Investigating differences in the root to shoot transfer and xylem sap solubility of organic compounds between zucchini, squash and soybean using a pressure chamber method.

PubMed

Garvin, Naho; Doucette, William J; White, Jason C

2015-07-01

A pressure chamber method was used to examine differences in the root to shoot transfer and xylem sap solubility of caffeine (log Kow=-0.07), triclocarban (log Kow=3.5-4.2) and endosulfan (log Kow=3.8-4.8) for zucchini (cucurbita pepo ssp pepo), squash (cucurbita pepo ssp ovifera), and soybean (glycine max L.). Transpiration stream concentration factors (TSCF) for caffeine (TSCF=0.8) were statistically equivalent for all plant species. However, for the more hydrophobic endosulfan and triclocarban, the TSCF values for zucchini (TSCF=0.6 and 0.4, respectively) were 3 and 10 times greater than the soybean and squash (TSCF=0.2 and 0.05, respectively). The difference in TSCF values was examined by comparing the measured solubilities of caffeine, endosulfan and triclocarban in deionized water to those in soybean and zucchini xylem saps using a modified shake flask method. The measured solubility of organic contaminants in xylem sap has not previously been reported. Caffeine solubilities in the xylem saps of soybean and zucchini were statistically equal to deionized water (21500mgL(-1)) while endosulfan and triclocarban solubilities in the zucchini xylem sap were significantly greater (0.43 and 0.21mgL(-1), respectively) than that of the soybean xylem sap (0.31 and 0.11mgL(-1), respectively) and deionized water (0.34 and 0.11mgL(-1), respectively). This suggests that the enhanced root to shoot transfer of hydrophobic organics reported for zucchini is partly due to increased solubility in the xylem sap. Further xylem sap characterization is needed to determine the mechanism of solubility enhancement. Copyright © 2014 Elsevier Ltd. All rights reserved.

Single dose pharmacokinetics, pharmacodynamics, tolerability and safety of BAY 60-5521, a potent inhibitor of cholesteryl ester transfer protein.

PubMed

Boettcher, Michael-Friedrich; Heinig, Roland; Schmeck, Carsten; Kohlsdorfer, Christian; Ludwig, Matthias; Schaefer, Anja; Gelfert-Peukert, Sabine; Wensing, Georg; Weber, Olaf

2012-02-01

To determine pharmacokinetics (PK), pharmacodynamics (PD), tolerability and safety of BAY 60-5521, a potent inhibitor of cholesteryl ester transfer protein (CETP). The first in man (FIM) study investigated the safety, tolerability, pharmacodynamics and pharmacokinetics in healthy male subjects following administration of single oral doses. The study was performed using a randomized, single-blind, placebo-controlled, single dose-escalation design. Thirty-eight young healthy male subjects (aged 20-45 years) received an oral dose of 5, 12.5, 25 or 50 mg BAY 60-5521 (n= 28) or were treated with a placebo (n= 10). In all four dose steps, only one adverse event (25 mg; mild skin rash) was considered drug related. Clinical laboratory parameters showed no clinically relevant changes. A clear dose-dependent CETP inhibition could be demonstrated starting at a dose of 5 mg. At a dose of 25 mg, a CETP inhibition >50% over 18 h was observed. After 50 mg, CETP inhibition >50% lasted more than 50 h. Twenty-four h after administration mean HDL-C-values showed a nearly dose-proportional increase. Following administration of 50 mg, a significant HDL-C increase of about 30% relative to baseline values was found. BAY 60-5521 was slowly absorbed reaching maximum concentrations in plasma after 4 to 6 h. The disposition in plasma was multi-exponential with an estimated mean terminal half-life of 76 to 144 h. BAY 60-5521 was clinically safe and well tolerated. No effects on heart rate, blood pressure and ECG recordings were observed during the study. A clear pharmacodynamic effect on CETP inhibition and HDL could be demonstrated. © 2011 The Authors. British Journal of Clinical Pharmacology © 2011 The British Pharmacological Society.

A systematic study of 25Mg NMR in paramagnetic transition metal oxides: applications to Mg-ion battery materials.

PubMed

Lee, Jeongjae; Seymour, Ieuan D; Pell, Andrew J; Dutton, Siân E; Grey, Clare P

2016-12-21

Rechargeable battery systems based on Mg-ion chemistries are generating significant interest as potential alternatives to Li-ion batteries. Despite the wealth of local structural information that could potentially be gained from Nuclear Magnetic Resonance (NMR) experiments of Mg-ion battery materials, systematic 25 Mg solid-state NMR studies have been scarce due to the low natural abundance, low gyromagnetic ratio, and significant quadrupole moment of 25 Mg (I = 5/2). This work reports a combined experimental 25 Mg NMR and first principles density functional theory (DFT) study of paramagnetic Mg transition metal oxide systems Mg 6 MnO 8 and MgCr 2 O 4 that serve as model systems for Mg-ion battery cathode materials. Magnetic parameters, hyperfine shifts and quadrupolar parameters were calculated ab initio using hybrid DFT and compared to the experimental values obtained from NMR and magnetic measurements. We show that the rotor assisted population transfer (RAPT) pulse sequence can be used to enhance the signal-to-noise ratio in paramagnetic 25 Mg spectra without distortions in the spinning sideband manifold. In addition, the value of the predicted quadrupolar coupling constant of Mg 6 MnO 8 was confirmed using the RAPT pulse sequence. We further apply the same methodology to study the NMR spectra of spinel compounds MgV 2 O 4 and MgMn 2 O 4 , candidate cathode materials for Mg-ion batteries.

Transfer of copper, lead and zinc in soil-grass ecosystem in aspect of soils properties, in Poland.

PubMed

Niesiobędzka, Krystyna

2012-04-01

The total metal concentrations in soil samples from polluted area (roadside soils) ranged from 13.87 to 195.76 mg/kg for Cu; 13.56-310.17 mg/kg for Pb and 18.43-894.11 mg/kg for Zn and they were, respectively about 5, 2 and 13 times above the corresponding values in soil samples from country area. The mean values of EDTA-extractable concentrations in soil samples at unpolluted sites were: 2.47 mg/kg for Cu, 6.33 mg/kg for Pb and 4.94 mg/kg for Zn. The highest concentrations of Cu, Pb and Zn in grass were measured in soils from polluted area. Higher values of proportions of EDTA-extractable metals (24% for Cu, 40% for Pb and 38% for Zn) indicate that anthropogenic metals were more mobile and bioavailable than the same metals in soils from unpolluted area (20, 16 and 20% for Cu, Pb and Zn, respectively). The availability of Cu, Pb and Zn are affected by soil properties such as pH, organic matter content and cation exchange capacity. Correlation between the EDTA-extractable forms concentrations of metals and the total concentration in the various soils was observed. The coefficients of determination (R(2)) varied between 0.809 for Cu; 0,709 for Pb and 0.930 for Zn in polluted soils and they are higher than corresponding values in unpolluted soils.

Direct organogenesis of seaside heliotrope (Heliotropium crassavicum) using stem explants.

PubMed

Satyavani, K; Dheepak, V; Gurudeeban, S; Ramanathan, T

2013-10-15

Heliotropium crassavicum L. is a sand binder salt marsh herb with enormous traditional value and widely found in South Asia America and Europe. In the direct method of regeneration from stem explants, we observed the maximum number of shoot regeneration after four weeks culture of MS elongation medium with 2.0 mg L(-1) of 2, 4-D (17.27 +/- 0.51). It was clear that MS medium with 2.0 mg mL(-1) 2, 4-D alone suitable for shoot multiplication as well as shoot elongation then compared to other combination of auxin and cytokinin. In vitro shoots were excised from shoot clumps and transferred to rooting medium containing 2, 4-dichlorophenoxy acetic acid (0.5-3.0 mg L(-1)). The maximum number of root regeneration (6.4 +/- 0.416) and root length (6.08 +/- 0.07) were observed in MS rooting medium fortified with 2.5 mg L(-1) of 2, 4-D after 2 weeks of culture. 85% of in vitro raised plantlets with well-developed shoots and roots were transferred to ex vivo conditions into polythene bag containing sterile compost with ratio (v/v/v) of organic fertilizer: sand: peat (1:2:2; 3:1:0 or 2:2:1). Sixty five percent of acclimated plants were transferred to the pots under full sun where they grew well without any detectable phenotypic variations.

Ion sensing by charge transfer absorption variations of benzocrown-bipyridinium conjugates with an alkyl chain.

PubMed

Kuwabara, Tetsuo; Satake, Ryota; Guo, Haocheng

2015-01-01

Two benzocrown ether-bipyridinium conjugates, 1 and 2, each having a different length of alkyl chains with butyl and dodecyl groups, respectively, have been synthesized for the purpose of developing a new guest-responsive color-change chemosensor. Both 1 and 2 showed yellow colors with broad absorption bands around 400 nm in acetonitrile. These are associated with the intramolecular charge transfer (CT) absorption, in which the benzocrown ether and bipyridinium units act as the donor and acceptor, respectively. Upon addition of the guest; such as Na(+), they faded in color due to the blue shift in their intramolecular charge transfer absorption bands. These are associated with the formation of 1:1 host-guest inclusion complex. Analogues, 3 and 4, both being similar in structure to 1 and 2 with non-crown ether unit, also showed intramolecular CT absorptions around 400 nm, but did not change their absorption spectra upon addition of the guest because of the lack of guest-binding abilities. The guest-induced color change of 1 and 2 can be used for alkali and alkaline metal ion sensing. Both 1 and 2 could detect divalent cations such as Mg(2+) and Ca(2+) rather than univalent ones, Li(+), Na(+), K(+), Rb(+), and Cs(+). Although a marked difference between 1 and 2 was not observed in their guest sensing abilities, the remarkable recognition of 1 and 2 for Mg(2+) and Ca(2+) was found compared with that of 5, which has benzyl unit instead of alkyl chains of 1 and 2. The sensitivity values of 1 and 2 were roughly proportional to their binding constants, as shown by the binding constants with Li(+), Na(+), Mg(2+), and Ca(2+) with the values of 910, 260, 820, and 2300 M(-1) for 1 and 930, 290, 1270, and 2790 M(-1) for 2, while the binding constants of 5 were estimated to be 930, 440, 210, and 1200 M(-1) for Li(+), Na(+), Mg(2+), and Ca(2+), respectively. The limit concentration of detection of 2 for Ca(2+) was estimated to be 0.016 mM, which was the smallest value in this system.

Mercury in soil and perennial plants in a mining-affected urban area from Northwestern Romania.

PubMed

Senilă, Marin; Levei, Erika A; Senilă, Lăcrimioara R; Oprea, Gabriela M; Roman, Cecilia M

2012-01-01

The mercury (Hg) concentrations were evaluated in soils and perennial plants sampled in four districts of Baia Mare city, a historical mining and ore processing center in Northwestern Romania. The results showed that the Hg concentration exceeded the guideline value of 1.0 mg kg(-1) dry weight (dw) established by the Romanian Legislation, in 24 % of the analyzed soil samples, while the median Hg concentration (0.70 mg kg(-1) dw) was lower than the guideline value. However, Hg content in soil was generally higher than typical values in soils from residential and agricultural areas of the cities all over the world. The median Hg concentration was 0.22 mg kg(-1) dw in the perennial plants, and exceeded the maximum level of Hg (0.10 mg kg(-1)) established by European Directive 2002/32/EC for plants used in animal feed in order to prevent its transfer and further accumulation in the higher levels of food chain. No significant correlations were found between soil Hg and other analyzed metals (Cd, Cu, Pb, Zn) resulted from the non-ferrous smelting activities, probably due to the different physicochemical properties, that led to different dispersion patterns.

Shear conditions in clavulanic acid production by Streptomyces clavuligerus in stirred tank and airlift bioreactors.

PubMed

Cerri, M O; Badino, A C

2012-08-01

In biochemical processes involving filamentous microorganisms, the high shear rate may damage suspended cells leading to viability loss and cell disruption. In this work, the influence of the shear conditions in clavulanic acid (CA) production by Streptomyces clavuligerus was evaluated in a 4-dm(3) conventional stirred tank (STB) and in 6-dm(3) concentric-tube airlift (ALB) bioreactors. Batch cultivations were performed in a STB at 600 and 800 rpm and 0.5 vvm (cultivations B1 and B2) and in ALB at 3.0 and 4.1 vvm (cultivations A1 and A2) to define two initial oxygen transfer conditions in both bioreactors. The average shear rate ([Formula: see text]) of the cultivations was estimated using correlations of recent literature based on experimental data of rheological properties of the broth (consistency index, K, and flow index, n) and operating conditions, impeller speed (N) for STB and superficial gas velocity in the riser (UGR) for ALB. In the same oxygen transfer condition, the [Formula: see text] values for ALB were higher than those obtained in STB. The maximum [Formula: see text] presented a strong correlation with a maximum consistency index (K (max)) of the broth. Close values of maximum CA production were obtained in cultivations A1 and A2 (454 and 442 mg L(-1)) with similar maximum [Formula: see text] values of 4,247 and 4,225 s(-1). In cultivations B1 and B2, the maximum CA production of 269 and 402 mg L(-1) were reached with a maximum [Formula: see text] of 904 and 1,786 s(-1). The results show that high values of average shear rate increase the CA production regardless of the oxygen transfer condition and bioreactor model.

Uptake Kinetics and Trophic Transfer of Tungsten from Cabbage to a Herbivorous Animal Model

DOE PAGES

Lindsay, James H.; Kennedy, Alan J.; Seiter-Moser, Jennifer M.; ...

2017-10-20

This paper builds on previous studies on military-relevant tungsten (W) to more thoroughly explore environmental pathways and bioaccumulation kinetics during direct soil exposure versus trophic transfer and elucidate its relative accumulation and speciation in different snail organs. The modeled steady-state concentration and bioaccumulation factor (BAF) of W from soil into cabbage were 302 mg/kg and 0.55, respectively. Steady-state concentrations (34 mg/kg) and BAF values (0.05) obtained for the snail directly exposed to contaminated soil were lower than trophic transfer by consumption of W-contaminated cabbage (tissue concentration of 86 mg/kg; BAF of 0.36). Thus, consumption of contaminated food is the mostmore » important pathway for W mobility in this food chain. The highest concentrations of W compartmentalization were in the snail’s hepatopancreas based on wet chemistry and synchrotron-based investigations. Chemical speciation via inductively couple plasma mass spectrometry showed a higher degree of polytungstate partitioning in the hepatopancreas relative to the rest of the body. Based on synchrotron analysis, W was incorporated into the shell matrix during exposure, particularly during the regeneration of damaged shell. Finally, this offers the potential for application of the shell as a longer-term biomonitoring and forensics tool for historic exposure.« less

Uptake Kinetics and Trophic Transfer of Tungsten from Cabbage to a Herbivorous Animal Model

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lindsay, James H.; Kennedy, Alan J.; Seiter-Moser, Jennifer M.

This paper builds on previous studies on military-relevant tungsten (W) to more thoroughly explore environmental pathways and bioaccumulation kinetics during direct soil exposure versus trophic transfer and elucidate its relative accumulation and speciation in different snail organs. The modeled steady-state concentration and bioaccumulation factor (BAF) of W from soil into cabbage were 302 mg/kg and 0.55, respectively. Steady-state concentrations (34 mg/kg) and BAF values (0.05) obtained for the snail directly exposed to contaminated soil were lower than trophic transfer by consumption of W-contaminated cabbage (tissue concentration of 86 mg/kg; BAF of 0.36). Thus, consumption of contaminated food is the mostmore » important pathway for W mobility in this food chain. The highest concentrations of W compartmentalization were in the snail’s hepatopancreas based on wet chemistry and synchrotron-based investigations. Chemical speciation via inductively couple plasma mass spectrometry showed a higher degree of polytungstate partitioning in the hepatopancreas relative to the rest of the body. Based on synchrotron analysis, W was incorporated into the shell matrix during exposure, particularly during the regeneration of damaged shell. Finally, this offers the potential for application of the shell as a longer-term biomonitoring and forensics tool for historic exposure.« less

Transfer of Cadmium from Soil to Vegetable in the Pearl River Delta area, South China

PubMed Central

Zhang, Huihua; Chen, Junjian; Zhu, Li; Yang, Guoyi; Li, Dingqiang

2014-01-01

The purpose of this study was to investigate the regional Cadmium (Cd) concentration levels in soils and in leaf vegetables across the Pearl River Delta (PRD) area; and reveal the transfer characteristics of Cadmium (Cd) from soils to leaf vegetable species on a regional scale. 170 paired vegetables and corresponding surface soil samples in the study area were collected for calculating the transfer factors of Cadmium (Cd) from soils to vegetables. This investigation revealed that in the study area Cd concentration in soils was lower (mean value 0.158 mg kg−1) compared with other countries or regions. The Cd-contaminated areas are mainly located in west areas of the Pearl River Delta. Cd concentrations in all vegetables were lower than the national standard of Safe vegetables (0.2 mg kg−1). 88% of vegetable samples met the standard of No-Polluted vegetables (0.05 mg kg−1). The Cd concentration in vegetables was mainly influenced by the interactions of total Cd concentration in soils, soil pH and vegetable species. The fit lines of soil-to-plant transfer factors and total Cd concentration in soils for various vegetable species were best described by the exponential equation (), and these fit lines can be divided into two parts, including the sharply decrease part with a large error range, and the slowly decrease part with a low error range, according to the gradual increasing of total Cd concentrations in soils. PMID:25247431

Transfer of cadmium from soil to vegetable in the Pearl River Delta area, South China.

PubMed

Zhang, Huihua; Chen, Junjian; Zhu, Li; Yang, Guoyi; Li, Dingqiang

2014-01-01

The purpose of this study was to investigate the regional Cadmium (Cd) concentration levels in soils and in leaf vegetables across the Pearl River Delta (PRD) area; and reveal the transfer characteristics of Cadmium (Cd) from soils to leaf vegetable species on a regional scale. 170 paired vegetables and corresponding surface soil samples in the study area were collected for calculating the transfer factors of Cadmium (Cd) from soils to vegetables. This investigation revealed that in the study area Cd concentration in soils was lower (mean value 0.158 mg kg(-1)) compared with other countries or regions. The Cd-contaminated areas are mainly located in west areas of the Pearl River Delta. Cd concentrations in all vegetables were lower than the national standard of Safe vegetables (0.2 mg kg(-1)). 88% of vegetable samples met the standard of No-Polluted vegetables (0.05 mg kg(-1)). The Cd concentration in vegetables was mainly influenced by the interactions of total Cd concentration in soils, soil pH and vegetable species. The fit lines of soil-to-plant transfer factors and total Cd concentration in soils for various vegetable species were best described by the exponential equation (y = ax(b)), and these fit lines can be divided into two parts, including the sharply decrease part with a large error range, and the slowly decrease part with a low error range, according to the gradual increasing of total Cd concentrations in soils.

Transferring Patients From Methadone to Buprenorphine: The Feasibility and Evaluation of Practice Guidelines.

