD risk. During 20 years of follow-up, we documented 544 incident CHD cases. In multivariable-adjusted models, the hazard ratio (95% confidence interval) of CHD comparing ≥30 with <1 metabolic equivalent of task-hours/wk of physical activity was 0.75 (0.57-0.99) (P, trend=0.01). Brisk walking alone was also associated with significantly lower CHD risk. Physical activity frequency was not associated with CHD risk when models also included overall activity volume. Finally, the association was not modified by body mass index (kg/m(2)) (P, interaction=0.70). Active women (≥30 metabolic equivalent of task-hours/wk) with body mass index<25 kg/m(2) had 0.52 (95% confidence interval, 0.35-0.78) times the rate of CHD in comparison with women who were obese (body mass index≥30 kg/m(2)) and inactive (physical activity <1 metabolic equivalent of task-hours/wk). These prospective data suggest that total volume of leisure-time physical activity is associated with lower risk of incident CHD among young women. In addition, this association was not modified by weight, emphasizing that it is important for normal weight, overweight, and obese women to be physically active. © 2016 American Heart Association, Inc.

  1. Allometric Scaling of the Active Hematopoietic Stem Cell Pool across Mammals

    PubMed Central

    Dingli, David; Pacheco, Jorge M.

    2006-01-01

    Background Many biological processes are characterized by allometric relations of the type Y = Y 0 Mb between an observable Y and body mass M, which pervade at multiple levels of organization. In what regards the hematopoietic stem cell pool, there is experimental evidence that the size of the hematopoietic stem cell pool is conserved in mammals. However, demands for blood cell formation vary across mammals and thus the size of the active stem cell compartment could vary across species. Methodology/Principle Findings Here we investigate the allometric scaling of the hematopoietic system in a large group of mammalian species using reticulocyte counts as a marker of the active stem cell pool. Our model predicts that the total number of active stem cells, in an adult mammal, scales with body mass with the exponent ¾. Conclusion/Significance The scaling predicted here provides an intuitive justification of the Hayflick hypothesis and supports the current view of a small active stem cell pool supported by a large, quiescent reserve. The present scaling shows excellent agreement with the available (indirect) data for smaller mammals. The small size of the active stem cell pool enhances the role of stochastic effects in the overall dynamics of the hematopoietic system. PMID:17183646

  2. Total cyanide mass measurement with micro-ion selective electrode for determination of specific activity of carbon-11 cyanide.

    PubMed

    Shea, Colleen; Alexoff, David L; Kim, Dohyun; Hoque, Ruma; Schueller, Michael J; Fowler, Joanna S; Qu, Wenchao

    2015-08-01

    In this research, we aim to directly measure the specific activity (SA) of the carbon-11 cyanide ([(11)C]CN¯) produced by our in-house built automated [(11)C]HCN production system and to identify the major sources of (12)C-cyanide ((12)CN¯). The [(11)C]CN¯ is produced from [(11)C]CO2, which is generated by the (14)N(p,α)(11)C nuclear reaction using a cyclotron. Direct measurement of cyanide concentrations was accomplished using a relatively inexpensive, and easy to use ion selective electrode (ISE) which offered an appropriate range of sensitivity for detecting mass. Multiple components of the [(11)C]HCN production system were isolated in order to determine their relative contributions to (12)CN¯ mass. It was determined that the system gases were responsible for approximately 30% of the mass, and that the molecular sieve/nickel furnace unit contributed approximately 70% of the mass. Beam on target (33µA for 1 and 10min) did not contribute significantly to the mass. Additionally, we compared the SA of our [(11)C]HCN precursor determined using the ISE to the SA of our current [(11)C]CN¯ derived radiotracers determined by HPLC to assure there was no significant difference between the two methods. These results are the first reported use of an ion selective electrode to determine the SA of no-carrier-added cyanide ion, and clearly show that it is a valuable, inexpensive and readily available tool suitable for this purpose. Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. Total cyanide mass measurement with micro-ion selective electrode for determination of specific activity of carbon-11 cyanide

    DOE PAGES

    Shea, Colleen; Alexoff, David L.; Kim, Dohyun; ...