PubMed

Lintzeris, Nicholas; Monds, Lauren A; Rivas, Consuelo; Leung, Stefanie; Dunlop, Adrian; Newcombe, David; Walters, Carina; Galea, Susanna; White, Nancy; Montebello, Mark; Demirkol, Apo; Swanson, Nicola; Ali, Robert

Transfer from methadone to buprenorphine is problematic for many opioid-dependent patients, with limited documented evidence or practical clinical guidance, particularly for the range of methadone doses routinely prescribed for most patients (>50 mg). This study aimed to implement and evaluate recent national Australian guidelines for transferring patients from methadone to buprenorphine. A multisite prospective cohort study. Participants were patients who transferred from methadone to buprenorphine-naloxone at 1 of 4 specialist addiction centers in Australia and New Zealand. Clinicians were trained in the guidelines, and medical records were reviewed to examine process (eg, transfer setting, doses, and guideline adherence) and safety (precipitated withdrawal) measures. Participants completed research interviews before and after transfer-assessing changes in substance use, health outcomes, and side effects. In all, 33 participants underwent transfer, 9 from low methadone doses (<30 mg), 9 from medium doses (30-50 mg), and 15 from high doses (>50 mg). The majority of high-dose transfers occurred in inpatient settings. There was reasonable guideline adherence, and no complications identified in the low and medium-dose transfers. Three high-dose transfers (20%) experienced precipitated withdrawal, and 7/33 participants (21%) returned to methadone within 1 week of attempted transfer. Transfer is feasible in outpatient settings for those transferring from methadone doses below 50 mg; however, inpatient settings and specialist supervision is recommended for higher-dose transfers. The Australian clinical guidelines appear safe and feasible, although further research is required to optimize high-dose transfer procedures.

Characteristics and risks of secondary pollutants generation during compression and transfer of municipal solid waste in Shanghai.

PubMed

Wang, Xiaoyuan; Xie, Bing; Wu, Dong; Hassan, Muhammad; Huang, Changying

2015-09-01

The generation and seasonal variations of secondary pollutants were investigated during three municipal solid waste (MSW) compression and transfer in Shanghai, China. The results showed that the raw wastewater generated from three MSW transfer stations had pH of 4.2-6.0, COD 40,000-70,000mg/L, BOD5 15,000-25,000mg/L, ammonia nitrogen (NH3-N) 400-700mg/L, total nitrogen (TN) 600-1500mg/L, total phosphorus (TP) 50-200mg/L and suspended solids (SS) 1000-80,000mg/L. The pH, COD, BOD5 and NH3-N did not show regular change throughout the year while the concentration of TN, TP and SS were higher in summer and autumn. The animal and vegetable oil content was extremely high. The average produced raw wastewater of three transfer stations ranged from 2.3% to 8.4% of total refuse. The major air pollutants of H2S 0.01-0.17mg/m(3), NH3 0.75-1.8mg/m(3) in transfer stations, however, the regular seasonal change was not discovered. During the transfer process, the generated leachate in container had pH of 5.7-6.4, SS of 9120-32,475mg/L. The COD and BOD5 were 41,633-89,060mg/L and 18,116-34,130mg/L respectively, higher than that in the compress process. The concentration of NH3-N and TP were 587-1422mg/L and 80-216mg/L, respectively, and both increased during transfer process. H2S, VOC, CH4 and NH3 were 0.4-4mg/m(3), 7-19mg/m(3), 0-3.4% and 1-4mg/m(3), respectively. The PCA analysis showed that the production of secondary pollutants is closely related to temperature, especially CH4. Therefore, avoiding high temperature is a key means of reducing the production of gaseous pollutants. And above all else, refuse classification in source, deodorization and anti-acid corrosion are the important processes to control the secondary pollutants during compression and transfer of MSW. Copyright © 2015 Elsevier Ltd. All rights reserved.

In vitro propagation, ex vitro rooting and leaf micromorphology of Bauhinia racemosa Lam.: a leguminous tree with medicinal values.

PubMed

Sharma, Udit; Kataria, Vinod; Shekhawat, N S

2017-10-01

A micropropagation system for Bauhinia racemosa Lam. was developed involving axillary shoot proliferation and ex vitro rooting using nodal explants obtained from mature tree. MS medium with 3.0 mg l -1 BA (6-benzyladenine) was optimum for shoot bud induction. For shoot multiplication, mother explants were transferred repeatedly on medium containing low concentration of BA (0.75 mg l -1 ). Number of shoots was increased up to two passages and decreased thereafter. Shoot multiplication was further enhanced on MS medium containing 0.25 mg l -1 each of BA and Kin (Kinetin) with 0.1 mg l -1 of NAA (α-naphthalene acetic acid). Addition of 0.004 mg l -1 TDZ (thidiazuron) increased the rate of shoot multiplication and 21.81 ± 1.26 shoots per culture vessel were obtained. In vitro regenerated shoots were rooted under ex vitro conditions treated with 400 mg l -1 IBA (indole-3-butyric acid) for 7 min on sterile soilrite. After successful hardening in greenhouse, ex vitro rooted plants were transferred to the field conditions with ≈85% of survival rate. Micromorphological changes were observed on leaf surface i.e. development of vein density and trichomes and stomatal appearance, when plants were subjected to environmental conditions. This is the first report on in vitro regeneration of B. racemosa from mature tree.

Experimental and DFT studies of gold nanoparticles supported on MgO(111) nano-sheets and their catalytic activity.

PubMed

Li, Zhi; Ciobanu, Cristian V; Hu, Juncheng; Palomares-Báez, Juan-Pedro; Rodríguez-López, José-Luis; Richards, Ryan

2011-02-21

A wet chemical preparation of MgO with the (111) facet as the primary surface has recently been reported and with alternating layers of oxygen anions and magnesium cations, this material shows unique chemical and physical properties. The potential to utilize the MgO(111) surface for the immobilization of metal particles is intriguing because the surface itself offers a very different environment for the metal particle with an all oxygen interface, as opposed to the typical (100) facet that possesses alternating oxygen anion and magnesium cation sites on the surface. Gold nanoparticles have demonstrated a broad range of interesting catalytic properties, but are often susceptible to aggregation at high temperatures and are very sensitive to substrate effects. Here, we investigate gold-supported on MgO(111) nanosheets as a catalyst system for the aerobic oxidation of benzyl alcohol. Gold nanoparticles deposited on MgO(111) show an increased level of activity in the solvent-free benzyl alcohol aerobic oxidation as compared to gold nanoparticles deposited on a typical MgO aerogel. TEM studies reveal that the gold nanoparticles have a hemispherical shape while sitting on the main surface of MgO(111) nanosheets, with a large Au-MgO interface. Given that the gold nanoparticles deposited on the two types of MgO have similar size, and that the two types of unmodified MgO show almost the same activities in the blank reaction, we infer that the high activity of Au/MgO(111) is due to the properties of the (111) support and/or those of the gold-support interface. To understand the binding of Au on low-index MgO surfaces and the charge distribution at the surface of the support, we have performed density functional theory (DFT) calculations on all low-index MgO substrates (with and without gold), using a model Au(10) cluster. Due to similar lattice constants of Au(111) and MgO(111) planes, the Au cluster retains its structural integrity and binds strongly on MgO(111) with either oxygen or magnesium termination. Furthermore, we have found that for the (001) and (110) substrates the charges of the ions in the top surface layer have similar values as in bulk MgO, but that on (111) surfaces these charges are significantly different. This difference in surface charge determines the direction of the electronic transfer upon adsorption of gold, such transfer occurring so as to restore the bulk MgO charge values. Using the results from theoretical calculations, we provide an explanation of our observations of increased catalytic activity in the case of the Au/MgO(111) system.

Guidelines for pre-clinical assessment of the acetylcholine receptor-specific passive transfer myasthenia gravis model - recommendations for methods and experimental designs

PubMed Central

Kusner, Linda L.; Losen, Mario; Vincent, Angela; Lindstrom, Jon; Tzartos, Socrates; Lazaridis, Konstantinos; Martinez-Martinez, Pilar

2015-01-01

Antibodies against the muscle acetylcholine receptor (AChR) are the most common cause of myasthenia gravis (MG). Passive transfer of AChR antibodies from MG patients into animals reproduces key features of human disease, including antigenic modulation of the AChR, complement-mediated damage of the neuromuscular junction, and muscle weakness. Similarly, AChR antibodies generated by active immunization in experimental autoimmune MG models can subsequently be passively transferred to other animals and induce weakness. The passive transfer model is useful to test therapeutic strategies aimed at the effector mechanism of the autoantibodies. Here we summarize published and unpublished experience using the AChR passive transfer MG model in mice, rats and rhesus monkeys, and give recommendations for the design of preclinical studies in order to facilitate translation of positive and negative results to improve MG therapies. PMID:25743217

Interoceptive conditioning with the nicotine stimulus: extinction learning as a method for assessing stimulus similarity across doses.

PubMed

Polewan, Robert J; Savala, Stephanie A; Bevins, Rick A

2013-02-01

Interoceptive conditioning involving the nicotine stimulus likely contributes to chronic tobacco use. To better understand the nature of this interoceptive conditioning, we compared generalization during repeated extinction with generalization in a 'transfer of extinction' test using a wide range of test doses. Rats were first trained in the discriminated goal-tracking task in which nicotine (0.2 or 0.4 mg/kg), but not saline, was paired with repeated intermittent access to sucrose. Across sessions, nicotine acquired control of approach behavior directed at the location of previous sucrose deliveries. Extinction followed with eight 20-min sessions without sucrose access; extinction doses of nicotine ranged from 0.05 to 0.6 mg/kg. In rats trained with 0.4 mg/kg, the 0.1, 0.2, and 0.6 mg/kg doses evoked comparable responding across extinction sessions; substitution was only partial at 0.05 and 0.075 mg/kg (i.e. above saline controls, but less than the training dose). With the 0.2 mg/kg training dose, complete generalization was seen only at the 0.1 and 0.4 mg/kg doses. After extinction, rats were given a transfer test with their training dose. Rats trained with 0.4 mg/kg showed full transfer of extinction learning with 0.1, 0.2, and 0.6 mg/kg (i.e. responding comparable with extinction with the training dose). Partial transfer was observed at 0.075 mg/kg. With the 0.2 mg/kg nicotine dose, only 0.4 mg/kg fully generalized; 0.075, 0.1, and 0.6 mg/kg showed partial transfer. Extinction with 0.05 mg/kg dose did not show transfer to either training dose. These findings indicated that conclusions regarding stimulus similarity across nicotine doses can vary with testing protocol.

Enhancement of the Rate of Pyrophosphate Hydrolysis by Nonenzymatic Catalysts and by Inorganic Pyrophosphatase*

PubMed Central

Stockbridge, Randy B.; Wolfenden, Richard

2011-01-01

To estimate the proficiency of inorganic pyrophosphatase as a catalyst, 31P NMR was used to determine rate constants and thermodynamics of activation for the spontaneous hydrolysis of inorganic pyrophosphate (PPi) in the presence and absence of Mg2+ at elevated temperatures. These values were compared with rate constants and activation parameters determined for the reaction catalyzed by Escherichia coli inorganic pyrophosphatase using isothermal titration calorimetry. At 25 °C and pH 8.5, the hydrolysis of MgPPi2− proceeds with a rate constant of 2.8 × 10−10 s−1, whereas E. coli pyrophosphatase was found to have a turnover number of 570 s−1 under the same conditions. The resulting rate enhancement (2 × 1012-fold) is achieved entirely by reducing the enthalpy of activation (ΔΔH‡ = −16.6 kcal/mol). The presence of Mg2+ ions or the transfer of the substrate from bulk water to dimethyl sulfoxide was found to increase the rate of pyrophosphate hydrolysis by as much as ∼106-fold. Transfer to dimethyl sulfoxide accelerated PPi hydrolysis by reducing the enthalpy of activation. Mg2+ increased the rate of PPi hydrolysis by both increasing the entropy of activation and reducing the enthalpy of activation. PMID:21460215

Kinetics of nitrogenase of Klebsiella pneumoniae. Heterotropic interactions between magnesium-adenosine 5'-diphosphate and magnesium-adenosine 5'-triphosphate.

PubMed Central

Thorneley, R N; Cornish-Bowden, A

1977-01-01

The effects of MgADP and MgATP on the kinetics of a pre-steady-state electron-transfer reaction and on the steady-state kinetics of H2 evulution for nitrogenase proteins of K. pneumoniae were studied. MgADP was a competitive inhibitor of MgATP in the MgATP-induced electron transfer from the Fe-protein to the Mo-Fe-protein. A dissociation constant K'i = 20 micron was determined for MgADP. The release of MgADP or a coupled conformation change in the Fe-protein of K.pneumoniae occurred with a rate comparable with that of electron transfer, k approximately 2 X 10(2)S-1. Neither homotropic nor heterotropic interactions involving MgATP and MgADP were observed for this reaction. Steady-state kinetic data for H2 evolution exhibited heterotropic effects between MgADP and MgATP. The data have been fitted to symmetry and sequential-type models involving conformation changes in two identical subunits. The data suggest that the enzyme can bind up to molecules of either MgATP or MgADP, but is unable to bind both nucleotides simultaneously. The control of H2 evolution by the MgATP/MgADP ratio is not at the level of electron transfer between the Fe- and Mo-Fe-proteins. Images Fig. 2. PMID:336036

Hierarchical meso/macro-porous carbon fabricated from dual MgO templates for direct electron transfer enzymatic electrodes.

PubMed

Funabashi, Hiroto; Takeuchi, Satoshi; Tsujimura, Seiya

2017-03-23

We designed a three-dimensional (3D) hierarchical pore structure to improve the current production efficiency and stability of direct electron transfer-type biocathodes. The 3D hierarchical electrode structure was fabricated using a MgO-templated porous carbon framework produced from two MgO templates with sizes of 40 and 150 nm. The results revealed that the optimal pore composition for a bilirubin oxidase-catalysed oxygen reduction cathode was a mixture of 33% macropores and 67% mesopores (MgOC 33 ). The macropores improve mass transfer inside the carbon material, and the mesopores improve the electron transfer efficiency of the enzyme by surrounding the enzyme with carbon.

Hierarchical meso/macro-porous carbon fabricated from dual MgO templates for direct electron transfer enzymatic electrodes

NASA Astrophysics Data System (ADS)

Funabashi, Hiroto; Takeuchi, Satoshi; Tsujimura, Seiya

2017-03-01

We designed a three-dimensional (3D) hierarchical pore structure to improve the current production efficiency and stability of direct electron transfer-type biocathodes. The 3D hierarchical electrode structure was fabricated using a MgO-templated porous carbon framework produced from two MgO templates with sizes of 40 and 150 nm. The results revealed that the optimal pore composition for a bilirubin oxidase-catalysed oxygen reduction cathode was a mixture of 33% macropores and 67% mesopores (MgOC33). The macropores improve mass transfer inside the carbon material, and the mesopores improve the electron transfer efficiency of the enzyme by surrounding the enzyme with carbon.

In Vitro and Cryopreservation Techniques for Conservation of Snow Mountain Garlic.

PubMed

Mahajan, Ritu

2016-01-01

Garlic is an important medicinal herb of culinary value by imparting its flavors and odors to the food. Allicin, a notable flavonoid in garlic, is a powerful antibiotic and antifungal compound. Due to poor bioavailability, garlic is of limited use for oral human consumption. Being sexually sterile, propagation of garlic is done by individual cloves from a bulb which increases the chances of transfer of viral diseases. In this chapter, an efficient and improved regeneration protocol for explant establishment and shoot multiplication under in vitro conditions is described. A high rate of shoot multiplication is obtained on MS medium supplemented with 0.5 mg/l BAP, 1.0 mg/l KN, and 2.0 mg/l GA3. Addition of 1.0 mg/l NAA to MS medium resulted in rooting at the shoot bases. A detailed method for encapsulation of explant in sodium alginate beads and their cryopreservation using encapsulation-dehydration is also described.

n3- polyunsaturated Fat Acid Content of Some Edible Fish from Bahrain Waters

NASA Astrophysics Data System (ADS)

Al-Arrayedu, F. H.; Al Maskati, H. A.; Abdullah, F. J.

1999-08-01

This study was performed to determine the content of n3- polyunsaturated fatty acids in 10 fish species that are commonly consumed in Bahrain in addition to the main commercial shrimp species. White sardinella, which is a plankton feeder, had the highest content of n3- polyunsaturated fatty acids. It had the highest value of eicosapentaenoic acid (146.5 ± 20 mg 100 g-1) and linolenic acid (98.9±f 100 g-1) and the second highest value of docosahexaenoic acid at (133.7 ± 22 mg 100 g-1). Spanish mackerel which feeds mainly on sardinella was second with eicosapentaenoc acid at 55 ± 5.4 mg 100 g-1, docosahexaenoic acid at 161 ± 19.8 mg 100 g-1, linolenic acid at 16.4 mg 100 g-1 and docosapentaenoic acid at 25 ± 1.9 mg 100 g-1. Rabbitfish, the most popular edible fish in Bahrain which feeds mainly on benthic algae had the third highest content of n3- polyunsaturated fatty acids with eicosapentaenoic acid at 37.5 ± 3.9 mg 100 g-1, docosahexaenoic acid at 76 ± 6.7 mg 100 g-1, and docosapentaenoic acid at 85.8 ± 10 mg 100 g-1. The other fish and crustacean species studied were Arabian carpet shark, doublebar bream, grouper, gray grunt, golden travally, keeled mullet, spangled emperor and shrimp. The study explores the transfer of n3- polyunsaturated fatty acids through the food webs of the examined fish. It is apparent, generally, that plankton feeders displayed the highest content of n3- polyunsaturated fatty acids followed by seaweed and algae grazers, with benthic carnivores feeding on invertebrates displaying the poorest content. The values reported here, however, are much lower than those reported for fish available in American markets and in Mediterranean fish. Warm water temperature and high salinity which lead to lowering of the density of phytoplankton and phytoplankton content of n3- polyunsaturated fatty acids are suggested as the reason for the observed low values of n3- polyunsaturated fatty acids in Bahrain fish.

Guidelines for pre-clinical assessment of the acetylcholine receptor--specific passive transfer myasthenia gravis model-Recommendations for methods and experimental designs.

PubMed

Kusner, Linda L; Losen, Mario; Vincent, Angela; Lindstrom, Jon; Tzartos, Socrates; Lazaridis, Konstantinos; Martinez-Martinez, Pilar

2015-08-01

Antibodies against the muscle acetylcholine receptor (AChR) are the most common cause of myasthenia gravis (MG). Passive transfer of AChR antibodies from MG patients into animals reproduces key features of human disease, including antigenic modulation of the AChR, complement-mediated damage of the neuromuscular junction, and muscle weakness. Similarly, AChR antibodies generated by active immunization in experimental autoimmune MG models can subsequently be passively transferred to other animals and induce weakness. The passive transfer model is useful to test therapeutic strategies aimed at the effector mechanism of the autoantibodies. Here we summarize published and unpublished experience using the AChR passive transfer MG model in mice, rats and rhesus monkeys, and give recommendations for the design of preclinical studies in order to facilitate translation of positive and negative results to improve MG therapies. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Oscillation characteristics of zero-field spin transfer oscillators with field-like torque

DOE Office of Scientific and Technical Information (OSTI.GOV)

Guo, Yuan-Yuan; Xue, Hai-Bin, E-mail: xuehaibin@tyut.edu.cn; Department of Physics and Optoelectronics, Taiyuan University of Technology, Taiyuan 030024

2015-05-15

We theoretically investigate the influence of the field-like spin torque term on the oscillation characteristics of spin transfer oscillators, which are based on MgO magnetic tunnel junctions (MTJs) consisting of a perpendicular magnetized free layer and an in-plane magnetized pinned layer. It is demonstrated that the field-like torque has a strong impact on the steady-state precession current region and the oscillation frequency. In particular, the steady-state precession can occur at zero applied magnetic field when the ratio between the field-like torque and the spin transfer torque takes up a negative value. In addition, the dependence of the oscillation properties onmore » the junction sizes has also been analyzed. The results indicate that this compact structure of spin transfer oscillator without the applied magnetic field is practicable under certain conditions, and it may be a promising configuration for the new generation of on-chip oscillators.« less

Tunable color and energy transfer in single-phase white-emitting Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68}:Ce{sup 3+},Dy{sup 3+} phosphors for UV white light-emitting diodes

DOE Office of Scientific and Technical Information (OSTI.GOV)

Yuan, Bo; Song, Yanhua; Sheng, Ye

Ce{sup 3+} and/or Dy{sup 3+} activated Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68} phosphors were synthesized by high temperature solid state reaction and their luminescent properties were studied. There are two emissions peaking at 407 and 577 nm in the emission spectra of Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68}:Ce{sup 3+}, Dy{sup 3+}, which are due to the transitions of Ce{sup 3+} and Dy{sup 3+} ions, respectively. More importantly, the effective energy transfer from Ce{sup 3+} to Dy{sup 3+} ions has been confirmed and investigated by emission/excitation spectra and luminescent decay behaviors. Furthermore, the energy level scheme and mechanism of energy transfermore » were investigated and it was demonstrated to be resonant type via dipole–dipole reaction. Under the excitation of 345 nm, the emitting color can change from blue to white by adjusting the relative doping concentration of Ce{sup 3+} and Dy{sup 3+} ions, indicating that the phosphors Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68}:Ce{sup 3+}, Dy{sup 3+} are promising single-phase white-emitting phosphors for application in pc-white LEDs. - Highlights: • The Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68}:Ce{sup 3+},Dy{sup 3+} are novel luminescent materials that have not been reported before. • The crystal structure of Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68} and energy transfer from Ce{sup 3+} to Dy{sup 3+} were investigated. • The emission color of Ca{sub 20}Al{sub 26}Mg{sub 3}Si{sub 3}O{sub 68}:Ce{sup 3+},Dy{sup 3+} can be adjusted from blue to white. • The phosphors have great application value in WLEDs as a kind of blue-to-white emitting phosphors.« less

Total arsenic in raw and boiled portions of Norway lobster (Nephrops norvegicus) from the central Adriatic Sea.

PubMed

Visciano, Pierina; Perugini, Monia; Manera, Maurizio; Abete, Maria Cesarina; Tarasco, Renata; Salese, Carmine; Amorena, Michele

2013-12-18

The distribution of total arsenic in different portions of Norway lobster (Nephrops norvegicus L., Crustacea) was studied both in fresh samples and after a boiling process. All individuals (n = 80) were selected of medium standard commercial size (13-15 cm). The highest mean concentrations (26.86 ± 1.57 mg/kg wet weight (ww)) were found in the raw brown meat of the crustacean, probably due to its detoxification role, whereas the lowest mean values (15.97 ± 0.85 mg/kg ww) were in the raw exoskeleton. The raw white meat reported mean values of 16.09 ± 0.61 mg/kg ww. The levels of arsenic contamination detected in the boiled portions showed a significant (p < 0.01) decrease compared to the raw portions, as a consequence of solubilization phenomena. In fact, a large amount of arsenic from raw lobsters was transferred to the corresponding boiling broth. In the most commonly consumed portion, the white meat, only slight losses (7.22%) in total arsenic content were observed compared to the raw portion.

Single event effects and laser simulation studies

NASA Technical Reports Server (NTRS)

Kim, Q.; Schwartz, H.; Mccarty, K.; Coss, J.; Barnes, C.

1993-01-01

The single event upset (SEU) linear energy transfer threshold (LETTH) of radiation hardened 64K Static Random Access Memories (SRAM's) was measured with a picosecond pulsed dye laser system. These results were compared with standard heavy ion accelerator (Brookhaven National Laboratory (BNL)) measurements of the same SRAM's. With heavy ions, the LETTH of the Honeywell HC6364 was 27 MeV-sq cm/mg at 125 C compared with a value of 24 MeV-sq cm/mg obtained with the laser. In the case of the second type of 64K SRAM, the IBM640lCRH no upsets were observed at 125 C with the highest LET ions used at BNL. In contrast, the pulsed dye laser tests indicated a value of 90 MeV-sq cm/mg at room temperature for the SEU-hardened IBM SRAM. No latchups or multiple SEU's were observed on any of the SRAM's even under worst case conditions. The results of this study suggest that the laser can be used as an inexpensive laboratory SEU prescreen tool in certain cases.

Distribution and accumulation of selenium in wild plants growing naturally in the Gumuskoy (Kutahya) mining area, Turkey.

PubMed

Sasmaz, Merve; Akgül, Bunyamin; Sasmaz, Ahmet

2015-05-01

This study investigated selenium uptake and transport from the soil to 12 plant species in the mining area of Gumuskoy (Kutahya), Turkey. Plant samples and their associated soils were collected and analyzed for Se content by ICP-MS. Mean Se values in the soils, roots, and shoots of all plants were 0.9, 0.6, and 0.8 mg kg(-1), respectively. The mean enrichment coefficients for roots (ECR) and shoots (ECS) of these plants were 0.78 and 0.97. The mean translocation factors (TLF) were 1.33. These values indicate that all 12 plant species had the ability to transfer Se from the roots to the shoot, but that transfer was more efficient in plants with higher ECR and ECS. Therefore, these plants may be useful in phytoremediation in rehabilitating areas contaminated by Se because their ECR, ECS and TLFs are >1.

In silico ordinary differential equation/partial differential equation hemodialysis model estimates methadone removal during dialysis.

PubMed

Linares, Oscar A; Schiesser, William E; Fudin, Jeffrey; Pham, Thien C; Bettinger, Jeffrey J; Mathew, Roy O; Daly, Annemarie L

2015-01-01

There is a need to have a model to study methadone's losses during hemodialysis to provide informed methadone dose recommendations for the practitioner. To build a one-dimensional (1-D), hollow-fiber geometry, ordinary differential equation (ODE) and partial differential equation (PDE) countercurrent hemodialyzer model (ODE/PDE model). We conducted a cross-sectional study in silico that evaluated eleven hemodialysis patients. Patients received a ceiling dose of methadone hydrochloride 30 mg/day. Outcome measures included: the total amount of methadone removed during dialysis; methadone's overall intradialytic mass transfer rate coefficient, km ; and, methadone's removal rate, j ME. Each metric was measured at dialysate flow rates of 250 mL/min and 800 mL/min. The ODE/PDE model revealed a significant increase in the change of methadone's mass transfer with increased dialysate flow rate, %Δkm =18.56, P=0.02, N=11. The total amount of methadone mass transferred across the dialyzer membrane with high dialysate flow rate significantly increased (0.042±0.016 versus 0.052±0.019 mg/kg, P=0.02, N=11). This was accompanied by a small significant increase in methadone's mass transfer rate (0.113±0.002 versus 0.014±0.002 mg/kg/h, P=0.02, N=11). The ODE/PDE model accurately predicted methadone's removal during dialysis. The absolute value of the prediction errors for methadone's extraction and throughput were less than 2%. ODE/PDE modeling of methadone's hemodialysis is a new approach to study methadone's removal, in particular, and opioid removal, in general, in patients with end-stage renal disease on hemodialysis. ODE/PDE modeling accurately quantified the fundamental phenomena of methadone's mass transfer during hemodialysis. This methodology may lead to development of optimally designed intradialytic opioid treatment protocols, and allow dynamic monitoring of outflow plasma opioid concentrations for model predictive control during dialysis in humans.

Multiexcitation Fluorogenic Labeling of Surface, Intracellular, and Total Protein Pools in Living Cells

PubMed Central

2016-01-01

Malachite green (MG) is a fluorogenic dye that shows fluorescence enhancement upon binding to its engineered cognate protein, a fluorogen activating protein (FAP). Energy transfer donors such as cyanine and rhodamine dyes have been conjugated with MG to modify the spectral properties of the fluorescent complexes, where the donor dyes transfer energy through Förster resonance energy transfer to the MG complex resulting in binding-conditional fluorescence emission in the far-red region. In this article, we use a violet-excitable dye as a donor to sensitize the far-red emission of the MG-FAP complex. Two blue emitting fluorescent coumarin dyes were coupled to MG and evaluated for energy transfer to the MG-FAP complex via its secondary excitation band. 6,8-Difluoro-7-hydroxycoumarin-3-carboxylic acid (Pacific blue, PB) showed the most efficient energy transfer and maximum brightness in the far-red region upon violet (405 nm) excitation. These blue-red (BluR) tandem dyes are spectrally varied from other tandem dyes and are able to produce fluorescence images of the MG-FAP complex with a large Stokes shift (>250 nm). These dyes are cell-permeable and are used to label intracellular proteins. Used together with a cell-impermeable hexa-Cy3-MG (HCM) dye that labels extracellular proteins, we are able to visualize extracellular, intracellular, and total pools of cellular protein using one fluorogenic tag that combines with distinct dyes to effect different spectral characteristics. PMID:27159569

The effects of serpentinization on Mg isotopes in Mid-Atlantic ridge peridotite

NASA Astrophysics Data System (ADS)

Wimpenny, J.; Harvey, J.; Yin, Q.

2012-12-01

The magnesium isotope composition of the Earth's mantle [1], and bulk estimates for upper crustal rocks [2] overlap with values obtained from chondritic meteorites [1], suggesting broad scale homogeneity of δ26Mg on Earth. By way of contrast, weathering of continental crust results in significant fractionation of Mg isotopes [3]. Negative δ26Mg in riverine and groundwater fluxes suggest that the lighter isotopes of Mg are preferentially removed in fluid during partial weathering, leaving a heavy δ26Mg residuum [4]. Thus, riverine fluxes to the ocean result in a marine reservoir with a δ26Mg = -0.82 ± 0.01 [5], significantly lighter than that of fresh mantle material and its derivatives [1]. Abyssal peridotites recovered from Ocean Drilling Program Leg 209 display a wide range of bulk-rock compositions and have been demonstrated to have interacted with a number of low and high temperature fluids [6]. Peridotite from Hole 1274a has been variably serpentinized at low (c. 200 oC) temperatures. Serpentinized samples from Hole 1268a, have also interacted with a higher temperature fluid (c. 350 oC) with a low Mg/Si ratio resulting in abundant talc formation [6]. Serpentinites contain high concentrations of Mg and are abundantly exposed at the seafloor at slow and ultra-slow oceanic ridges [7,8]. Because peridotites are thought to be a source of Mg to seawater [9] any fractionation of Mg isotopes that accompanies serpentinization will have implications for the composition of Mg in seawater. The δ26Mg of samples from 1274a are similar to primary upper crustal rocks, (UCC δ26Mg = -0.22 ± 0.04 [2]). However, samples from 1268a have fractionated δ26Mg values that are generally enriched in isotopically heavy Mg relative to the UCC, ranging from -0.25 to -0.02‰. These results suggest that serpentinization itself does not cause fractionation of Mg, but that later formation of talc is associated with the preferential retention of isotopically heavy Mg, consistent with secondary silicates formed during continental weathering [e.g. 3]. Mass balance requires that the talc-altered serpentinite must be complimented by an isotopically light component. It seems most likely that this isotopically light Mg will be transferred and mixed into ambient temperature seawater. The impact of this transfer will be dependent on the size of the Mg exchange between peridotite and seawater and the fractionation factor associated with talc alteration. Our data suggest that this would input Mg into seawater that is isotopically light relative to the altered peridotite. [1] Pogge von Strandmann et al., (2011) GCA 75, 5247-5268. [2] Li et al. (2010) GCA 74, 6867-6884. [3] Tipper et al., (2006) EPSL 247, 267-279. [4] Wimpenny et al., (2010) GCA 74, 5259-5279. [5] Foster et al., (2010) Geochem. Geophys. Geosys. 11, doi:10.1029/2010GC003201. [6] Bach et al., (2004) Geochem. Geophys. Geosys. 5, doi:10.1029/2004GC000744. [7] Cannat et al., (1997) Tectonophys. 279, 193-213. [8] Jokat et al., (2003) Nature 423, 962-965. [9] Snow & Dick (1995) GCA, 59, 4219-4235.

Rapid in vitro propagation, conservation and analysis of genetic stability of Viola pilosa.

PubMed

Soni, Madhvi; Kaur, Rajinder

2014-01-01

A protocol for in vitro propagation was developed for Viola pilosa, a plant of immense medicinal value. To start with in vitro propagation, the sterilized explants (buds) were cultured on MS basal medium supplemented with various concentrations of growth regulators. One of the medium compositions MS basal + 0.5 mg/l BA + 0.5 mg/l TDZ + 0.5 mg/l GA3 gave best results for in vitro shoot bud establishment. Although the problem of shoot vitrification occurred on this medium but this was overcome by transferring the vitrified shoots on MS medium supplemented with 1 mg/l BA and 0.25 mg/l Kn. The same medium was found to be the best medium for further in vitro shoot multiplication. 100 % root induction from in vitro grown shoots was obtained on half strength MS medium supplemented with 1 mg/l IBA. In vitro formed plantlets were hardened and transferred to soil with 83 % survival. Additionally, conservation of in vitro multiplying shoots was also attempted using two different approaches namely slowing down the growth at low temperature and cryopreservation following vitrification. At low temperature retrieval rate was better at 10 °C than at 4 °C after conservation of in vitro multiplying shoots. In cryopreservation-vitrification studies, the vitrified shoot buds gave maximum retrieval of 41.66 % when they were precooled at 4 °C, while only 16.66 % vitrified shoots were retrieved from those precooled at 10 °C. Genetic stability of the in vitro grown plants was analysed by RAPD and ISSR markers which indicated no somaclonal variation among in vitro grown plants demonstrating the feasibility of using the protocol without any adverse genetical effects.

I. Measuring and Reducing Stress and Surface Roughness in IBAD MgO Films and II. Developing Tools to Measure Transfer in Undergraduate Chemistry Students

NASA Astrophysics Data System (ADS)

Antonakos, Cory Dale

I. MgO may be grown with a biaxial texture onto an amorphous substrate with the use of ion beam assisted deposition (IBAD). This MgO film may then be used as a platform on which to grow epitaxial films on an amorphous membrane for characterization purposes. However, the IBAD MgO film is stressed, causing buckles in the amorphous membrane and problems with further film growth on the IBAD MgO. This dissertation work explores the source of this film stress and develops methods to relax the stress and reduce surface roughness with annealing and increased growth temperature. It is determined that annealing and increased growth temperature coupled with a higher ion-to-atom ratio (IAR) during film growth reduce stress and surface roughness sufficiently to use even thinner IBAD MgO films as an intermediate layer between an amorphous membrane and epitaxial film. II. Much of the existing literature on knowledge transfer concludes that transfer is rare and does not occur spontaneously. However, studies supporting that transfer is rare often use methods that focus on binary success or failure to solve a problem correctly and do not analyze thought process. This dissertation work aims at developing transfer questions that allow open-ended responses, developing a method of analysis for these responses that looks for transfer in the problem-solving process, and assessing the methodology itself and its sensitivity, validity, and utility as a general transfer measurement technique for use across a broad range of expertise levels in chemistry. Detailed analysis of responses to each transfer question show that some transfer questions are more effective at distinguishing between expertise levels while also allowing responders of all levels to show knowledge transfer. Simpler questions that are more accessible to students of introductory chemistry proved the most useful at eliciting a range of responses that correlate with expertise level while still showing some degree of transfer in all levels of responders. More challenging questions with complex systems and common misconceptions are too advanced for lower level undergraduates to show knowledge transfer, but may be useful to show transfer in advanced undergraduates and experts.

Transfer parameters for ICRP's Reference Animals and Plants in a terrestrial Mediterranean ecosystem.

PubMed

Guillén, J; Beresford, N A; Baeza, A; Izquierdo, M; Wood, M D; Salas, A; Muñoz-Serrano, A; Corrales-Vázquez, J M; Muñoz-Muñoz, J G

2018-06-01

A system for the radiological protection of the environment (or wildlife) based on Reference Animals and Plants (RAPs) has been suggested by the International Commission on Radiological Protection (ICRP). To assess whole-body activity concentrations for RAPs and the resultant internal dose rates, transfer parameters are required. However, transfer values specifically for the taxonomic families defined for the RAPs are often sparse and furthermore can be extremely site dependent. There is also a considerable geographical bias within available transfer data, with few data for Mediterranean ecosystems. In the present work, stable element concentrations (I, Li, Be, B, Na, Mg, Al, P, S, K. Ca, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, As, Se, Rb, Sr, Mo, Ag, Cd, Cs, Ba, Tl, Pb and U) in terrestrial RAPs, and the corresponding whole-body concentration ratios, CR wo , were determined in two different Mediterranean ecosystems: a Pinewood and a Dehesa (grassland with disperse tree cover). The RAPs considered in the Pinewood ecosystem were Pine Tree and Wild Grass; whereas in the Dehesa ecosystem those considered were Deer, Rat, Earthworm, Bee, Frog, Duck and Wild Grass. The CR wo values estimated from these data are compared to those reported in international compilations and databases. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

[Construction of the new Escherichia coli K-12 wild-type strain with improved growth characteristics for application in metabolic engineering].

PubMed

Biriukova, I V; Krylov, A A; Kiseleva, E M; Minaeva, N I; Mashko, S V

2010-03-01

MG1655 of Escherichia coli K-12 is frequently used in metabolic engineering as the wild-type strain. However, its two mutations, ilvG and rph-1 provide a negative effect on culture growth. The "polar effect" of rph-1 decreases the level of pyrE expression, causing partial auxotrophy for pyrimidines. Mutation ilvG leading to the appearance of Val(S) phenotype causes retardation of cell growth rate on media containing amino acids. In this work, the substitution of two loci in the genome of MG1655 with the recovery of the wild-type phenotype was accomplished. Gene rph(wt) from the chromosome of E. coli TG1 was marked via Red-dependent integration of DNA fragment carrying lambda attL-Cm(R)-lambda attR and transduced with phage P1 into MG1655; later, the Cm(R) marker was removed with the use of lambda Xis/Int recombinase. Parallel to this procedure, a spontaneous Val(R) mutant of E. coli MG1655 yielding colonies of maximal size on M9 medium with glucose in the presence of Val (50 microg/ml) was isolated. It was shown that a nucleotide deletion in the isolated Val(R) strain had been generated in the region of the identified E. coli K-12 ilvG mutation, which led to the recovery of the reading frame and active protein synthesis. This mutation named ilvG-15, which is the only reason for the Val(R) phenotype in the obtained strain, was transferred to MG1655-rph(wt) using cotransduction, by analogy to the transfer of rph(wt). Evaluation of rates of aerobically growing cells (microm, hour(-1)) on M9 medium with glucose produced the following values: 0.56, 0.69, and 0.73 for strains MG1655, MG1655-rph(wt), and MG1655-(rph(wt), ilvG-15), respectively.

Charge transfer transitions in optical spectra of NicMg1-cO oxides

NASA Astrophysics Data System (ADS)

Churmanov, V. N.; Sokolov, V. I.; Pustovarov, V. A.; Gruzdev, N. B.; Uimin, M. A.; Byzov, I. V.; Druzhinin, A. V.; Korolyov, A. V.; Kim, G. A.; Zatsepin, A. F.; Kuznetsova, J. A.

2017-04-01

Radiative recombination with charge transfer was observed in NicMg1-cO (c = 0.008) oxides over the 8-300 K temperature range. This recombination occurs as a result of strong hybridization of the Ni2+ ion 3d-states and the band states. The charge transfer radiation excitation spectrum shows vibrational LO repeats of two exciton lines having charge transfer energy intervals of about 35 meV. The NiO nanocrystal absorption spectrum shows two weak peaks with energies of 3.510 and 3.543 eV, which are highly dependent on temperature. They are interpreted as charge transfer excitons at the edge of NiO fundamental absorption. The distance between the charge transfer exciton lines in the NicMg1-cO oxide spectra are caused by spin-orbit splitting of the valence band peak that was formed by the p-states of the oxygen ion.