    2015-04-25

    In this study, we aim to directly measure the specific activity (SA) of the carbon-11 cyanide ([ 11C]CN¯) produced by our in-house built automated [ 11C]HCN production system and to identify the major sources of 12C-cyanide ( 12CN¯). The [ 11C]CN¯ is produced from [ 11C]CO 2, which is generated by the 14N(p,α) 11C nuclear reaction using a cyclotron. Direct measurement of cyanide concentrations was accomplished using a relatively inexpensive, and easy to use ion selective electrode (ISE) which offered an appropriate range of sensitivity for detecting mass. Multiple components of the [ 11C]HCN production system were isolated in ordermore » to determine their relative contributions to 12CN¯ mass. It was determined that the system gases were responsible for approximately 30% of the mass, and that the molecular sieve/nickel furnace unit contributed approximately 70% of the mass. Beam on target (33 µA for 1 and 10 min) did not contribute significantly to the mass. Additionally, we compared the SA of our [ 11C]HCN precursor determined using the ISE to the SA of our current [ 11C]CN¯ derived radiotracers determined by HPLC to assure there was no significant difference between the two methods. These results are the first reported use of an ion selective electrode to determine the SA of no-carrier-added cyanide ion, and clearly show that it is a valuable, inexpensive and readily available tool suitable for this purpose.« less

  4. Total cyanide mass measurement with micro-ion selective electrode for determination of specific activity of carbon-11 cyanide

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Shea, Colleen; Alexoff, David L.; Kim, Dohyun

    In this study, we aim to directly measure the specific activity (SA) of the carbon-11 cyanide ([ 11C]CN¯) produced by our in-house built automated [ 11C]HCN production system and to identify the major sources of 12C-cyanide ( 12CN¯). The [ 11C]CN¯ is produced from [ 11C]CO 2, which is generated by the 14N(p,α) 11C nuclear reaction using a cyclotron. Direct measurement of cyanide concentrations was accomplished using a relatively inexpensive, and easy to use ion selective electrode (ISE) which offered an appropriate range of sensitivity for detecting mass. Multiple components of the [ 11C]HCN production system were isolated in ordermore » to determine their relative contributions to 12CN¯ mass. It was determined that the system gases were responsible for approximately 30% of the mass, and that the molecular sieve/nickel furnace unit contributed approximately 70% of the mass. Beam on target (33 µA for 1 and 10 min) did not contribute significantly to the mass. Additionally, we compared the SA of our [ 11C]HCN precursor determined using the ISE to the SA of our current [ 11C]CN¯ derived radiotracers determined by HPLC to assure there was no significant difference between the two methods. These results are the first reported use of an ion selective electrode to determine the SA of no-carrier-added cyanide ion, and clearly show that it is a valuable, inexpensive and readily available tool suitable for this purpose.« less

  5. Physical Activity, Energy Expenditure, and Defense of Body Weight in Melanocortin 4 Receptor-Deficient Male Rats

    PubMed Central

    Almundarij, Tariq I.; Smyers, Mark E.; Spriggs, Addison; Heemstra, Lydia A.; Beltz, Lisa; Dyne, Eric; Ridenour, Caitlyn; Novak, Colleen M.