Enhanced anaerobic degradation of Fischer-Tropsch wastewater by integrated UASB system with Fe-C micro-electrolysis assisted.

PubMed

Wang, Dexin; Ma, Wencheng; Han, Hongjun; Li, Kun; Xu, Hao; Fang, Fang; Hou, Baolin; Jia, Shengyong

2016-12-01

Coupling of the Fe-C micro-electrolysis (IC-ME) into the up-flow anaerobic sludge blanket (UASB) was developed for enhanced Fischer-Tropsch wastewater treatment. The COD removal efficiency and methane production in R 3 with IC-ME assisted both reached up to 80.6 ± 1.7% and 1.38 ± 0.11 L/L·d that higher than those values in R 1 with GAC addition (63.0 ± 3.4% and 0.95 ± 0.09 L/L·d) and R 2 with ZVI addition (74.5 ± 2.8% and 1.21 ± 0.09 L/L·d) under the optimum HRT (5 d). The Fe corrosion as electron donor reduced the ORP values and stimulated the activities of hydrogenotrophic methanogens to lower H 2 partial pressure in R 2 and R 3 . Additionally, Fe 2+ as by-product of iron corrosion, its presence could effectively increase the percentage of protein content in tightly bound extracellular polymeric substances (TB-EPS) to promote better bioflocculation, increasing to 90.5 mg protein/g·VSS (R 2 ) and 106.3 mg protein/g·VSS (R 3 ) while this value in R1 was simply 56.6 mg protein/g·VSS. More importantly, compared with R 1 , the excess accumulation of propionic acid and butyric acid in system was avoided. The macroscopic galvanic cells around Fe-C micro-electrolysis carriers in R 3 , that larger than microscopic galvanic cells in R 2 , further accelerate to transfer the electrons from anodic Fe to cathodic carbon that enhance interspecies hydrogen transfer, making the decomposition of propionic acid and butyric acid more thermodynamically feasible, finally facilitate more methane production. Copyright © 2016 Elsevier Ltd. All rights reserved.

Transfer factors of natural radionuclides and (137)Cs from soil to plants used in traditional medicine in central Serbia.

PubMed

Djelic, Gorica; Krstic, Dragana; Stajic, Jelena M; Milenkovic, Biljana; Topuzovic, Marina; Nikezic, Dragoslav; Vucic, Dusica; Zeremski, Tijana; Stankovic, Milan; Kostic, Dragana

2016-07-01

Transfer factors of natural radionuclides and (137)Cs from soil to plants used in traditional medicine were determined. The transfer factors (TF) were calculated as Bq kg(-1) of dry plant per Bq kg(-1) of dry soil. Mass activity concentrations of (226)Ra, (232)Th, (40)K and (137)Cs in soil and plant samples were measured with high purity germanium detector (HPGe). The concentrations of As, Co, Cr, Cu, Mn, Ni, Pb and Zn were determined, as well as the cation exchange capacity (CEC) and the content of exchangeable cations (Ca, Mg, K, Na). Wide ranges of values were obtained for all the metals, especially for Cr and Ni. The Absalom model was used for determination of the amount of (137)Cs transferred from soil to plant based on soil characteristics such as pH, exchangeable potassium, humus and clay contents. The estimated transfer factors were in the range from 0.011 to 0.307 with an arithmetic mean of 0.071, median of 0.050, geometric mean of 0.053 and geometric standard deviation (GSD) of 2.08. This value agreed well with that calculated from the measurements of 0.069, geometric mean 0.040 and GSD 3.19. Correlations between radionuclides, metals, physicochemical properties and transfer factors were determined by Spearman correlation coefficient. There was a strong positive correlation between (137)Cs transfer factor and the ratio of transfer factor for K and (137)Cs. Principal Component Analysis (PCA) was performed in order to identify some pattern of data. Copyright © 2016. Published by Elsevier Ltd.

Solubility assessment of 232Th from various types of soil in Malaysia using USP and DIN In Vitro digestion method

NASA Astrophysics Data System (ADS)

Rashid, Nur Shahidah Abdul; Perama, Yasmin Mohd Idris; Salih, Fitri Hakeem Mohd; Sarmani, Sukiman; Majid, Amran Ab.; Siong, Khoo Kok

2016-11-01

The overall results of the study showed that the concentrations of 232Th radionuclide using DIN digestion method during gastric phase are 0.0015 mg/kg - 0.0554 mg/kg and 0.0015 mg/kg - 0.0139 mg/kg during intestinal phase, respectively. As for USP digestion method during gastric phase are between 0.0877 mg/kg - 0.4964 mg/kg and 0.0207 mg/kg - 0.2291 mg/kg. The results from the measurements in various types of soils indicates some elevation of 232Th concentration in some types of soil compared to UNSCEAR reference values, in which may be a result from the impact of previous mining activity in the surrounding area and considered to be safe. In general, the results of 232Th concentrations from in vitro extraction technique is considered to be safe. By natural processes, thorium ingestion is getting transferred to living beings through different pathways and need to be monitored in order to assess possible hazards. Environmental studies are generally carried out to trace the pathway of radionuclides/radiotoxic elements to reach living organism. Environmental monitoring and meaningful interpretation of data from man-made pollution are more complicated without adequate knowledge about the natural abundance of radioactive elements in the environment.

Theoretical aspects of photonic band gap in 1D nano structure of LN: MgLN periodic layer

DOE Office of Scientific and Technical Information (OSTI.GOV)

Sisodia, Namita, E-mail: namitasisodiya@gmail.com

2015-06-24

By using the transfer matrix method, we have analyzed the photonic band gap properties in a periodic layer of LN:MgLN medium. The Width of alternate layers of LN and MgLN is in the range of hundred nanometers. The birefringent and ferroelectric properties of the medium (i.e ordinary, extraordinary refractive indices and electric dipole moment) is given due considerations in the formulation of photonic band gap. Effect of electronic transition dipole moment of the medium on photonic band gap is also taken into account. We find that photonic band gap can be modified by the variation in the ratio of themore » width of two medium. We explain our findings by obtaining numerical values and the effect on the photonic band gap due to variation in the ratio of alternate medium is shown graphically.« less

Phytoremediation of strontium contaminated soil by Sorghum bicolor (L.) Moench and soil microbial community-level physiological profiles (CLPPs).

PubMed

Wang, Xu; Chen, Can; Wang, Jianlong

2017-03-01

Phytoremediation of strontium contaminated soil by Sorghum bicolor (L.) Moench was investigated, and the soil microbial community-level physiological profiles (CLPPs) were examined. The growth and the stable strontium ( 88 Sr) accumulations of the energy crop S. bicolor grown on the Sr-spiked soil at the level of 0, 50, 100, 200, and 400 mg/kg soil were characterized through pot soil system after the entire growth period (140 days). Correspondingly, the available content of strontium in soil extracted by Mehlich III extraction solution reached 42.0, 71.9, 151.8, and 242.2 mg/kg, respectively. The Sr-polluted soil microbial community was assessed by a Biolog Eco-plate method. The results showed that the spiked Sr significantly increased the height and the stem biomass weight of the plant. Sr contents in roots, stems, and leaves of the sorghum increased linearly (R 2  > 0.95) with the elevation of the Sr-spiked level in soil. The average Sr concentration in roots, stems, and leaves reached 68.9, 61.3, and 132.6 mg/kg dry weight (DW) under Sr-spiked 400 mg/kg soil, respectively. Sr content in tissues decreased in the order of leaves > roots > stems. The bioconcentration factor (BCF; Sr contents in shoots to soil) values of S. bicolor in soil system was lower than 1 (0.21∼0.39) whether based on the spiked Sr level or on the available Sr level in soil. The transfer factor (TF; Sr contents in shoots to roots) values of S. bicolor in soil system usually is higher than 1 or near to 1 (0.92∼1.29). TF values increased while BCF values decreased as the soil Sr increased. The Biolog Eco-plate assay showed that Sr at the spiked level of 400 mg/kg soil enhanced the soil microbial diversity and activity.

A solvent-isotope-effect study of proton transfer during catalysis by Escherichia coli (lacZ) beta-galactosidase.

PubMed Central

Selwood, T; Sinnott, M L

1990-01-01

1. Michaelis-Menten parameters for the hydrolysis of 4-nitrophenyl beta-D-galactopyranoside and 3,4-dinitrophenyl beta-D-galactopyranoside Escherichia coli (lacZ) beta-galactosidase were measured as a function of pH or pD (pL) in both 1H2O and 2H2O. 2. For hydrolysis of 4-nitrophenyl beta-D-galactopyranoside by Mg2(+)-free enzyme, V is pL-independent below pL 9, but the V/Km-pL profile is sigmoid, the pK values shifting from 7.6 +/- 0.1 in 1H2O to 8.2 +/- 0.1 in 2H2O, and solvent kinetic isotope effects are negligible, in accord with the proposal [Sinnott, Withers & Viratelle (1978) Biochem. J. 175, 539-546] that glycone-aglycone fission without acid catalysis governs both V and V/Km. 3. V for hydrolysis of 4-nitrophenyl beta-D-galactopyranoside by Mg2(+)-enzyme varies sigmoidally with pL, the pK value shifting from 9.19 +/- 0.09 to 9.70 +/- 0.07; V/Km shows both a low-pL fall, probably due to competition between Mg2+ and protons [Tenu, Viratelle, Garnier & Yon (1971) Eur. J. Biochem. 20, 363-370], and a high-pL fall, governed by a pK that shifts from 8.33 +/- 0.08 to 8.83 +/- 0.08. There is a negligible solvent kinetic isotope effect on V/Km, but one of 1.7 on V, which a linear proton inventory shows to arise from one transferred proton. 4. The variation of V and V/Km with pL is sigmoid for hydrolysis of 3,4-dinitrophenyl beta-D-galactopyranoside by Mg2(+)-enzyme, with pK values showing small shifts, from 8.78 +/- 0.09 to 8.65 +/- 0.08 and from 8.7 +/- 0.1 to 8.9 +/- 0.1 respectively. There is no solvent isotope effect on V or V/Km for 3,4-dinitrophenyl beta-D-galactopyranoside, despite hydrolysis of the galactosyl-enzyme intermediate governing V. 5. Identification of the 'conformation change' in the hydrolysis of aryl galactosides proposed by Sinnott & Souchard [(1973) Biochem. J. 133, 89-98] with the protolysis of the magnesium phenoxide arising from the action of enzyme-bound Mg2+ as an electrophilic catalyst rationalizes these data and also resolves the conflict between the proposals and the 18O kinetic-isotope-effect data reported by Rosenberg & Kirsch [(1981) Biochemistry 20, 3189-3196]. It should be noted that the actual Km values were determined to higher precision than can be estimated from the Figures in this paper.(ABSTRACT TRUNCATED AT 400 WORDS) PMID:2114090

A solvent-isotope-effect study of proton transfer during catalysis by Escherichia coli (lacZ) beta-galactosidase.

PubMed

Selwood, T; Sinnott, M L

1990-06-01

1. Michaelis-Menten parameters for the hydrolysis of 4-nitrophenyl beta-D-galactopyranoside and 3,4-dinitrophenyl beta-D-galactopyranoside Escherichia coli (lacZ) beta-galactosidase were measured as a function of pH or pD (pL) in both 1H2O and 2H2O. 2. For hydrolysis of 4-nitrophenyl beta-D-galactopyranoside by Mg2(+)-free enzyme, V is pL-independent below pL 9, but the V/Km-pL profile is sigmoid, the pK values shifting from 7.6 +/- 0.1 in 1H2O to 8.2 +/- 0.1 in 2H2O, and solvent kinetic isotope effects are negligible, in accord with the proposal [Sinnott, Withers & Viratelle (1978) Biochem. J. 175, 539-546] that glycone-aglycone fission without acid catalysis governs both V and V/Km. 3. V for hydrolysis of 4-nitrophenyl beta-D-galactopyranoside by Mg2(+)-enzyme varies sigmoidally with pL, the pK value shifting from 9.19 +/- 0.09 to 9.70 +/- 0.07; V/Km shows both a low-pL fall, probably due to competition between Mg2+ and protons [Tenu, Viratelle, Garnier & Yon (1971) Eur. J. Biochem. 20, 363-370], and a high-pL fall, governed by a pK that shifts from 8.33 +/- 0.08 to 8.83 +/- 0.08. There is a negligible solvent kinetic isotope effect on V/Km, but one of 1.7 on V, which a linear proton inventory shows to arise from one transferred proton. 4. The variation of V and V/Km with pL is sigmoid for hydrolysis of 3,4-dinitrophenyl beta-D-galactopyranoside by Mg2(+)-enzyme, with pK values showing small shifts, from 8.78 +/- 0.09 to 8.65 +/- 0.08 and from 8.7 +/- 0.1 to 8.9 +/- 0.1 respectively. There is no solvent isotope effect on V or V/Km for 3,4-dinitrophenyl beta-D-galactopyranoside, despite hydrolysis of the galactosyl-enzyme intermediate governing V. 5. Identification of the 'conformation change' in the hydrolysis of aryl galactosides proposed by Sinnott & Souchard [(1973) Biochem. J. 133, 89-98] with the protolysis of the magnesium phenoxide arising from the action of enzyme-bound Mg2+ as an electrophilic catalyst rationalizes these data and also resolves the conflict between the proposals and the 18O kinetic-isotope-effect data reported by Rosenberg & Kirsch [(1981) Biochemistry 20, 3189-3196]. It should be noted that the actual Km values were determined to higher precision than can be estimated from the Figures in this paper.(ABSTRACT TRUNCATED AT 400 WORDS)

Different annealing temperature suitable for different Mg doped P-GaN

NASA Astrophysics Data System (ADS)

Liu, S. T.; Yang, J.; Zhao, D. G.; Jiang, D. S.; Liang, F.; Chen, P.; Zhu, J. J.; Liu, Z. S.; Li, X.; Liu, W.; Zhang, L. Q.; Long, H.; Li, M.

2017-04-01

In this work, epitaxial GaN with different Mg doping concentration annealed at different temperature is investigated. Through Hall and PL spectra measurement we found that when Mg doping concentration is different, different annealing temperature is needed for obtaining the best p-type conduction of GaN, and this difference comes from the different influence of annealing on compensated donors. For ultra-heavily Mg doped sample, the process of Mg related donors transferring to non-radiative recombination centers is dominated, so the performance of P-GaN deteriorates with temperature increase. But for low Mg doped sample, the process of Mg related donors transfer to non-raditive recombination is weak compare to the Mg acceptor activation, so along the annealing temperature increase the performance GaN gets better.

Total and Bioaccessible Soil Arsenic and Lead Levels and Plant Uptake in Three Urban Community Gardens in Puerto Rico.

PubMed

Misenheimer, John; Nelson, Clay; Huertas, Evelyn; Medina-Vera, Myriam; Prevatte, Alex; Bradham, Karen

2018-01-01

Arsenic (As) and lead (Pb) are two contaminants of concern associated with urban gardening. In Puerto Rico, data currently is limited on As and Pb levels in urban garden soils, soil metal (loid) bioaccessibility, and uptake of As and Pb in soil by edible plants grown in the region. This study examined total and bioaccessible soil As and Pb concentrations and accumulation in 10 commonly grown garden plants collected from three urban community gardens in Puerto Rico. Bioavailability values were predicted using bioaccessibility data to compare site-specific bioavailability estimates to commonly used default exposure assumptions. Total and bioaccessible As levels in study soils ranged from 2 to 55 mg/kg and 1 to 18 mg/kg, respectively. Total and bioaccessible Pb levels ranged from 19 to 172 mg/kg and 17 to 97 mg/kg, respectively. Measured bioaccessibility values corresponded to 19 to 42% bioaccessible As and 61 to 100% bioaccessible Pb when expressed as a percent of total As and Pb respectively. Predicted relative percent bioavailability of soil As and Pb based on measured bioaccessibility values ranged from 18 to 36% and 51 to 85% for As and Pb respectively. Transfer factors (TFs) measuring uptake of As in plants from soil ranged from 0 to 0.073 in the edible flesh (fruit or vegetable) of plant tissues analyzed and 0.073 to 0.444 in edible leaves. Pb TFs ranged from 0.002 to 0.012 in flesh and 0.023 to 0.204 in leaves. Consistent with TF values, leaves accumulated higher concentrations of As and Pb than the flesh, with the highest tissue concentrations observed in the culantro leaf (3.2 mg/kg dw of As and 8.9 mg/kg dw of Pb). Leaves showed a general but not statistically-significant (α = 0.05) trend of increased As and Pb concentration with increased soil levels, while no trend was observed for flesh tissues. These findings provide critical data that can improve accuracy and reduce uncertainty when conducting site-specific risk determination of potential As and Pb exposure while gardening or consuming garden produce in the understudied region of Puerto Rico.

Effect of impeller type and mechanical agitation on the mass transfer and power consumption aspects of ASBR operation treating synthetic wastewater.

PubMed

Michelan, Rogério; Zimmer, Thiago R; Rodrigues, José A D; Ratusznei, Suzana M; de Moraes, Deovaldo; Zaiat, Marcelo; Foresti, Eugenio

2009-03-01

The effect of flow type and rotor speed was investigated in a round-bottom reactor with 5 L useful volume containing 2.0 L of granular biomass. The reactor treated 2.0 L of synthetic wastewater with a concentration of 800 mgCOD/L in 8-h cycles at 30 degrees C. Five impellers, commonly used in biological processes, have been employed to this end, namely: a turbine and a paddle impeller with six-vertical-flat-blades, a turbine and a paddle impeller with six-45 degrees -inclined-flat-blades and a three-blade-helix impeller. Results showed that altering impeller type and rotor speed did not significantly affect system stability and performance. Average organic matter removal efficiency was about 84% for filtered samples, total volatile acids concentration was below 20 mgHAc/L and bicarbonate alkalinity a little less than 400 mgCaCO3/L for most of the investigated conditions. However, analysis of the first-order kinetic model constants showed that alteration in rotor speed resulted in an increase in the values of the kinetic constants (for instance, from 0.57 h(-1) at 50 rpm to 0.84 h(-1) at 75 rpm when the paddle impeller with six-45 degrees -inclined-flat-blades was used) and that axial flow in mechanically stirred reactors is preferable over radial-flow when the vertical-flat-blade impeller is compared to the inclined-flat-blade impeller (for instance at 75 rpm, from 0.52 h(-1) with the six-flat-blade-paddle impeller to 0.84 h(-1) with the six-45 degrees -inclined-flat-blade-paddle impeller), demonstrating that there is a rotor speed and an impeller type that maximize solid-liquid mass transfer in the reaction medium. Furthermore, power consumption studies in this reduced reactor volume showed that no high power transfer is required to improve mass transfer (less than 0.6 kW/10(3)m3).

Partially reduced graphene oxide-gold nanorods composite based bioelectrode of improved sensing performance.

PubMed

Nirala, Narsingh R; Abraham, Shiju; Kumar, Vinod; Pandey, Shobhit A; Yadav, Umakant; Srivastava, Monika; Srivastava, S K; Singh, Vidya Nand; Kayastha, Arvind M; Srivastava, Anchal; Saxena, Preeti S

2015-11-01

The present work proposes partially reduced graphene oxide-gold nanorods supported by chitosan (CH-prGO-AuNRs) as a potential bioelectrode material for enhanced glucose sensing. Developed on ITO substrate by immobilizing glucose oxidase on CH-prGO-AuNRs composite, these CH-prGO-AuNRs/ITO bioelectrodes demonstrate high sensitivity of 3.2 µA/(mg/dL)/cm(2) and linear range of 25-200 mg/dL with an ability to detect as low as 14.5 mg/dL. Further, these CH-prGO-AuNRs/ITO based electrodes attest synergistiacally enhanced sensing properties when compared to simple graphene oxide based CH-GO/ITO electrode. This is evident from one order higher electron transfer rate constant (Ks) value in case of CH-prGO-AuNRs modified electrode (12.4×10(-2) cm/s), in contrast to CH-GO/ITO electrode (6×10(-3) cm/s). Additionally, very low Km value [15.4 mg/dL(0.85 mM)] ensures better binding affinity of enzyme to substrate which is desirable for good biosensor stability and resistance to environmental interferences. Hence, with better loading capacity, kinetics and stability, the proposed CH-prGO-AuNRs composite shows tremendous potential to detect several bio-analytes in the coming future. Copyright © 2015 Elsevier B.V. All rights reserved.

Atomistic simulations of deformation mechanisms in ultralight weight Mg-Li alloys

NASA Astrophysics Data System (ADS)

Karewar, Shivraj

Mg alloys have spurred a renewed academic and industrial interest because of their ultra-light-weight and high specific strength properties. Hexagonal close packed Mg has low deformability and a high plastic anisotropy between basal and non-basal slip systems at room temperature. Alloying with Li and other elements is believed to counter this deficiency by activating non-basal slip by reducing their nucleation stress. In this work I study how Li addition affects deformation mechanisms in Mg using atomistic simulations. In the first part, I create a reliable and transferable concentration dependent embedded atom method (CD-EAM) potential for my molecular dynamics study of deformation. This potential describes the Mg-Li phase diagram, which accurately describes the phase stability as a function of Li concentration and temperature. Also, it reproduces the heat of mixing, lattice parameters, and bulk moduli of the alloy as a function of Li concentration. Most importantly, our CD-EAM potential reproduces the variation of stacking fault energy for basal, prismatic, and pyramidal slip systems that in uences the deformation mechanisms as a function of Li concentration. This success of CD-EAM Mg-Li potential in reproducing different properties, as compared to literature data, shows its reliability and transferability. Next, I use this newly created potential to study the effect of Li addition on deformation mechanisms in Mg-Li nanocrystalline (NC) alloys. Mg-Li NC alloys show basal slip, pyramidal type-I slip, tension twinning, and two-compression twinning deformation modes. Li addition reduces the plastic anisotropy between basal and non-basal slip systems by modifying the energetics of Mg-Li alloys. This causes the solid solution softening. The inverse relationship between strength and ductility therefore suggests a concomitant increase in alloy ductility. A comparison of the NC results with single crystal deformation results helps to understand the qualitative and quantitative effect of Li addition in Mg on nucleation stress and fault energies of each deformation mode. The nucleation stress and fault energies of basal dislocations and compression twins in single crystal Mg-Li alloy increase while those for pyramidal dislocations and tension twinning decrease. This variation in respective values explains the reduction in plastic anisotropy and increase in ductility for Mg-Li alloys.

In silico ordinary differential equation/partial differential equation hemodialysis model estimates methadone removal during dialysis

PubMed Central

Linares, Oscar A; Schiesser, William E; Fudin, Jeffrey; Pham, Thien C; Bettinger, Jeffrey J; Mathew, Roy O; Daly, Annemarie L

2015-01-01

Background There is a need to have a model to study methadone’s losses during hemodialysis to provide informed methadone dose recommendations for the practitioner. Aim To build a one-dimensional (1-D), hollow-fiber geometry, ordinary differential equation (ODE) and partial differential equation (PDE) countercurrent hemodialyzer model (ODE/PDE model). Methodology We conducted a cross-sectional study in silico that evaluated eleven hemodialysis patients. Patients received a ceiling dose of methadone hydrochloride 30 mg/day. Outcome measures included: the total amount of methadone removed during dialysis; methadone’s overall intradialytic mass transfer rate coefficient, km; and, methadone’s removal rate, jME. Each metric was measured at dialysate flow rates of 250 mL/min and 800 mL/min. Results The ODE/PDE model revealed a significant increase in the change of methadone’s mass transfer with increased dialysate flow rate, %Δkm=18.56, P=0.02, N=11. The total amount of methadone mass transferred across the dialyzer membrane with high dialysate flow rate significantly increased (0.042±0.016 versus 0.052±0.019 mg/kg, P=0.02, N=11). This was accompanied by a small significant increase in methadone’s mass transfer rate (0.113±0.002 versus 0.014±0.002 mg/kg/h, P=0.02, N=11). The ODE/PDE model accurately predicted methadone’s removal during dialysis. The absolute value of the prediction errors for methadone’s extraction and throughput were less than 2%. Conclusion ODE/PDE modeling of methadone’s hemodialysis is a new approach to study methadone’s removal, in particular, and opioid removal, in general, in patients with end-stage renal disease on hemodialysis. ODE/PDE modeling accurately quantified the fundamental phenomena of methadone’s mass transfer during hemodialysis. This methodology may lead to development of optimally designed intradialytic opioid treatment protocols, and allow dynamic monitoring of outflow plasma opioid concentrations for model predictive control during dialysis in humans. PMID:26229501

Spectroscopy of charge transfer states in Mg1 - x Ni x O

NASA Astrophysics Data System (ADS)

Churmanov, V. N.; Sokolov, V. I.; Pustovarov, V. A.; Gruzdev, N. B.; Mironova-Ulmane, N.

2016-10-01

Photoluminescence and photoluminescence excitation spectra of solid solution Mg1- x Ni x O ( x = 0.008) have been analyzed. The contributions of charge transfer electronic states and nonradiative Auger relaxation to the formation of the photoluminescence spectrum are discussed.

Reduced Graphene Oxide Coating with Anticorrosion and Electrochemical Property-Enhancing Effects Applied in Hydrogen Storage System.

PubMed

Du, Yi; Li, Na; Zhang, Tong-Ling; Feng, Qing-Ping; Du, Qian; Wu, Xing-Hua; Huang, Gui-Wen

2017-08-30

Low-capacity retention is the most prominent problem of the magnesium nickel alloy (Mg 2 Ni), which prevents it from being commercially applied. Here, we propose a practical method for enhancing the cycle stability of the Mg 2 Ni alloy. Reduced graphene oxide (rGO) possesses a graphene-based structure, which could provide high-quality barriers that block the hydroxyl in the aqueous electrolyte; it also possesses good hydrophilicity. rGO has been successfully coated on the amorphous-structured Mg 2 Ni alloy via electrostatic assembly to form the rGO-encapsulated Mg 2 Ni alloy composite (rGO/Mg 2 Ni). The experimental results show that ζ potentials of rGO and the modified Mg 2 Ni alloy are totally opposite in water, with values of -11.0 and +22.4 mV, respectively. The crumpled structure of rGO sheets and the contents of the carbon element on the surface of the alloy are measured using scanning electron microscopy, transmission electron microscopy, and energy dispersive spectrometry. The Tafel polarization test indicates that the rGO/Mg 2 Ni system exhibits a much higher anticorrosion ability against the alkaline solution during charging/discharging. As a result, high-capacity retentions of 94% (557 mAh g -1 ) at the 10th cycle and 60% (358 mAh g -1 ) at the 50th cycle have been achieved, which are much higher than the results on Mg 2 Ni capacity retention combined with the absolute value reported so far to our knowledge. In addition, both the charge-transfer reaction rate and the hydrogen diffusion rate are proven to be boosted with the rGO encapsulation. Overall, this work demonstrates the effective anticorrosion and electrochemical property-enhancing effects of rGO coating and shows its applicability in the Mg-based hydrogen storage system.

Lead in New York City community garden chicken eggs: influential factors and health implications.

PubMed

Spliethoff, Henry M; Mitchell, Rebecca G; Ribaudo, Lisa N; Taylor, Owen; Shayler, Hannah A; Greene, Virginia; Oglesby, Debra

2014-08-01

Raising chickens for eggs in urban areas is becoming increasingly common. Urban chickens may be exposed to lead, a common urban soil contaminant. We measured lead concentrations in chicken eggs from New York City (NYC) community gardens and collected information on factors that might affect those concentrations. Lead was detected between 10 and 167 μg/kg in 48 % of NYC eggs. Measures of lead in eggs from a henhouse were significantly associated (p < 0.005) with lead concentrations in soil. The association between soil and egg lead has been evaluated only once before, by a study of a rural region in Belgium. In our study, the apparent lead soil-to-egg transfer efficiency was considerably lower than that found in Belgium, suggesting that there may be important geographic differences in this transfer. We developed models that suggested that, for sites like ours, lead concentrations in >50 % of eggs from a henhouse would exceed store-bought egg concentrations (<7-13 μg/kg; 3 % above detection limit) at soil lead concentrations >120 mg/kg and that the concentration in one of six eggs from a henhouse would exceed a 100 μg/kg guidance value at soil lead concentrations >410 mg/kg. Our models also suggested that the availability of dietary calcium supplements was another influential factor that reduced egg lead concentrations. Estimates of health risk from consuming eggs with the lead concentrations we measured generally were not significant. However, soil lead concentrations in this study were <600 mg/kg, and considerably higher concentrations are not uncommon. Efforts to reduce lead transfer to chicken eggs and associated exposure are recommended for urban chicken keepers.

Active transport of cimetidine into human milk.

PubMed

Oo, C Y; Kuhn, R J; Desai, N; McNamara, P J

1995-11-01

Most xenobiotics are transferred from blood into breast milk by passive diffusion. However, an active transport mechanism has been speculated for cimetidine, and the purpose of this study was to characterize cimetidine transfer into human milk. Twelve healthy lactating volunteers received single oral doses of 100, 600, and 1200 mg cimetidine in a randomized, crossover design on 3 different days. Blood and milk specimens were collected and assayed for cimetidine. In vitro measurements, including skim to whole milk concentration ratio, milk pH, and free fractions in serum and milk were used for a diffusion model prediction of milk to serum concentration ratio of cimetidine; the mean milk/serum ratio (+/- SD) was 1.05 +/- 0.18. The observed milk/serum ratio (5.77 +/- 1.24) was 5.5 times higher than the milk/serum ratio predicted by diffusion. The observed milk/serum ratio for the three dosing regimens were not significantly different from one another. Time of peak concentration (tmax) in milk (3.3 +/- 0.7 hours) displayed a delay compared with serum tmax (1.7 +/- 0.6 hours). Oral clearance for 1200 mg cimetidine dose (0.47 +/- 0.11 L/hr/kg) was significantly lower compared with oral clearance values for 100 and 600 mg cimetidine doses (0.59 +/- 0.11 and 0.57 +/- 0.13 L/hr/kg, respectively). The maternal dose of cimetidine ingested by a suckling infant based on body weight was estimated to be 6.7%, which appears to be safe under normal conditions. This study provides the first definitive evidence of an active transport system for drug transfer into human milk, which may have broader consequences for the suckling infant.

Lead in New York City Community Garden Chicken Eggs: Influential Factors and Health Implications

PubMed Central

Spliethoff, Henry M.; Mitchell, Rebecca G.; Ribaudo, Lisa N.; Taylor, Owen; Shayler, Hannah A.; Greene, Virginia; Oglesby, Debra

2014-01-01

Raising chickens for eggs in urban areas is becoming increasingly common. Urban chickens may be exposed to lead, a common urban soil contaminant. We measured lead concentrations in chicken eggs from New York City (NYC) community gardens and collected information on factors that might affect those concentrations. Lead was detected between 10 and 167 μg/kg in 48% of NYC eggs. Measures of lead in eggs from a henhouse were significantly associated (p<0.005) with lead concentrations in soil. The association between soil and egg lead has been evaluated only once before, by a study of a rural region in Belgium. In our study, the apparent lead soil-to-egg transfer efficiency was considerably lower than that found in Belgium, suggesting that there may be important geographic differences in this transfer. We developed models that suggested that, for sites like ours, lead concentrations in >50% of eggs from a henhouse would exceed store-bought egg concentrations (<7–13 μg/kg; 3% above detection limit) at soil lead concentrations >120 mg/kg, and that the concentration in one of six eggs from a henhouse would exceed a 100 μg/kg guidance value at soil lead concentrations >410 mg/kg. Our models also suggested that the availability of dietary calcium supplements was another influential factor that reduced egg lead concentrations. Estimates of health risk from consuming eggs with the lead concentrations we measured generally were not significant. However, soil lead concentrations in this study were <600 mg/kg, and considerably higher concentrations are not uncommon. Efforts to reduce lead transfer to chicken eggs and associated exposure are recommended for urban chicken keepers. PMID:24287691

Copper Oxide Nanoparticle Foliar Uptake, Phytotoxicity, and Consequences for Sustainable Urban Agriculture.

PubMed

Xiong, TianTian; Dumat, Camille; Dappe, Vincent; Vezin, Hervé; Schreck, Eva; Shahid, Muhammad; Pierart, Antoine; Sobanska, Sophie

2017-05-02

Throughout the world, urban agriculture supplies fresh local vegetables to city populations. However, the increasing anthropogenic uses of metal-containing nanoparticles (NPs) such as CuO-NPs in urban areas may contaminate vegetables through foliar uptake. This study focused on the CuO-NP transfer processes in leafy edible vegetables (i.e., lettuce and cabbage) to assess their potential phytotoxicity. Vegetables were exposed via leaves for 5, 10, or 15 days to various concentrations of CuO-NPs (0, 10, or 250 mg per plant). Biomass and gas exchange values were determined in relation to the Cu uptake rate, localization, and Cu speciation within the plant tissues. High foliar Cu uptake occurred after exposure for 15 days for lettuce [3773 mg (kg of dry weight) -1 ] and cabbage [4448 mg (kg of dry weight) -1 ], along with (i) decreased plant weight, net photosynthesis level, and water content and (ii) necrotic Cu-rich areas near deformed stomata containing CuO-NPs observed by scanning electron microscopy and energy dispersive X-ray microanalysis. Analysis of the CuO-NP transfer rate (7.8-242 μg day -1 ), translocation of Cu from leaves to roots and Cu speciation biotransformation in leaf tissues using electron paramagnetic resonance, suggests the involvement of plant Cu regulation processes. Finally, a potential health risk associated with consumption of vegetables contaminated with CuO-NPs was highlighted.

Transfer of chemical elements from a contaminated estuarine sediment to river water. A leaching assay

NASA Astrophysics Data System (ADS)

Abreu, Manuela; Peres, Sara; Magalhães, M. Clara F.

2014-05-01

Wastes of a former Portuguese steel industry were deposited during 40 years on the left bank of the Coina River, which flows into the estuary of the Tagus River near Lisbon. The aim of this study was to evaluate the release of the chemical elements from the contaminated sediment to the river water. A leaching experiment (four replicates) was performed using 1.6 kg/replicate of sediment from a landfill located in the Coina River bank, forming a lagoon subject to tidal influence. River water coming from this lagoon was collected during low tide. This water (200 mL) was added to the moist sediment, contained in cylindrical reactors, and was collected after 24 h of percolation. The leaching experiments were conducted for 77 days being leachates collected at time zero, after 28, 49 and 77 days with the sediment always moist. The sediment was characterized for: pH, electric conductivity (EC), total organic carbon (TOC), extractable phosphorus and potassium, mineral nitrogen, iron from iron oxides (crystalline and non-crystalline) and manganese oxides. Multi-elemental analysis was also made by ICP-INAA. Leachates and river water were analysed for pH, EC, hydrogencarbonate and sulfatetot by titrations, chloride by potentiometry, and multi-elemental composition by ICP-MS. The sediment presented pH=7.2, EC=18.5 dS/m, TOC=147.8 g/kg, high concentrations of extractable phosphorous (62.8 mg/kg) and potassium (1236.8 mg/kg), mineral nitrogen=11.3 mg/kg. The non-crystalline fraction of iron oxides corresponds to 99% (167.5 g Fe/kg) of the total iron oxides, and manganese from manganese oxides was low (52.7 mg/kg). Sediment is considered contaminated. It contained high concentrations (g/kg) of Zn (2.9), Pb (0.9), Cr (0.59), Cu (0.16), As (0.07), Cd (0.005), and Hg (0.001), which are above Canadian values for marine sediments quality guidelines for protection of aquatic life. River water had: pH=8.2, EC=28.6 dS/m, csulfate=1.23 g/L, and [Cl-]=251.6 mg/L. The concentrations of Cd (0.001 mg/L) and Hg (0.02 mg/L) were above Canadian water quality guidelines for protection of aquatic life. Leachates had pH≡7.9 and EC=38.7 dS/m (mean values), and high concentrations of hydrogencarbonate (723.7 mg/L), sulfatetot (1.8 g/L) and chloride (252.2 mg/L). Over the experiment, only pH (7.6-8.0) and EC (35.7-55.2 dS/m) values showed statistical differences, increasing over time. Regarding multi-elemental contamination, statistical differences were found between some elements concentrations (Co, Cu, Cr, Mn, Ni, Sb, U, V, W, Zn) in the leachates/kg of sediment collected after river water percolation in the four periods. However, only the concentrations of Ni (4.7-9.2 µg/kg), Sb (0.08-0.14 µg/kg), W (0.16-1.1 µg/kg) and Zn (1.72-5.74 µg/kg) have increased. The concentration of the elements in the leachates when compared to the same elements concentration in the sediments corresponds to a fraction lower than 1%. When comparing the concentrations of the elements in the leachates and in the river water used for sediments leaching, the values in leachates are in general lower, being the highest obtained for Ni, W and U, which correspond to 62, 61 and 50% of the river water values, respectively. Chemical elements transfer from sediments to river water can be considered very low.

Measuring one nucleon transfer reaction 24Mg( p, d)23Mg for astrophysical reaction rates

NASA Astrophysics Data System (ADS)

Lee, E. J.; Chae, K. Y.

2017-12-01

The level structure of a radionuclide 23Mg has been studied by using the 24Mg( p, d)23Mg one nucleon transfer reaction measurement for the astrophysical 19Ne(α, γ)23Mg reaction rate. A 41 MeV proton beam was produced and accelerated at the 25 MV tandem accelerator of the Holifield Radioactive Ion Beam Facility of the Oak Ridge National Laboratory in the United States. The beam particles impinged on an isotopically-enriched 24Mg solid target. Angular distributions of recoiling deuterons were extracted by using a large area silicon strip detector array. By comparing the experimentally-obtained angular distributions with zero range distorted wave Born approximation calculations, spins and parities of three energy levels of 23Mg could be constrained for the first time, which is very important information needed to understand the 19Ne(α, γ)23Mg reaction rate.

Chlorpyrifos residual behaviors in field crops and transfers during duck pellet feed processing.