    2016-01-01

    Melanocortin 4 receptor (MC4R) variants contribute to human obesity, and rats lacking functional MC4R (Mc4rK314X/K314X) are obese. We investigated the hypothesis that low energy expenditure (EE) and physical activity contribute to this obese phenotype in male rats, and determined whether lack of functional MC4R conferred protection from weight loss during 50% calorie restriction. Though Mc4rK314X/K314X rats showed low brown adipose Ucp1 expression and were less physically active than rats heterozygous for the mutation (Mc4r+/K314X) or wild-type (Mc4r+/+) rats, we found no evidence of lowered EE in Mc4rK314X/K314X rats once body weight was taken into account using covariance. Mc4rK314X/K314X rats had a significantly higher respiratory exchange ratio. Compared to Mc4r+/+ rats, Mc4rK314X/K314X and Mc4r+/K314X rats lost less lean mass during calorie restriction, and less body mass when baseline weight was accounted for. Limited regional overexpression of Mc3r was found in the hypothalamus. Although lower physical activity levels in rats with nonfunctional MC4R did not result in lower total EE during free-fed conditions, rats lacking one or two functional copies of Mc4r showed conservation of mass, particularly lean mass, during energy restriction. This suggests that variants affecting MC4R function may contribute to individual differences in the metabolic response to food restriction. PMID:27886210

  6. Active Flow Control on a Boundary-Layer-Ingesting Inlet

    NASA Technical Reports Server (NTRS)

    Gorton, Susan Althoff; Owens, Lewis R.; Jenkins, Luther N.; Allan, Brian G.; Schuster, Ernest P.

    2004-01-01

    Boundary layer ingestion (BLI) is explored as means to improve overall system performance for Blended Wing Body configuration. The benefits of BLI for vehicle system performance benefit are assessed with a process derived from first principles suitable for highly-integrated propulsion systems. This performance evaluation process provides framework within which to assess the benefits of an integrated BLI inlet and lays the groundwork for higher-fidelity systems studies. The results of the system study show that BLI provides a significant improvement in vehicle performance if the inlet distortion can be controlled, thus encouraging the pursuit of active flow control (AFC) as a BLI enabling technology. The effectiveness of active flow control in reducing engine inlet distortion was assessed using a 6% scale model of a 30% BLI offset, diffusing inlet. The experiment was conducted in the NASA Langley Basic Aerodynamics Research Tunnel with a model inlet designed specifically for this type of testing. High mass flow pulsing actuators provided the active flow control. Measurements were made of the onset boundary layer, the duct surface static pressures, and the mass flow through the duct and the actuators. The distortion was determined by 120 total pressure measurements located at the aerodynamic interface plane. The test matrix was limited to a maximum freestream Mach number of 0.15 with scaled mass flows through the inlet for that condition. The data show that the pulsed actuation can reduce distortion from 29% to 4.6% as measured by the circumferential distortion descriptor DC60 using less than 1% of inlet mass flow. Closed loop control of the actuation was also demonstrated using a sidewall surface static pressure as the response sensor.

  7. Testosterone and androstanediol glucuronide among men in NHANES III.

    PubMed

    Duan, Chuan Wei; Xu, Lin

    2018-03-09

    Most of the androgen replacement therapies were based on serum testosterone and without measurements of total androgen activities. Whether those with low testosterone also have low levels of androgen activity is largely unknown. We hence examined the association between testosterone and androstanediol glucuronide (AG), a reliable measure of androgen activity, in a nationally representative sample of US men. Cross-sectional analysis was based on 1493 men from the Third National Health and Nutrition examination Survey (NHANES III) conducted from 1988 to 1991. Serum testosterone and AG were measured by immunoassay. Kernel density was used to estimate the average density of serum AG concentrations by quartiles of testosterone. Testosterone was weakly and positively correlated with AG (correlation coefficient = 0.18). The kernel density estimates show that the distributions are quite similar between the quartiles of testosterone. After adjustment for age, the distributions of AG in quartiles of testosterone did not change. The correlation between testosterone and AG was stronger in men with younger age, lower body mass index, non-smoking and good self-rated health and health status. Serum testosterone is weakly correlated with total androgen activities, and the correlation is even weaker for those with poor self-rated health. Our results suggest that measurement of total androgen activity in addition to testosterone is necessary in clinical practice, especially before administration of androgen replacement therapy.