PubMed

Li, Rui; Wei, Wei; He, Liang; Hao, Lili; Ji, Xiaofeng; Zhou, Yu; Wang, Qiang

2014-10-22

Chlorpyrifos is a widely used organophosphorus pesticide in agricultural crops (including food) and animal feeds in China, resulting in heavy contamination. Many studies have focused on the food-processing effects on chlorpyrifos removal, but sufficient information is not observed for feed-processing steps. Here, chlorpyrifos residual behaviors in field crops and its transfers in duck pellet feed-processing steps were evaluated. In field trials, the highest residues for rice grain, shelled corn, and soybean seed were 12.0, 0.605, and 0.220 mg/kg, respectively. Residues of all rice grain and about half of shelled corn exceeded the maximum residue limits (MRLs) of China, and five soybean seeds exceeded the MRL of China. Chlorpyrifos residue was reduced 38.2% in brown rice after the raw rice grain was hulled. The residue in bran increased 71.2% after milling from brown rice. During the squashing step, the residue reduced 73.8% in soybean meal. The residues reduced significantly (23.7-36.8%) during the process of granulating for rice, maize, and soybean products. Comparatively, the grinding process showed only limited influence on chlorpyrifos removal (<10%). The residues of duck pellet feeds produced from highly contaminated raw materials of this study were 1.01 mg/kg (maize-soybean feed) and 3.20 mg/kg (rice-soybean feed), which were much higher than the generally accepted value (>0.1 mg/kg) for animal feeding. Chlorpyrifos residues were removed significantly by processing steps of pellet feeds, but the residue of raw materials was the determining factor for the safety of duck feeding.

Organic and inorganic selenium: IV. passive transfer of immunoglobulin from ewe to lamb.

PubMed

Stewart, W C; Bobe, G; Vorachek, W R; Stang, B V; Pirelli, G J; Mosher, W D; Hall, J A

2013-04-01

Newborn lambs depend on their dams for passive transfer of immunoglobulins, primarily IgG, for protection from harmful pathogens until their own immunological defenses have developed. Previous studies have suggested that supplementation with Se results in a modest increase in IgG concentration in serum of newborn calves and lambs. To evaluate the effect of the Se source and supplementation rate in ewes during pregnancy on passive transfer of IgG to their lambs, 210 Polypay, Suffolk, or Suffolk × Polypay cross ewes were divided into 7 treatment groups (n = 30 each) and drenched weekly with no Se, at the maximum FDA-allowed concentration with inorganic Na-selenite or organic Se-yeast (4.9 mg Se/wk), or with inorganic Na-selenite and organic Se-yeast at supranutritional concentrations (14.7 and 24.5 mg Se/wk). Ewe serum IgG concentrations were measured within 30 d of parturition, ewe colostrum and lamb serum IgG concentrations were measured at parturition before suckling, and lamb serum IgG concentrations were measured again at 48 h postnatal. Ewes receiving 24.5 mg Se/wk tended to have or had, independent of Se source, greater colostral IgG concentrations than ewes receiving 4.9 mg Se/wk overall (81.3 vs. 66.2 mg/mL; P = 0.08) and for Polypay ewes only (90.1 vs. 60.7 mg/mL; P = 0.03). Polypay ewes receiving Se-yeast at 24.5 mg Se/wk transferred a greater calculated total IgG amount to their lambs than Polypay ewes receiving Se-yeast at 4.9 mg Se/wk (15.5 vs. 11.6 g; P = 0.02), whereas the converse was true (interaction between Se source and dose concentration; P = 0.03) for Polypay ewes receiving inorganic Na-selenite at 24.5 mg Se/wk vs. Na-selenite at 4.9 mg/wk (11.6 vs. 15.7 g; P = 0.08). Our results suggest that supranutritional Se supplementation of Polypay ewes during pregnancy increases colostral IgG concentrations but that the optimal supplementation rate for IgG transfer from ewe to lamb may differ for Na-selenite and Se-yeast.

Heavy metals in intensive greenhouse vegetable production systems along Yellow Sea of China: Levels, transfer and health risk.

PubMed

Hu, Wenyou; Huang, Biao; Tian, Kang; Holm, Peter E; Zhang, Yanxia

2017-01-01

Recently, greenhouse vegetable production (GVP) has grown rapidly and counts a large proportion of vegetable production in China. In this study, the accumulation, health risk and threshold values of selected heavy metals were evaluated systematically. A total of 120 paired soil and vegetable samples were collected from three typical intensive GVP systems along the Yellow Sea of China. Mean concentrations of Cd, As, Hg, Pb, Cu and Zn in greenhouse soils were 0.21, 7.12, 0.05, 19.81, 24.95 and 94.11 mg kg -1 , respectively. Compared to rootstalk and fruit vegetables, leafy vegetables had relatively high concentrations and transfer factors of heavy metals. The accumulation of heavy metals in soils was affected by soil pH and soil organic matter. The calculated hazard quotients (HQ) of the heavy metals by vegetable consumption decreased in the order of leafy > rootstalk > fruit vegetables with hazard index (HI) values of 0.61, 0.33 and 0.26, respectively. The HI values were all below 1, which indicates that there is a low risk of greenhouse vegetable consumption. Soil threshold values (STVs) of heavy metals in GVP system were established according to the health risk assessment. The relatively lower transfer factors of rootstalk and fruit vegetables and higher STVs suggest that these types of vegetables are more suitable for cultivation in greenhouse soils. This study will provide an useful reference for controlling heavy metals and developing sustainable GVP. Copyright © 2016 Elsevier Ltd. All rights reserved.

Evaluation of an Ultra-Low Power Reed Solomon Encoder for NASA's Space Technology 5 Mission

NASA Technical Reports Server (NTRS)

Lei, K. E.; Xapsos, M. A.; Poivey, C.; LaBel, K. A.; Stone, R. F.; Yeh, P-S.; Gambles, J.; Hass, J.; Maki, G.; Murguia, J.

2003-01-01

Radiation test results and analyses are presented for ultra-low power Reed Solomon encoder circuits that are being considered for use on the Space Technology 5 (ST5) mission. The total ionizing dose tolerance is in excess of 100 krad(Si) and is due to the low supply voltage and the use of back-bias, which suppresses radiation-induced leakage currents in the n-channel devices. The circuits do not latch-up for ion LET values of at least 90 MeV-sq cm/mg. A hardened-by-design approach to SEU has achieved an upset threshold of about 20 MeV-sq cm/mg. The SEU rate expected for these circuits in the geosynchronous transfer orbit of ST5 is low.

Intriguingly high convective heat transfer enhancement of nanofluid coolants in laminar flows

NASA Astrophysics Data System (ADS)

Xie, Huaqing; Li, Yang; Yu, Wei

2010-05-01

We reported on investigation of the convective heat transfer enhancement of nanofluids as coolants in laminar flows inside a circular copper tube with constant wall temperature. Nanofluids containing Al 2O 3, ZnO, TiO 2, and MgO nanoparticles were prepared with a mixture of 55 vol.% distilled water and 45 vol.% ethylene glycol as base fluid. It was found that the heat transfer behaviors of the nanofluids were highly depended on the volume fraction, average size, species of the suspended nanoparticles and the flow conditions. MgO, Al 2O 3, and ZnO nanofluids exhibited superior enhancements of heat transfer coefficient, with the highest enhancement up to 252% at a Reynolds number of 1000 for MgO nanofluid. Our results demonstrated that these oxide nanofluids might be promising alternatives for conventional coolants.

Photoinduced electron transfer process on emission spectrum of N,N‧-bis(salicylidene)-1,2-phenylenediamine as a Mg2+ cation chemosensor: A first principle DFT and TDDFT study

NASA Astrophysics Data System (ADS)

Taherpour, Avat (Arman); Jamshidi, Morteza; Rezaei, Omid; Belverdi, Ali Rezaei

2018-06-01

The electronic and optical properties of N,N‧-bis(salicylidene)-1,2-phenylenediamine (SPDA) ligand were studied as a chemical sensor of Mg2+ cation in two solvents (water and DMSO) using the ab initio theory through Density Functional Theory (DFT) and Time Dependent Density Functional theory (TDDFT) methods. The results show that the SPDA ligand has a high ability for chemical sensing of Mg2+. The results has also represented that HOMO-LUMO energy gap decreases 0.941 eV after the complex formation between SPDA and Mg2+. In addition, obvious changes are found in the UV-Vis absorption spectrum, optical analyses SPDA ligand and [SPDA.Mg]2+ complex, which it has the capability of detecting Mg2+ via the adsorptive UV-Vis and colorimetric methods. Emission spectrum calculations and photoinduced electron transfer (PET) process in water solution shows different wavelength emission spectrum in amount of 4.6 nm. An analysis of NBO (natural bond orbital) data indicates tangible changes in the electron transfers data from the electron pairs of ligand to the conjugated system, both prior and subsequent to Mg2+addition.

Transfer rates of 19 typical pesticides and the relationship with their physicochemical property.

PubMed

Chen, Hongping; Pan, Meiling; Pan, Rong; Zhang, Minglu; Liu, Xin; Lu, Chengyin

2015-01-21

Determining the transfer rate of pesticides during tea brewing is important to identify the potential exposure risks from pesticide residues in tea. In this study, the transfer rates of 19 typical pesticides from tea to brewing were investigated using gas chromatography tandem mass and ultraperformance liquid chromatography tandem mass. The leaching rates of five pesticides (isocarbophos, triazophos, fenvalerate, buprofezin, and pyridaben) during tea brewing were first reported. The pesticides exhibited different transfer rates; however, this result was not related to residual concentrations and tea types. Pesticides with low octanol-water partition coefficients (Logkow) and high water solubility demonstrated high transfer rates. The transfer rates of pesticides with water solubility > 29 mg L(-1) (or <15 mg L(-1)) were >25% (or <10%), and those of pesticides with LogKow < 1.52 (or >2.48) were >65% (or <35%). This result indicates that water solubility at approximately 20 mg L(-1) and LogKow at approximately 2.0 could be the demarcation lines of transfer rate. The results of this study can be used as a guide in the application of pesticides to tea trees and establishment of maximum residue limits of pesticides in tea to reduce pesticide exposure in humans.

Mechanism of Mg2+-Accompanied Product Release in Sugar Nucleotidyltransferases.

PubMed

Vithani, Neha; Ankush Jagtap, Pravin Kumar; Verma, Sunil Kumar; Tripathi, Ravi; Awasthi, Shalini; Nair, Nisanth N; Prakash, Balaji

2018-03-06

The nucleotidyl transfer reaction, catalyzed by sugar nucleotidyltransferases (SNTs), is assisted by two active site Mg 2+ ions. While studying this reaction using X-ray crystallography, we captured snapshots of the pyrophosphate (product) as it exits along a pocket. Surprisingly, one of the active site Mg 2+ ions remains coordinated to the exiting pyrophosphate. This hints at the participation of Mg 2+ in the process of product release, besides its role in catalyzing nucleotidyl transfer. These observations are further supported by enhanced sampling molecular dynamics simulations. Free energy computations suggest that the product release is likely to be rate limiting in SNTs, and the origin of the high free energy barrier for product release could be traced back to the "slow" conformational change of an Arg residue at the exit end of the pocket. These results establish a dual role for Mg 2+ , and propose a general mechanism of product release during the nucleotidyl transfer by SNTs. Copyright © 2018 Elsevier Ltd. All rights reserved.

Toxicity reference values for methylmercury effects on avian reproduction: Critical review and analysis.

PubMed

Fuchsman, Phyllis C; Brown, Lauren E; Henning, Miranda H; Bock, Michael J; Magar, Victor S

2017-02-01

Effects of mercury (Hg) on birds have been studied extensively and with increasing frequency in recent years. The authors conducted a comprehensive review of methylmercury (MeHg) effects on bird reproduction, evaluating laboratory and field studies in which observed effects could be attributed primarily to Hg. The review focuses on exposures via diet and maternal transfer in which observed effects (or lack thereof) were reported relative to Hg concentrations in diet, eggs, or adult blood. Applicable data were identified for 23 species. From this data set, the authors identified ranges of toxicity reference values suitable for risk-assessment applications. Typical ranges of Hg effect thresholds are approximately 0.2 mg/kg to >1.4 mg/kg in diet, 0.05 mg/kg/d to 0.5 mg/kg/d on a dose basis, 0.6 mg/kg to 2.7 mg/kg in eggs, and 2.1 mg/kg to >6.7 mg/kg in parental blood (all concentrations on a wet wt basis). For Hg in avian blood, the review represents the first broad compilation of relevant toxicity data. For dietary exposures, the current data support TRVs that are greater than older, commonly used TRVs. The older diet-based TRVs incorporate conservative assumptions and uncertainty factors that are no longer justified, although they generally were appropriate when originally derived, because of past data limitations. The egg-based TRVs identified from the review are more similar to other previously derived TRVs but have been updated to incorporate new information from recent studies. While important research needs remain, a key recommendation is that species not yet tested for MeHg toxicity should be evaluated using toxicity data from tested species with similar body weights. Environ Toxicol Chem 2017;36:294-319. © 2016 SETAC. © 2016 SETAC.

Enhanced Ionization of Embedded Clusters by Electron-Transfer-Mediated Decay in Helium Nanodroplets.

PubMed

LaForge, A C; Stumpf, V; Gokhberg, K; von Vangerow, J; Stienkemeier, F; Kryzhevoi, N V; O'Keeffe, P; Ciavardini, A; Krishnan, S R; Coreno, M; Prince, K C; Richter, R; Moshammer, R; Pfeifer, T; Cederbaum, L S; Mudrich, M

2016-05-20

We report the observation of electron-transfer-mediated decay (ETMD) involving magnesium (Mg) clusters embedded in helium (He) nanodroplets. ETMD is initiated by the ionization of He followed by removal of two electrons from the Mg clusters of which one is transferred to the He ion while the other electron is emitted into the continuum. The process is shown to be the dominant ionization mechanism for embedded clusters for photon energies above the ionization potential of He. For Mg clusters larger than five atoms we observe stable doubly ionized clusters. Thus, ETMD provides an efficient pathway to the formation of doubly ionized cold species in doped nanodroplets.

Magnesium isotope geochemistry in arc volcanism.

PubMed

Teng, Fang-Zhen; Hu, Yan; Chauvel, Catherine

2016-06-28

Incorporation of subducted slab in arc volcanism plays an important role in producing the geochemical and isotopic variations in arc lavas. The mechanism and process by which the slab materials are incorporated, however, are still uncertain. Here, we report, to our knowledge, the first set of Mg isotopic data for a suite of arc lava samples from Martinique Island in the Lesser Antilles arc, which displays one of the most extreme geochemical and isotopic ranges, although the origin of this variability is still highly debated. We find the δ(26)Mg of the Martinique Island lavas varies from -0.25 to -0.10, in contrast to the narrow range that characterizes the mantle (-0.25 ± 0.04, 2 SD). These high δ(26)Mg values suggest the incorporation of isotopically heavy Mg from the subducted slab. The large contrast in MgO content between peridotite, basalt, and sediment makes direct mixing between sediment and peridotite, or assimilation by arc crust sediment, unlikely to be the main mechanism to modify Mg isotopes. Instead, the heavy Mg isotopic signature of the Martinique arc lavas requires that the overall composition of the mantle wedge is buffered and modified by the preferential addition of heavy Mg isotopes from fluids released from the altered subducted slab during fluid-mantle interaction. This, in turn, suggests transfer of a large amount of fluid-mobile elements from the subducting slab to the mantle wedge and makes Mg isotopes an excellent tracer of deep fluid migration.

The influence of facility agriculture production on phthalate esters distribution in black soils of northeast China.

PubMed

Zhang, Ying; Wang, Pengjie; Wang, Lei; Sun, Guoqiang; Zhao, Jiaying; Zhang, Hui; Du, Na

2015-02-15

The current study investigates the existence of 15 phthalate esters (PAEs) in surface soils (27 samples) collected from 9 different facility agriculture sites in the black soil region of northeast China, during the process of agricultural production (comprising only three seasons spring, summer and autumn). Concentrations of the 15 PAEs detected significantly varied from spring to autumn and their values ranged from 1.37 to 4.90 mg/kg-dw, with a median value of 2.83 mg/kg-dw. The highest concentration of the 15 PAEs (4.90 mg/kg-dw) was determined in summer when mulching film was used in the greenhouses. Probably an increase in environmental temperature was a major reason for PAE transfer from the mulching film into the soil and coupled with the increased usage of chemical fertilizers in greenhouses. Results showed that of the 15 PAEs, di(2-ethylhexyl) phthalate(DEHP), di-n-butyl phthalate (DBP), diethyl phthalate (DEP) and dimethyl phthalate (DMP) were in abundance with the mean value of 1.12 ± 0.22, 0.46 ± 0.05, 0.36 ± 0.04, and 0.17 ± 0.01 mg/kg-dw, respectively; and their average contributions in spring, summer, and autumn ranged between 64.08 and 90.51% among the 15 PAEs. The results of Principal Component Analysis (PCA) indicated the concentration of these four main PAEs significantly differed among the facility agricultures investigated, during the process of agricultural production. In comparison with foreign and domestic results of previous researches, it is proved that the black soils of facility agriculture in northeast China show higher pollution situation comparing with non-facility agriculture soils. Copyright © 2014 Elsevier B.V. All rights reserved.

The high sensitivity of the rabbit to the teratogenic effects of 13-cis-retinoic acid (isotretinoin) is a consequence of prolonged exposure of the embryo to 13-cis-retinoic acid and 13-cis-4-oxo-retinoic acid, and not of isomerization to all-trans-retinoic acid.

PubMed

Tzimas, G; Bürgin, H; Collins, M D; Hummler, H; Nau, H

1994-01-01

Previous studies suggested that the rabbit is much more susceptible to the teratogenic action of 13-cis-retinoic acid (13-cis-RA) than the mouse or the rat, while the teratogenicity of all-trans-RA was comparable in these species. In the present study we investigated if pharmacokinetics can explain these species- and structure-related differences. The embryotoxic and teratogenic potential of all-trans-retinoic acid (all-trans-RA) and 13-cis-RA were evaluated in the Swiss hare rabbit after oral administration of daily doses of the two drugs throughout organogenesis, from gestation day (GD) 6 to 18 (plug day = GD 0). All-trans-RA was given at dose levels of 0.7, 2 or 6 mg/kg body weight per day and 13-cis-RA at 3, 7.5 or 10 mg/kg per day. The doses needed to elicit a minimum teratogenic response were found to be 6 mg/kg per day for all-trans-RA and 10 mg/kg per day for 13-cis-RA. Using these doses, transplacental pharmacokinetics of all-trans- and 13-cis-RA were performed. Pregnant rabbits were treated once daily from GD 7 to 12 and plasma and embryo samples were collected for HPLC analysis at various time intervals after the final dose. The main plasma metabolites of all-trans- and 13-cis-RA were all-trans-beta-glucuronide (all-trans-RAG) and 13-cis-4-oxo-RA, respectively. The elimination of 13-cis-RA and its metabolites from maternal plasma were much slower than of all-trans-RA resulting in accumulation of the 13-cis-isomers in plasma. Marked differences in the placental transfer of the two drugs and their metabolites were observed. All-trans-RA and all-trans-4-oxo-RA were efficiently transferred to the rabbit embryo, reaching concentrations similar to the plasma levels. On the contrary, the 13-cis-isomers reached the embryo to a lesser extent. Despite its limited placental transfer, a considerable embryonic exposure to 13-cis-RA and 13-cis-4-oxo-RA was noticed after treatment with isotretinoin, as indicated by their area-under-the-concentration-time-curve (AUC) values in the embryo, which were in the same range as the corresponding AUC value of all-trans-RA after treatment with the all-trans-isomer.(ABSTRACT TRUNCATED AT 400 WORDS)

[Structure and luminescence properties of MgGa2O4 : Cr3+ with Zn substituted for Mg].

PubMed

Zhang, Wan-Xin; Wang, Yin-Hai; Li, Hai-Ling; Wang, Xian-Sheng; Zhao, Hui

2013-01-01

A series of red long afterglow phosphors with composition Zn(x) Mg(1-2) Ga2 O4 : Cr3+ (x = 0, 0.2, 0.6, 0.8, 1.0) were synthesized by a high temperature solid-state reaction method. The X-ray diffraction studies show that the phase of the phosphors is face-centered cubic structure. Photoluminescence spectra show that the red emission of Cr3+ originated from the transition of 2E-4A2. Due to the large overlap between absorption band of Cr3+ and emission band of the host. Cr3+ could obtain the excitation energy from the host via the effective energy transfer. The afterglow decay characteristics show that the phosphor samples with different Zn contents have different afterglow time and the afterglow time also changes with the value of x. The measurement of thermoluminescence reveals that the trap depth of the phosphor samples with different Zn contents is different. The samples with deeper traps have longer afterglow time.

Investigation of the kinetic mechanism of the demanganization reaction between carbon-saturated liquid iron and CaF2-CaO-SiO2-based slags

NASA Astrophysics Data System (ADS)

Duan, Sheng-chao; Li, Chuang; Guo, Han-jie; Guo, Jing; Han, Shao-wei; Yang, Wen-sheng

2018-04-01

The demanganization reaction kinetics of carbon-saturated liquid iron with an eight-component slag consisting of CaO-SiO2-MgO-FeO-MnO-Al2O3-TiO2-CaF2 was investigated at 1553, 1623, and 1673 K in this study. The rate-controlling step (RCS) for the demanganization reaction with regard to the hot metal pretreatment conditions was studied via kinetics analysis based on the fundamental equation of heterogeneous reaction kinetics. From the temperature dependence of the mass transfer coefficient of a transition-metal oxide (MnO), the apparent activation energy of the demanganization reaction was estimated to be 189.46 kJ·mol-1 in the current study, which indicated that the mass transfer of MnO in the molten slag controlled the overall rate of the demanganization reaction. The calculated apparent activation energy was slightly lower than the values reported in the literature for mass transfer in a slag phase. This difference was attributed to an increase in the "specific reaction interface" (SRI) value, either as a result of turbulence at the reaction interface or a decrease of the absolute amount of slag phase during sampling, and to the addition of calcium fluoride to the slag.

Detection of recombinant human lactoferrin and lysozyme produced in a bitransgenic cow.

PubMed

Kaiser, Germán G; Mucci, Nicolás C; González, Vega; Sánchez, Lourdes; Parrón, José A; Pérez, María D; Calvo, Miguel; Aller, Juan F; Hozbor, Federico A; Mutto, Adrián A

2017-03-01

Lactoferrin and lysozyme are 2 glycoproteins with great antimicrobial activity, being part of the nonspecific defensive system of human milk, though their use in commercial products is difficult because human milk is a limited source. Therefore, many investigations have been carried out to produce those proteins in biological systems, such as bacteria, yeasts, or plants. Mammals seem to be more suitable as expression systems for human proteins, however, especially for those that are glycosylated. In the present study, we developed a bicistronic commercial vector containing a goat β-casein promoter and an internal ribosome entry site fragment between the human lactoferrin and human lysozyme genes to allow the introduction of both genes into bovine adult fibroblasts in a single transfection. Embryos were obtained by somatic cell nuclear transfer, and, after 6 transferences to recipients, 3 pregnancies and 1 viable bitransgenic calf were obtained. The presence of the vector was confirmed by fluorescent in situ hybridization of skin cells. At 13 mo of life and after artificial induction of lactation, both recombinant proteins were found in the colostrum and milk of the bitransgenic calf. Human lactoferrin concentration in the colostrum was 0.0098 mg/mL and that in milk was 0.011 mg/mL; human lysozyme concentration in the colostrum was 0.0022 mg/mL and that in milk was 0.0024 mg/mL. The molar concentration of both human proteins revealed no differences in protein production of the internal ribosome entry site upstream and downstream protein. The enzymatic activity of lysozyme in the transgenic milk was comparable to that of human milk, being 6 and 10 times higher than that of bovine lysozyme present in milk. This work represents an important step to obtain multiple proteins or enhance single protein production by using animal pharming and fewer regulatory and antibiotic-resistant foreign sequences, allowing the design of humanized milk with added biological value for newborn nutrition and development. Transgenic animals can offer a unique opportunity to the dairy industry, providing starting materials suitable to develop specific products with high added value. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Initial hydration processes of magnesium chloride: size-selected anion photoelectron spectroscopy and ab initio calculations.

PubMed

Feng, Gang; Liu, Cheng-Wen; Zeng, Zhen; Hou, Gao-Lei; Xu, Hong-Guang; Zheng, Wei-Jun

2017-06-14

To understand the initial hydration processes of MgCl 2 , we measured photoelectron spectra of MgCl 2 (H 2 O) n - (n = 0-6) and conducted ab initio calculations on MgCl 2 (H 2 O) n - and their neutral counterparts up to n = 7. A dramatic drop in the vertical detachment energy (VDE) was observed upon addition of the first water molecule to bare MgCl 2 - . This large variation in VDE can be associated with the charge-transfer-to-solvent (CTTS) effect occurring in the MgCl 2 (H 2 O) n - clusters, as hydration induces transfer of the excess electron of MgCl 2 - to the water molecules. Investigation of the separation of Cl - -Mg 2+ ion pair shows that, in MgCl 2 (H 2 O) n - anions, breaking of the first Mg-Cl bond occurs at n = 4, while breaking of the second Mg-Cl bond takes place at n = 6. For neutral MgCl 2 (H 2 O) n clusters, breaking of the first Mg-Cl bond starts at n = 7.

Photoluminescence properties and energy transfer in Ce(3+) /Dy(3+) co-doped Sr(3) MgSi(2) O(8) phosphors for potential application in ultraviolet white light-emitting diodes.

PubMed

Yu, Hong; Zi, Wenwen; Lan, Shi; Gan, Shucai; Zou, Haifeng; Xu, Xuechun; Hong, Guangyan

2013-01-01

Sr(3) MgSi(2) O(8) :Ce(3+) , Dy(3+) phosphors were prepared by a solid-state reaction technique and the photoluminescence properties were investigated. The emission spectra show not only a band due to Ce(3+) ions (403 nm) but also as a band due to Dy(3+) ions (480, 575 nm) (UV light excitation). The photoluminescence properties reveal that effective energy transfer occurs in Ce(3+) /Dy(3+) co-doped Sr(3) MgSi(2) O(8)phosphors, and the co-doping of Ce(3+) could enhance the emission intensity of Dy(3+) to a certain extent by transferring its energy to Dy(3+) . The Ce(3+) /Dy(3+) energy transfer was investigated by emission/excitation spectra, and photoluminescence decay behaviors. In Sr2.94 MgSi2 O8 :0.01Ce(3+) , 0.05Dy(3+) phosphors, the fluorescence lifetime of Dy(3+) (from 3.35 to 27.59 ns) is increased whereas that of Ce(3+) is greatly decreased (from 43.59 to 13.55 ns), and this provides indirect evidence of the Ce(3+) to Dy(3+) energy transfer. The varied emitted color of Sr(3) MgSi(2) O(8):Ce(3+) , Dy(3+) phosphors from blue to white were achieved by altering the concentration ratio of Ce(3+) and Dy(3+) . These results indicate Sr(3) MgSi(2) O(8):Ce(3+) , Dy(3+) may be as a candidate phosphor for white light-emitting diodes. Copyright © 2012 John Wiley & Sons, Ltd.

HscA and HscB stimulate [2Fe-2S] cluster transfer from IscU to apo-ferredoxin in an ATP-dependent reaction†

PubMed Central

Chandramouli, Kala; Johnson, Michael K.

2008-01-01

The role of the Azotobacter vinelandii HscA/HscB co-chaperone system in ISC-mediated iron-sulfur cluster biogenesis has been investigated in vitro by using CD and EPR spectrometry to monitor the effect of HscA, HscB, MgATP, and MgADP on the time course of cluster transfer from [2Fe-2S]IscU to apo-Isc ferredoxin. CD spectra indicate that both HscB and HscA interact with [2Fe-2S] IscU and the rate of cluster transfer was stimulated more than 20-fold in the presence stoichiometric HscA and HscB and excess MgATP. No stimulation was observed in the absence of either HscB or MgATP and cluster transfer was found to be an ATP-dependent reaction based on concomitant phosphate production and the enhanced rates of cluster transfer in the presence of KCl which is known to stimulated HscA ATPase activity. The results demonstrate a role of the ISC HscA/HscB co-chaperone system in facilitating efficient [2Fe-2S] cluster transfer from the IscU scaffold protein to acceptor proteins and that [2Fe-2S] cluster transfer from IscU is an ATP-dependent process. The data are consistent with the proposed regulation of the HscA ATPase cycle by HscB and IscU (Silberg, J. J., Tapley, T. L., Hoff, K. G., and Vickery, L. E. (2004) J. Biol. Chem. 279, 53924-53931), and mechanistic proposals for coupling of the HscA ATPase cycle with cluster transfer from [2Fe-2S]IscU to apo-IscFdx are discussed. PMID:16964969

HscA and HscB stimulate [2Fe-2S] cluster transfer from IscU to apoferredoxin in an ATP-dependent reaction.

PubMed

Chandramouli, Kala; Johnson, Michael K

2006-09-19

The role of the Azotobacter vinelandii HscA/HscB cochaperone system in ISC-mediated iron-sulfur cluster biogenesis has been investigated in vitro by using CD and EPR spectrometry to monitor the effect of HscA, HscB, MgATP, and MgADP on the time course of cluster transfer from [2Fe-2S]IscU to apo-Isc ferredoxin. CD spectra indicate that both HscB and HscA interact with [2Fe-2S]IscU and the rate of cluster transfer was stimulated more than 20-fold in the presence stoichiometric HscA and HscB and excess MgATP. No stimulation was observed in the absence of either HscB or MgATP, and cluster transfer was found to be an ATP-dependent reaction based on concomitant phosphate production and the enhanced rates of cluster transfer in the presence of KCl which is known to stimulate HscA ATPase activity. The results demonstrate a role of the ISC HscA/HscB cochaperone system in facilitating efficient [2Fe-2S] cluster transfer from the IscU scaffold protein to acceptor proteins and that [2Fe-2S] cluster transfer from IscU is an ATP-dependent process. The data are consistent with the proposed regulation of the HscA ATPase cycle by HscB and IscU [Silberg, J. J., Tapley, T. L., Hoff, K. G., and Vickery, L. E. (2004) J. Biol. Chem. 279, 53924-53931], and mechanistic proposals for coupling of the HscA ATPase cycle with cluster transfer from [2Fe-2S]IscU to apo-IscFdx are discussed.

Results From Cs Activated GaN Photocathode Development for MCP Detector Systems at GSFC

NASA Technical Reports Server (NTRS)

Norton, Tim; Woodgate, Bruce; Stock, Joe; Hilton, George; Ulmer, Mel; Aslam, Shahid; Vispute, R. D.

2003-01-01

We describe the development of high quantum efficiency W photocathodes for use in large area two dimensional microchannel plate based detector arrays to enable new W space astronomy missions. Future W missions will require improvements in detector sensitivity, which has the most leverage for cost-effective improvements in overall telescope/instrument sensitivity. We use new materials such as p-doped GaN, AIGaN, ZnMgO, Sic and diamond. We have currently obtained QE values > 40 % at 185 nm with Cesiated GaN, and hope to demonstrate higher values in the future. By using controlled internal fields and nano-structuring of the surfaces, we plan to provide field emission assistance for photoelectrons while maintaining their energy distinction from dark noise electrons. We will transfer these methods from GaN to ZnMgO, a new family of wide band-gap materials more compatible with microchannel plates. We also are exploring technical parameters such as doping profiles, internal and external field strengths, angle of incidence, field emission assistance, surface preparation, etc.

Nano-Ni induced surface modification relevant to the hydrogenation performances in La-Mg based alloys

NASA Astrophysics Data System (ADS)

Zhang, Huaiwei; Fu, Li; Xuan, Weidong; Li, Xingguo

2018-05-01

Nano-Ni drived modification in LaMg3/Ni composite is investigated. The new phases of LaMg2 and MgNi2 can be formed on the sample surface during the milling process. There is almost no electric charge transfer process between Ni and La element through XPS analyses. The amorphization structure can be found on the alloy surface with the increasing of reaction duration, and the capacity and cycle stability are also greatly promoted. On the other hand, the milled alloys show the lower charge transfer resistance, better anti-corrosion ability and higher oxidation current density.

High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer.

PubMed Central

Abele, U.; Schulz, G. E.

1995-01-01

The structure of adenylate kinase from yeast ligated with the two-substrate-mimicking inhibitor Ap5A and Mg2+ has been refined to 1.96 A resolution. In addition, the refined structure of the same complex with a bound imidazole molecule replacing Mg2+ has been determined at 1.63 A. These structures indicate that replacing Mg2+ by imidazole disturbs the water structure and thus the complex. A comparison with the G-proteins shows that Mg2+ is exactly at the same position with respect to the phosphates. However, although the Mg2+ ligand sphere of the G-proteins is a regular octahedron containing peptide ligands, the reported adenylate kinase has no such ligands and an open octahedron leaving space for the Mg2+ to accompany the transferred phosphoryl group. A superposition of the known crystalline and therefore perturbed phosphoryl transfer geometries in the adenylate kinases demonstrates that all of them are close to the start of the forward reaction with bound ATP and AMP. Averaging all observed perturbed structures gives rise to a close approximation of the transition state, indicating in general how to establish an elusive transition state geometry. The average shows that the in-line phosphoryl transfer is associative, because there is no space for a dissociative metaphosphate intermediate. As a side result, the secondary dipole interaction in the alpha-helices of both protein structures has been quantified. PMID:7670369

Accelerating anodic biofilms formation and electron transfer in microbial fuel cells: Role of anionic biosurfactants and mechanism.

PubMed

Zhang, Yunshu; Jiang, Junqiu; Zhao, Qingliang; Gao, YunZhi; Wang, Kun; Ding, Jing; Yu, Hang; Yao, Yue

2017-10-01

Anodic electron transfer is the predominant electricity generation process of MFCs. To accelerate anodic biofilms formation and electron transfer, 40mg/L, 80mg/L, and 120mg/L of rhamnolipid biosurfactants were added to the anolyte, resulting in an increased abiotic capacitance from 15.12F/m 2 (control) to 16.54F/m 2 , 18.00F/m 2 , and 19.39F/m 2 , respectively. Anodic biofilm formation was facilitated after dosing 40mg/L of rhamnolipids on the 7th day after inoculation, resulting in an increased anodic biofilm coverage from 0.43% to 42.51%, and an increased maximum power density from 6.92±1.18W/m 3 to 9.93±0.88W/m 3 . Furthermore, the adsorption of rhamnolipids on the anode caused the Frumkin effect, leading to a decrease of equilibrium potential from -0.43V to -0.56V, and an increase of exchange current density from 5.09×10 -3 A/m 2 to 8.72×10 -3 A/m 2 . However, electron transfer was blocked when the rhamnolipid concentration was further increased to 80mg/L, and 120mg/L. Analysis of the anodic bacterial communities revealed that rhamnolipids facilitated the enrichment of exoelectrogen, increasing the total proportion from 65% to 81%. Additionally, biosurfactants were found to have significant impacts on the composition of exoelectrogens. Copyright © 2017 Elsevier B.V. All rights reserved.

Oxygen ion transference number of doped lanthanum gallate

NASA Astrophysics Data System (ADS)

Wang, Shizhong; Wu, Lingli; Gao, Jie; He, Qiong; Liu, Meilin

The transference numbers for oxygen ion (t O) in several LaGaO 3-based materials are determined from oxygen concentration cells using the materials as the electrolyte, including La 0.8Sr 0.2Ga 0.8Mg 0.2O 3- δ (LSGM8282), La 0.8Sr 0.2Ga 0.8Mg 0.15Co 0.05O 3- δ (LSGMC5) and La 0.8Sr 0.2Ga 0.8Mg 0.115Co 0.085O 3- δ (LSGMC8.5). Analysis indicates that the accuracy in determination of oxygen ion transference number depends on the electrode polarization resistances of the concentration cell as well as the transport properties of the materials studied. For example, the ratio of open cell voltage to Nernst potential is a good approximation to the ionic transference number for LSGM8282. However, this approximation is no longer adequate for LSGMC5 and LSGMC8.5; the effect of electrode polarization resistances must be taken into consideration in estimation of the ionic transference numbers. In particular, the ionic transference number for LSGMC5 is as high as 0.99, suggesting that it is a promising electrolyte material for low-temperature solid-state electrochemical applications.

Phytoavailability, human risk assessment and transfer characteristics of cadmium and zinc contamination from urban gardens in Kano, Nigeria.

PubMed

Abdu, Nafiu; Agbenin, John O; Buerkert, Andreas

2011-12-01

Quantitative data about phytoavailability and transfer into consumed plant parts for heavy metals in intensively managed urban vegetable production areas of sub-Saharan Africa are scarce. We therefore studied the transfer of zinc (Zn) and cadmium (Cd) from soil to the root and subsequent translocation to edible portions of four vegetables in six urban gardens. While respective diethylenetriaminepentaacetic acid (DTPA)-available Zn and Cd concentrations ranged from 18 to 66 mg kg(-1) and from 0.19 to 0.35 mg kg(-1) , respectively, in soils, total Zn and Cd were 8.4-256 mg kg(-1) and 0.04-1.7 mg kg(-1) in shoot parts. Metal transfer factor (MTF) ratios were higher in Zn (0.2-0.9) than in Cd (0.1-0.6). Our data suggest that total Zn concentration in soil is a reliable indicator to assess its transfer from soil to crop in lettuce, carrot and parsley, while for Cd DTPA-extractable concentration may be used to estimate soil-crop transfer of Cd in amaranthus and carrot. Overall, Cd was more easily translocated to the aerial plant parts than Zn. Zinc and Cd accumulation by vegetables in our soils is mainly a metabolically controlled process. Such accumulation can contaminate the ecosystem but under our conditions intake and ingestion of these metals will likely have to occur over a prolonged period to experience health hazard. Copyright © 2011 Society of Chemical Industry.

Cobalt as chemical modifier to improve chromium sensitivity and minimize matrix effects in tungsten coil atomic emission spectrometry.

PubMed

Silva, Sidnei G; Donati, George L; Santos, Luana N; Jones, Bradley T; Nóbrega, Joaquim A

2013-05-30

Cobalt is used as chemical modifier to improve sensitivity and minimize matrix effects in Cr determinations by tungsten coil atomic emission spectrometry (WCAES). The atomizer is a tungsten filament extracted from microscope light bulbs. A solid-state power supply and a handheld CCD-based spectrometer are also used in the instrumental setup. In the presence of 1000 mg L(-1) Co, WCAES limit of detection for Cr (λ=425.4 nm) is calculated as 0.070 mg L(-1); a 10-fold improvement compared to determinations without Co modifier. The mechanism involved in such signal enhancement is similar to the one observed in ICP OES and ICP-MS determinations of As and Se in the presence of C. Cobalt increases the population of Cr(+) by charge transfer reactions. In a second step, Cr(+)/e(-) recombination takes place, which results in a larger population of excited-state Cr atoms. This alternative excitation route is energetically more efficient than heat transfer from atomizer and gas phase to analyte atoms. A linear dynamic range of 0.25-10 mg L(-1) and repeatability of 3.8% (RSD, n=10) for a 2.0 mg L(-1) Cr solution are obtained with this strategy. The modifier high concentration also contributes to improving accuracy due to a matrix-matching effect. The method was applied to a certified reference material of Dogfish Muscle (DORM-2) and no statistically significant difference was observed between determined and certified Cr values at a 95% confidence level. Spike experiments with bottled water samples resulted in recoveries between 93% and 112%. Copyright © 2013 Elsevier B.V. All rights reserved.