  8. Overall adsorption rate of metronidazole, dimetridazole and diatrizoate on activated carbons prepared from coffee residues and almond shells.

    PubMed

    Flores-Cano, J V; Sánchez-Polo, M; Messoud, J; Velo-Gala, I; Ocampo-Pérez, R; Rivera-Utrilla, J

    2016-03-15

    This study analyzed the overall adsorption rate of metronidazole, dimetridazole, and diatrizoate on activated carbons prepared from coffee residues and almond shells. It was also elucidated whether the overall adsorption rate was controlled by reaction on the adsorbent surface or by intraparticle diffusion. Experimental data of the pollutant concentration decay curves as a function of contact time were interpreted by kinetics (first- and second-order) and diffusion models, considering external mass transfer, surface and/or pore volume diffusion, and adsorption on an active site. The experimental data were better interpreted by a first-order than second-order kinetic model, and the first-order adsorption rate constant varied linearly with respect to the surface area and total pore volume of the adsorbents. According to the diffusion model, the overall adsorption rate is governed by intraparticle diffusion, and surface diffusion is the main mechanism controlling the intraparticle diffusion, representing >90% of total intraparticle diffusion. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Environmental bacteria produce abundant and diverse antibiofilm compounds.

    PubMed

    Farmer, J T; Shimkevitch, A V; Reilly, P S; Mlynek, K D; Jensen, K S; Callahan, M T; Bushaw-Newton, K L; Kaplan, J B

    2014-12-01

    The aim of this study was to isolate novel antibiofilm compounds produced by environmental bacteria. Cell-free extracts were prepared from lawns of bacteria cultured on agar. A total of 126 bacteria isolated from soil, cave and river habitats were employed. Extracts were tested for their ability to inhibit Staphylococcus aureus biofilm in a 96-well microtitre plate assay. A total of 55/126 extracts (44%) significantly inhibited Staph. aureus biofilm. Seven extracts were selected for further analysis. The antibiofilm activities in all seven extracts exhibited unique patterns of molecular mass, chemical polarity, heat stability and spectrum of activity against Staph. aureus, Staphylococcus epidermidis and Pseudomonas fluorescens, suggesting that these seven antibiofilm activities were mediated by unique chemical compounds with different mechanisms of action. Environmental bacteria produce abundant and diverse antibiofilm compounds. Screening cell-free extracts is a useful method for identifying secreted compounds that regulate biofilm formation. Such compounds may represent a novel source of antibiofilm agents for technological development. © 2014 The Society for Applied Microbiology.

  10. Trachyspermum ammi (L.) sprague: chemical composition of essential oil and antimicrobial activities of respective fractions.

    PubMed

    Moein, Mahmoodreza R; Zomorodian, Kamiar; Pakshir, Keyvan; Yavari, Farnoosh; Motamedi, Marjan; Zarshenas, Mohammad M

    2015-01-01

    Resistance to antibacterial agents has become a serious problem for global health. The current study evaluated the antimicrobial activities of essential oil and respective fractions of Trachyspermum ammi (L.) Sprague. Seeds of the essential oil were extracted and fractionated using column chromatography. All fractions were then analyzed by gas chromatography/mass spectrometry. Antifungal and antibacterial activities of the oil and its fractions were assessed using microdilution method. Compounds γ-terpinene (48.07%), ρ-cymene (33.73%), and thymol (17.41%) were determined as major constituents. The effect of fraction II was better than total essential oil, fraction I, and standard thymol. The greater effect of fraction II compared to standard thymol showed the synergistic effects of the ingredients in this fraction. As this fraction and also total oil were effective on the studied microorganism, the combination of these products with current antimicrobial agents could be considered as new antimicrobial compounds in further investigations. © The Author(s) 2014.

  11. Enhancing total nitrogen removal from wastewater of a science and industrial park using entrapped biomass.

    PubMed

    Chao, Yeong-Nan; Ng, Kok-Kwang; Wu, Chung-Hsin; Hong, Pui-Kwan Andy; Lin, Cheng-Fang

    2014-01-01

    This study employed entrapped biomass technology to augment the conventional activated sludge process with anoxic-oxic (AO)/anaerobic-anoxic-oxic (A20) functions for the removal of total nitrogen (TN) from wastewater of a science and industrial park in Taiwan. The entrapped biomass unit was fabricated in the format of carrier plates on which microbial cells were entrapped. Due to mass transport limitations, anoxic and anaerobic conditions were created within the bioplates that enabled denitrification to occur. The treatment basin incorporated an equivalent amount of 1300-2400mg MLSS/L of activated sludge on the bioplates at packing ratios of 10-30% (volume ratio ofbioplates to basin) operating with the addition of sodium carbonate for alkalinity and methanol for the electron donor. The results showed nearly 90% of ammonia nitrogen being converted to nitrate and 63% of TN removal, in comparison with typically 10% of TN removal in traditional activated sludge process of domestic wastewater plants.

  12. The independent roles of cardiorespiratory fitness and sedentary time on chronic conditions and Body Mass Index in older adults.

    PubMed

    Stathokostas, L; Dogra, S; Paterson, D H

    2015-10-01

    The aim of this paper was to examine the independent influence of cardiorespiratory fitness and sedentary behavior on chronic disease incidence and body composition in older adults. A sample of 292 community dwelling men and women (mean 69.3±8.1 years) underwent maximal treadmill testing and completed questionnaires relating to their leisure-time physical activity, sedentary time, and health. The average V O2 of the sample was approximately 21 ml.kg(-1).min(-1) with the average sedentary time being over 3 hours per day. Cardiorespiratory fitness was found to be a stronger predictor of number of chronic conditions and BMI than total physical activity and sedentary. Those with a higher cardiorespiratory fitness had fewer chronic conditions and a lower BMI. No such associations were seen for either total physical activity levels or sedentary time. Cardiorespiratory fitness is a stronger predictor of health among older adults and further highlights the importance of promoting public health guidelines for cardiorespiratory fitness.

  13. Estimation of total discharged mass from the phreatic eruption of Ontake Volcano, central Japan, on September 27, 2014

    NASA Astrophysics Data System (ADS)

    Takarada, Shinji; Oikawa, Teruki; Furukawa, Ryuta; Hoshizumi, Hideo; Itoh, Jun'ichi; Geshi, Nobuo; Miyagi, Isoji

    2016-08-01

    The total mass discharged by the phreatic eruption of Ontake Volcano, central Japan, on September 27, 2014, was estimated using several methods. The estimated discharged mass was 1.2 × 106 t (segment integration method), 8.9 × 105 t (Pyle's exponential method), and varied from 8.6 × 103 to 2.5 × 106 t (Hayakawa's single isopach method). The segment integration and Pyle's exponential methods gave similar values. The single isopach method, however, gave a wide range of results depending on which contour was used. Therefore, the total discharged mass of the 2014 eruption is estimated at between 8.9 × 105 and 1.2 × 106 t. More than 90 % of the total mass accumulated within the proximal area. This shows how important it is to include a proximal area field survey for the total mass estimation of phreatic eruptions. A detailed isopleth mass distribution map was prepared covering as far as 85 km from the source. The main ash-fall dispersal was ENE in the proximal and medial areas and E in the distal area. The secondary distribution lobes also extended to the S and NW proximally, reflecting the effects of elutriation ash and surge deposits from pyroclastic density currents during the phreatic eruption. The total discharged mass of the 1979 phreatic eruption was also calculated for comparison. The resulting volume of 1.9 × 106 t (using the segment integration method) indicates that it was about 1.6-2.1 times larger than the 2014 eruption. The estimated average discharged mass flux rate of the 2014 eruption was 1.7 × 108 kg/h and for the 1979 eruption was 1.0 × 108 kg/h. One of the possible reasons for the higher flux rate of the 2014 eruption is the occurrence of pyroclastic density currents at the summit area.

  14. Maternal polyunsaturated fatty acid plasma levels during pregnancy and childhood adiposity. The Generation R Study

    PubMed Central

    Vidakovic, Aleksandra Jelena; Gishti, Olta; Voortman, Trudy; Felix, Janine F.; Williams, Michelle A.; Hofman, Albert; Demmelmair, Hans; Koletzko, Berthold; Tiemeier, Henning; Jaddoe, Vincent WV; Gaillard, Romy

    2017-01-01

    Background Maternal polyunsaturated fatty acid (PUFA) levels during pregnancy may have persistent effects on growth and adiposity in the offspring. Suboptimal maternal diet during pregnancy might lead to fetal cardio-metabolic adaptations with persistent consequences in the offspring. Objective We examined the associations of maternal PUFA levels during pregnancy with childhood general and abdominal fat distribution measures. Design In a population-based prospective cohort study among 4,830 mothers and their children, we measured maternal second trimester n-3 and n-6 PUFA plasma levels. At the median age of 6.0 years (95% range, 5.6–7.9), we measured childhood body mass index, fat mass percentage, android/gynoid fat ratio with dual-energy x-ray absorptiometry, and pre-peritoneal abdominal fat area with ultrasound. Analyses were adjusted for maternal and childhood socio-demographic and lifestyle related characteristics. Results We observed that higher maternal total n-3 PUFA levels, and specifically eicosapentaenoic acid (EPA), docosapentaenoic acid (DPA), docosahexaenoic acid (DHA) levels, were associated with lower childhood total body fat percentage and lower android/gynoid fat mass ratio (p-values<0.05), but not with childhood body mass index and abdominal pre-peritoneal fat mass area. Higher maternal total n-6 PUFA levels and specifically dihomo-gamma linolenic acid (DGLA) were associated with a higher childhood total body fat percentage, android/gynoid fat mass ratio and abdominal pre-peritoneal fat mass area (p-values<0.05), but not with childhood body mass index. In line with these findings, a higher maternal n-6/n-3 PUFA ratio was associated with higher childhood total body and abdominal fat mass levels. Conclusions Lower maternal n-3 PUFA levels and higher n-6 PUFA levels during pregnancy are associated with higher total body fat and abdominal fat levels in childhood. Further studies are needed to replicate these observations and to explore the causality, the underlying pathways and long-term cardio-metabolic consequences. PMID:26912493

  15. TNFα blockade for inflammatory rheumatic diseases is associated with a significant gain in android fat mass and has varying effects on adipokines: a 2-year prospective study.

    PubMed

    Toussirot, Éric; Mourot, Laurent; Dehecq, Barbara; Wendling, Daniel; Grandclément, Émilie; Dumoulin, Gilles

    2014-04-01

    To evaluate the long-term consequences of TNFα inhibitors on body composition and fat distribution, as well as changes in serum adipokines in patients with rheumatoid arthritis (RA) or ankylosing spondylitis (AS). Eight patients with RA and twelve with AS requiring a TNFα inhibitor were prospectively followed for 2 years. Body composition was evaluated by dual X-ray absorptiometry and included measurements of total fat mass, lean mass, fat in the gynoid and android regions, and visceral fat. Serum leptin, total and high molecular weight (HMW) adiponectin, resistin, and ghrelin were also assessed. There was a significant gain in body mass index (p = 0.05) and a tendency for weight (p = 0.07), android fat (p = 0.07), and visceral fat (p = 0.059) increase in patients with RA, while in AS, total fat mass significantly increased (p = 0.02) with a parallel weight gain (p = 0.07). When examining the whole population of patients, we observed after 2 years a significant increase in body weight (+1.9%; p = 0.003), body mass index (+2.5%; p = 0.004), total fat mass (+11.1%; p = 0.007), and fat in the android region (+18.3%; p = 0.02). There was a substantial, albeit nonsignificant gain in visceral fat (+24.3%; p = 0.088). Lean mass and gynoid fat were not modified. No major changes were observed for serum leptin, total adiponectin, and ghrelin, while HMW adiponectin and the HMW/total adiponectin ratio tended to decrease (-15.2%, p = 0.057 and -9.3%, p = 0.067, respectively). Resistin decreased significantly (-22.4%, p = 0.01). Long-term TNFα inhibition in RA and AS is associated with a significant gain in fat mass, with a shift to the android (visceral) region. This fat redistribution raises questions about its influence on the cardiovascular profile of patients receiving these treatments.

  16. Cluster galaxy population evolution from the Subaru Hyper Suprime-Cam survey: brightest cluster galaxies, stellar mass distribution, and active galaxies

    NASA Astrophysics Data System (ADS)

    Lin, Yen-Ting; Hsieh, Bau-Ching; Lin, Sheng-Chieh; Oguri, Masamune; Chen, Kai-Feng; Tanaka, Masayuki; Chiu, I.-non; Huang, Song; Kodama, Tadayuki; Leauthaud, Alexie; More, Surhud; Nishizawa, Atsushi J.; Bundy, Kevin; Lin, Lihwai; Miyazaki, Satoshi; HSC Collaboration

    2018-01-01

    The unprecedented depth and area surveyed by the Subaru Strategic Program with the Hyper Suprime-Cam (HSC-SSP) have enabled us to construct and publish the largest distant cluster sample out to z~1 to date. In this exploratory study of cluster galaxy evolution from z=1 to z=0.3, we investigate the stellar mass assembly history of brightest cluster galaxies (BCGs), and evolution of stellar mass and luminosity distributions, stellar mass surface density profile, as well as the population of radio galaxies. Our analysis is the first high redshift application of the top N richest cluster selection, which is shown to allow us to trace the cluster galaxy evolution faithfully. Our stellar mass is derived from a machine-learning algorithm, which we show to be unbiased and accurate with respect to the COSMOS data. We find very mild stellar mass growth in BCGs, and no evidence for evolution in both the total stellar mass-cluster mass correlation and the shape of the stellar mass surface density profile. The clusters are found to contain more red galaxies compared to the expectations from the field, even after the differences in density between the two environments have been taken into account. We also present the first measurement of the radio luminosity distribution in clusters out to z~1.

  17. Impact of Interstellar Vehicle Acceleration and Cruise Velocity on Total Mission Mass and Trip Time

    NASA Technical Reports Server (NTRS)

    Frisbee, Robert H.

    2006-01-01

    Far-term interstellar missions, like their near-term solar system exploration counterparts, seek to minimize overall mission trip time and transportation system mass. Trip time is especially important in interstellar missions because of the enormous distances between stars and the finite limit of the speed of light (c). In this paper, we investigate the impact of vehicle acceleration and maximum or cruise velocity (Vcruise) on the total mission trip time. We also consider the impact that acceleration has on the transportation system mass (M) and power (P) (e.g., acceleration approx. power/mass and mass approx. power), as well as the impact that the cruise velocity has on the vehicle mass (e.g., the total mission change in velocity ((Delta)V) approx. Vcruise). For example, a Matter-Antimatter Annihilation Rocket's wet mass (Mwet) with propellant (Mp) will be a function of the dry mass of the vehicle (Mdry) and (Delta)V through the Rocket Equation. Similarly, a laser-driven LightSail's sail mass and laser power and mass will be a function of acceleration, Vcruise, and power-beaming distance (because of the need to focus the laser beam over interstellar distances).

  18. The catalytic activity of CoMo/USY on deoxygenation reaction of anisole in a batch reactor

    NASA Astrophysics Data System (ADS)

    Nugrahaningtyas, K. D.; Putri, I. F.; Heraldy, E.; Hidayat, Y.

    2018-04-01

    The catalytic hydrodeoxigenation of the bio oil model compounds (biomass pyrolysis results) typically uses sulphide catalysts. In this study, we studied the activity of non-sulphide catalyst, the effect of temperature and reaction time on anisole deoxygenation. The catalytic activity was performed in a batch reactor, using N2 gas at 1 bar of pressure. The product was analyzed by gas chromatography (GC) and gas chromatography-mass spectrometry (GC-MS). The result showed that the Co-Mo/USY catalyst perform a highest activity and produce pentamethylbenzene, an oxygen free products, when reaction time is 2 hours. The Co-Mo/USY catalysts has the value of the total yield of the product increased with time increase drastically.

  19. Development of a mass balance model for estimating PCB export from the lower Fox River to Green Bay

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Velleux, M.; Endicott, D.

    A mass balance approach was used to model contaminant cycling in the lower Fox River from the DePere Dam to Green Bay. The objectives of this research were (1) to estimate present contaminant export from the Fox River to Green Bay, and (2) to quantify contaminant transport and fate pathways in the lower river for the study period. Specifically, a model describing the transport, fate, and export of chlorides, total suspended solids, total PCBs, and six PCB congeners for the lower Fox River was developed. Field data collected as part of the U.S. Environmental Protection Agency's Green Bay Mass Balancemore » Study were used to calibrate the model. Model results suggest that the transport of inplace pollutants significantly contributed to the cumulative export of total PCBs over this period. Estimated total PCB transport in the Fox River during 1989 increased 60% between the dam and river mouth due to the resuspension of lower river sediments. Total suspended solids and PCB predictions are most sensitive to particle transport parameters, particularly the settling and resuspension velocities. The significant components of the total PCB mass balance are import (loading over the DePere Dam), settling, resuspension, and export to Green Bay. Volatilization, porewater transport, and point source input were not significant to the mass balance. Present point source discharges to the river are not significant total PCB sources, collectively contributing less than 6 kg of PCB to the river during the mass balance period.« less

  20. Early nutritional support and physiotherapy improved long-term self-sufficiency in acutely ill older patients.

    PubMed

    Hegerová, Petra; Dědková, Zuzana; Sobotka, Luboš

    2015-01-01

    An acute disease is regularly associated with inflammation, decreased food intake, and low physical activity; the consequence is loss of muscle mass. However, the restoration of muscle tissue is problematic, especially in older patients. Loss of muscle mass leads to further decrease of physical activity which leads, together with recurring disease, to the progressive muscle mass loss accompanied by loss of self-sufficiency. Early nutrition support and physical activity could reverse this situation. Therefore, the aim of this study was to determine whether an active approach based on early nutritional therapy and exercise would influence the development of sarcopenia and impaired self-sufficiency during acute illness. Two hundred patients >78 y were admitted to a hospital internal medicine department and participated in a prospective, randomized controlled study. The patients were randomized to a control group receiving standard treatment (n = 100) or to an intervention group (n = 100). The intervention consisted of nutritional supplements (600 kcal, 20 g/d protein) added to a standard diet and a simultaneous intensive rehabilitation program. The tolerance of supplements and their influence on spontaneous food intake, self-sufficiency, muscle strength, and body composition were evaluated during the study period. The patients were then regularly monitored for 1 y post-discharge. The provision of nutritional supplements together with early rehabilitation led to increased total energy and protein intake while the intake of standard hospital food was not reduced. The loss of lean body mass and a decrease in self-sufficiency were apparent at discharge from the hospital and 3 mo thereafter in the control group. Nutritional supplementation and the rehabilitation program in the study group prevented these alterations. A positive effect of nutritional intervention and exercise during the hospital stay was apparent at 6 mo post-discharge. The early nutritional intervention together with early rehabilitation preserves muscle mass and independence in ill older patients hospitalized because of acute disease. Copyright © 2015 Elsevier Inc. All rights reserved.

Top