Comparison of a single dose of moxidectin and a five-day course of fenbendazole to reduce and suppress cyathostomin fecal egg counts in a herd of embryo transfer-recipient mares.

PubMed

Mason, Maren E; Voris, Nathan D; Ortis, Hunter A; Geeding, Amy A; Kaplan, Ray M

2014-10-15

To compare larvicidal regimens of fenbendazole and moxidectin for reduction and suppression of cyathostomin fecal egg counts (FEC) in a transient herd of embryo transfer-recipient mares. Randomized, complete block, clinical trial. 120 mares from 21 states, residing on 1 farm. An initial fecal sample was collected from each mare; mares with an FEC ≥ 200 eggs/g were assigned to treatment groups. Eighty-two horses received fenbendazole (10.0 mg/kg [4.5 mg/lb], PO, q 24 h for 5 days) or moxidectin (0.4 mg/kg [0.18 mg/lb], PO, once); FEC data were analyzed 14, 45, and 90 days after treatment. Mean FEC reduction was 99.9% for moxidectin-treated mares and 41.9% for fenbendazole-treated mares 14 days after treatment. By 45 days, mean FEC of fenbendazole-treated mares exceeded pretreatment counts; however, FECs of moxidectin-treated mares remained suppressed below pretreatment values for the duration of the 90-day study. Fecal egg counts were significantly different between groups at 14, 45, and 90 days after treatment. Failure of the 5-day regimen of fenbendazole to adequately reduce or suppress FEC suggested inadequate adulticidal and larvicidal effects. In contrast, a single dose of moxidectin effectively reduced and suppressed FEC for an extended period. Given the diverse geographic origins of study mares, these results are likely representative of cyathostomin-infected mares in much of the United States, confirming previous findings indicating that fenbendazole resistance in cyathostomins is widespread and that moxidectin remains an effective treatment for control of these important parasites.

Asymmetric angular dependence of spin-transfer torques in CoFe/Mg-B-O/CoFe magnetic tunnel junctions

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tang, Ling, E-mail: lingtang@zjut.edu.cn; Xu, Zhi-Jun, E-mail: xzj@zjut.edu.cn; Zuo, Xian-Jun

Using a first-principles noncollinear wave-function-matching method, we studied the spin-transfer torques (STTs) in CoFe/Mg-B-O/CoFe(001) magnetic tunnel junctions (MTJs), where three different types of B-doped MgO in the spacer are considered, including B atoms replacing Mg atoms (Mg{sub 3}BO{sub 4}), B atoms replacing O atoms (Mg{sub 4}BO{sub 3}), and B atoms occupying interstitial positions (Mg{sub 4}BO{sub 4}) in MgO. A strong asymmetric angular dependence of STT can be obtained both in ballistic CoFe/Mg{sub 3}BO{sub 4} and CoFe/Mg{sub 4}BO{sub 4} based MTJs, whereas a nearly symmetric STT curve is observed in the junctions based on CoFe/Mg{sub 4}BO{sub 3}. Furthermore, the asymmetry ofmore » the angular dependence of STT can be suppressed significantly by the disorder of B distribution. Such skewness of STTs in the CoFe/Mg-B-O/CoFe MTJs could be attributed to the interfacial resonance states induced by the B diffusion into MgO spacer.« less

Photoluminescence properties and energy transfer of color tunable MgZn₂(PO₄)₂:Ce³⁺,Tb³⁺ phosphors.

PubMed

Xu, Mengjiao; Wang, Luxiang; Jia, Dianzeng; Zhao, Hongyang

2015-11-21

A series of Ce(3+)/Tb(3+) co-doped MgZn2(PO4)2 phosphors have been synthesized by the co-precipitation method. Their structure, morphology, photoluminescence properties, decay lifetime, thermal stability and luminous efficiency were investigated. The possible energy transfer mechanism was proposed based on the experimental results and detailed luminescence spectra and decay curves of the phosphors. The critical distance between Ce(3+) and Tb(3+) ions was calculated by both the concentration quenching method and the spectral overlap method. The energy transfer mechanism from the Ce(3+) to Tb(3+) ion was determined to be dipole-quadrupole interaction, and the energy transfer efficiency was 85%. By utilizing the principle of energy transfer and appropriate tuning of Ce(3+)/Tb(3+) contents, the emission color of the obtained phosphors can be tuned from blue to green light. The MgZn2(PO4)2:Ce(3+),Tb(3+) phosphor is proved to be a promising UV-convertible material capable of green light emitting in UV-LEDs due to its excellent thermal stability and luminescence properties.

Distribution and bioconcentration of heavy metals in a tropical aquatic food web: A case study of a tropical estuarine lagoon in SE Mexico.

PubMed

Mendoza-Carranza, Manuel; Sepúlveda-Lozada, Alejandra; Dias-Ferreira, Celia; Geissen, Violette

2016-03-01

Despite the increasing impact of heavy metal pollution in southern Mexico due to urban growth and agricultural and petroleum activities, few studies have focused on the behavior and relationships of these pollutants in the biotic and abiotic components of aquatic environments. Here, we studied the bioaccumulation of heavy metals (Cd, Cr, Ni, Pb, V, Zn) in suspended load, sediment, primary producers, mollusks, crustaceans, and fish, in a deltaic lagoon habitat in the Tabasco coast, with the aim to assess the potential ecological risk in that important wetland. Zn showed the highest concentrations, e.g., in suspended load (mean of 159.58 mg kg(-1)) and aquatic consumers (15.43-171.71 mg kg(-1)), particularly Brachyura larvae and ichthyoplankton (112.22-171.71 mg kg(-1)), followed by omnivore Callinectes sp. crabs (113.81-128.07 mg kg(-1)). The highest bioconcentration factors (BCF) of Zn were observed for planktivore and omnivore crustaceans (3.06-3.08). Zn showed a pattern of distribution in the food web through two pathways: the pelagic (where the higher concentrations were found), and the benthic (marsh plants, sediment, mollusk, fish). The other heavy metals had lower occurrences in the food web. Nevertheless, high concentrations of Ni and Cr were found in phytoplankton and sediment (37.62-119.97 mg kg(-1)), and V in epiphytes (68.64 mg kg(-1)). Ni, Cr, and Cd concentrations in sediments surpassed international and national threshold values, and Cd entailed a "considerable" potential risk. These heavy metals are most likely transferred into the food web up to fishes through the benthic pathway. Most of the collected fishes are residents in this type of habitat and have commercial importance. Our results show that the total potential ecological risk in the area can be considered as "moderate". Nevertheless, heavy metal values were similar or surpassed the values from other highly industrialized tropical coastal regions. Copyright © 2015 Elsevier Ltd. All rights reserved.

Failure of colostral immunoglobulin transfer as an explanation for most infections and deaths of neonatal foals.

PubMed

McGuire, T C; Crawford, T B; Hallowell, A L; Macomber, L E

1977-06-01

Failure in colostral immunoglobulin G (IgG) transfer was found in 9 of 87 Thoroughbred foals. Seven (78%) of these 9 foals acquired infections requiring therapy. Twelve of the foals had partial failure in colostral IgG transfer, and 3 of these had infections requiring therapy. The remaining 66 foals had normal transfer of colostral IgG, and only 2 had detectable infections. The failure of colostral IgG transfer was attributable to nursing problems in only one case. When presuckle postpartum colostrum was collected, 2 of 4 failures of colostral IgG transfer and 4 of 6 partial failures of colostral IgG transfer were explained by low colostral IgG content. Of 11 foals from various other sources and dying of infection before 2 weeks of age, 6 had failure of colostral IgG transfer (less than 200 mg IgG/100 ml serum), and 4 had partial failure (200-400 mg IgG/100 ml serum).

Biophysicochemical evaluation of wild hilly biotypes of Jatropha curcas for biodiesel production and micropropagation study of elite plant parts.

PubMed

Verma, K C; Verma, S K

2015-01-01

Depleting reserves of fossil fuel and increasing effects of environmental pollution from petrochemicals demands eco-friendly alternative fuel sources. Jatropha curcas oil, an inedible vegetable oil, can be a substitute feedstock for traditional food crops in the production of environment-friendly and renewable fuel. Jatropha oil is looked up in terms of availability and cost and also has several applications and enormous economic benefits. The seed oils of various jatropha biotypes from hilly regions were screened out and evaluated for their physiochemical parameters, viz, seed index(520-600 g), oil content (15-42 %), biodiesel yield (71-98 %), moisture content (2.3-6.5 %), ash content (3.2-5.6 %), acid value (4.2-26), density (0.9172-0.9317 g/cm(3)), viscosity (5-37 mm(2)/s), saponification value (195.8-204.2 mg/g), iodine value (106.6-113.6 mg/g), flash point (162-235 °C), cetane value (46.70-50.06 °C), free fatty acid value (2.5-10.2 %), and refractive index (1.4600-1.4710). Fatty acid profiling of jatropha resembles as edible oilseeds. NAA with BAP was found to be superior for callus induction (up to 87 %), as well as for shoot regeneration (up to12 shoots). Root induction (90-100 %) was successfully obtained in MS medium with or without phytoregulators. Grown plantlets were successfully transferred from lab to field with a survival rate of 80 %.

Carbon dioxide stripping in aquaculture -- part II: development of gas transfer models

USGS Publications Warehouse

Colt, John; Watten, Barnaby; Pfeiffer, Tim

2012-01-01

The basic mass transfer equation for gases such as oxygen and carbon dioxide can be derived from integration of the driving force equation. Because of the physical characteristics of the gas transfer processes, slightly different models are used for aerators tested under the non steady-state procedures, than for packed columns, or weirs. It is suggested that the standard condition for carbon dioxide should be 20 °C, 1 atm, CCO2=20 mg/kg, and XCO2=0.000285. The selection of the standard condition for carbon dioxide based on a fixed mole fraction ensures that standardized carbon dioxide transfer rates will be comparable even though the value of C*CO2 in the atmosphere is increasing with time. The computation of mass transfer for carbon dioxide is complicated by the impact of water depth and gas phase enrichment on the saturation concentration within the unit, although the importance of either factor depends strongly on the specific type of aerator. For some types of aerators, the most accurate gas phase model remains to be determined for carbon dioxide. The assumption that carbon dioxide can be treated as a non-reactive gas in packed columns may apply for cold acidic waters but not for warm alkaline waters.

Effect of drug Piper nigrum on magnesium chloride at varying concentration and temperature through ultrasonic method: A thermoacoustic study

NASA Astrophysics Data System (ADS)

Nalle, Pallavi B.; Deshmukh, S. S.; Dorik, R. G.; Jadhav, K. M.

2016-12-01

The ultrasonic velocity (U), density (ρ), and viscosity (η) of an ethanolic extract of drug Piper nigrum with MgCl2 (metal ions) have been measured as a function of the number of moles n = (0.7009, 1.4018, 2.1027, 2.8036 and 3.5045) at 303.15, 308.15, 313.15 and 318.15 K temperature. Various thermoacoustic and their excess values such as adiabatic compressibilities (β), intermolecular free lengths (Lf), excess adiabatic compressibility (βE), excess intermolecular free length (?) have been computed using values of ultrasonic velocity (U), density (ρ), and viscosity (η). The excess values of ultrasonic velocity, specific acoustic impedance are positive, whereas isentropic compressibility and intermolecular free lengths are negative over the entire composition range of MgCl2 + P. nigrum which indicates the presence of specific interactions between unlike molecules. Molecular association is reflected by ultrasonic investigation. This may be interpreted due to the of complex formation. The chemical interaction may involve the association due to the solute-solvent and ion-solvent interaction and due to the formation of charge-transfer complexes, which is useful to understand the mechanism of their metabolism in living systems. The results obtained from these studies are helpful for pharmacological applications of drugs, transport of drugs across biological membranes.

Chemical elements in pearl oysters (Paxyodon ponderosus), phytoplankton and estuarine sediments from eastern Amazon (Northern Brazil): Bioaccumulation factors and trophic transfer factors

NASA Astrophysics Data System (ADS)

Vilhena, Maria P. S. P.; Costa, Marcondes L.; Berrêdo, José F.; Paiva, Rosildo S.; Souza, Crisvaldo C. S.

2016-04-01

The current study was conducted near Barcarena County, which is a mid-sized urban center where aluminum ore processing industries (bauxite) and Vila do Conde cargo terminal are located. It aims to discuss the bioaccumulation factors as well as factors related to the trophic transfer of chemical elements in water, oyster, phytoplankton and bottom sediments from an estuary in the Brazilian Northern coast. The bioaccumulation factor (BAF), trophic transfer factor (TTF) and biota-sediment-water were used to correlate the contents of chemical elements found in organisms. The sediment, surface water, phytoplankton and pearl oysters chemical composition was analyzed by ICP-OES and ICP-MS. Pearl oysters showed K, Ca, Mg, P, Mn, Fe, Zn, Al, Ba and Pb accumulation, which concentration increase is associated with their diet (phytoplankton). Al concentrations are 14 times higher in pearl oysters (Paxyodon ponderosus), assuming that they are associated with wastewater emissions and with industrialization processes in the area. BAF and BSAF values are 1000 times higher than the metal concentrations in water and bioavailable fraction concentrations. The oyster-phytoplankton trophic transfer factor indicates that P, Ba, Ca, Na, Cd and Zn showed the largest transfers (from 5 to 19). These trophic transfers may be sufficient to cause significant ecotoxicological effects on the region biota.

Heat Transfer Analysis of an Optimized, Flexible Holder System for Freeze-Drying in Dual Chamber Cartridges Using Different State-of-the-Art PAT Tools.

PubMed

Korpus, Christoph; Pikal, Michael; Friess, Wolfgang

2016-11-01

The aim of this study was to determine the heat transfer characteristics of an optimized flexible holder device, using Tunable Diode Laser Absorption Spectroscopy, the Pressure Rise Test, and the gravimetric procedure. Two different controlled nucleation methods were tested, and an improved sublimation process, "preheated plate," was developed. Tunable Diode Laser Absorption Spectroscopy identified an initial sublimation burst phase. Accordingly, steady-state equations were adapted for the gravimetric procedure, to account for this initial non-steady-state period. The heat transfer coefficient, K DCC , describing the transfer from the holder to the DCC, was the only heat transfer coefficient showing a clear pressure dependence with values ranging from 3.81E-04 cal/(g·cm 2 ·K) at 40 mTorr to 7.38E-04 cal/(g·cm 2 ·K) at 200 mTorr. The heat transfer coefficient, K tot , reflecting the overall energy transfer via the holder, increased by around 24% from 40 to 200 mTorr. This resulted in a pressure-independent sublimation rate of around 42 ± 1.06 mg/h over the whole pressure range. Hence, this pressure-dependent increase in energy transfer completely compensated the decrease in driving force of sublimation. The "flexible holder" shows a substantially reduced impact of atypical radiation, improved drying homogeneity, and ultimately a better transferability of the freeze-drying cycle for process optimization. Copyright © 2016 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.

Protein kinase A catalytic subunit primed for action: Time-lapse crystallography of Michaelis complex formation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Das, Amit; Gerlits, Oksana O.; Parks, Jerry M.

The catalytic subunit of the cyclic AMP-dependent protein kinase A (PKAc) catalyzes the transfer of the γ-phosphate of bound Mg 2ATP to a serine or threonine residue of a protein substrate. Here, time-lapse X-ray crystallography was used to capture a series of complexes of PKAc with an oligopeptide substrate and unreacted Mg 2ATP, including the Michaelis complex, that reveal important geometric rearrangements in and near the active site preceding the phosphoryl transfer reaction. Contrary to the prevailing view, Mg 2+ binds first to the M1 site as a complex with ATP and is followed by Mg 2+ binding to themore » M2 site. Furthermore, the target serine hydroxyl of the peptide substrate rotates away from the active site toward the bulk solvent, which breaks the hydrogen bond with D166. In conclusion, the serine hydroxyl of the substrate rotates back toward D166 to form the Michaelis complex with the active site primed for phosphoryl transfer.« less

Protein kinase A catalytic subunit primed for action: Time-lapse crystallography of Michaelis complex formation

DOE PAGES

Das, Amit; Gerlits, Oksana O.; Parks, Jerry M.; ...

2015-11-12

The catalytic subunit of the cyclic AMP-dependent protein kinase A (PKAc) catalyzes the transfer of the γ-phosphate of bound Mg 2ATP to a serine or threonine residue of a protein substrate. Here, time-lapse X-ray crystallography was used to capture a series of complexes of PKAc with an oligopeptide substrate and unreacted Mg 2ATP, including the Michaelis complex, that reveal important geometric rearrangements in and near the active site preceding the phosphoryl transfer reaction. Contrary to the prevailing view, Mg 2+ binds first to the M1 site as a complex with ATP and is followed by Mg 2+ binding to themore » M2 site. Furthermore, the target serine hydroxyl of the peptide substrate rotates away from the active site toward the bulk solvent, which breaks the hydrogen bond with D166. In conclusion, the serine hydroxyl of the substrate rotates back toward D166 to form the Michaelis complex with the active site primed for phosphoryl transfer.« less

High - Resolution SST Record Based on Mg/Ca Ratios of Late Holocene Planktonic Foraminifers From the Great Bahama Bank

NASA Astrophysics Data System (ADS)

Mueller, A.; Reijmer, J. J.; Roth, S.

2001-12-01

We analyzed five different planktic foraminifera species in the high resolution core MD 992201 off the Great Bahama Bank (79° 16.34 W; 25° 53.49 N) in 290 m water depth. This 38.05 m long core comprises a 7,000 year long Holocene record. The selected species were Orbulina universa, Globigerinoides ruber, Globigerinoides sacculifer, Globorotalia menardii and Globigerinella aequilateralis, which live in the upper 200 m of the water column. The Mg/Ca ratios of these different foraminifers show species-specific values, which represent a distinct habitat depth. With this species-specific Mg/Ca ratios we can reconstruct a temperature profile through the water column. The lowest Mg/Ca are shown by G. menardii (2.5 - 4 mmol/mol), followed by G. sacculifer (4.2 - 5.6 mmol/mol), G. ruber (5.1 - 7.2 mmol/mol) and G. aequilateralis (5.5 - 8.7 mmol/mol). Highest are shown by O. universa (6 - 14 mmol/mol). During the Little Ice Age, the Mg/Ca ratios of all species except for the deeper dwelling G. menardii, became more variable and showed lower ratios. The shallow dwelling species like G. ruber and G. sacculifer display an increase in the Mg/Ca ratios during the Medieval Warm Period. Our data show that transferring Mg/Ca ratios into SST based calibration curves known from literature needs re-evaluation. Species-specific calibration seems to be necessary to achieve reliable results.

Bioaccumulation of Multiwall Carbon Nanotubes in Tetrahymena thermophila by Direct Feeding or Trophic Transfer

DOE PAGES

Mortimer, Monika; Petersen, Elijah J.; Buchholz, Bruce A.; ...

2016-07-11

We report that consumer goods contain multiwall carbon nanotubes (MWCNTs) that could be released during product life cycles into the environment, where their effects are uncertain. Here, we assessed MWCNT bioaccumulation in the protozoan Tetrahymena thermophila via trophic transfer from bacterial prey (Pseudomonas aeruginosa) versus direct uptake from growth media. The experiments were conducted using 14C-labeled MWCNT ( 14C-MWCNT) doses at or below 1 mg/L, which proved subtoxic since there were no adverse effects on the growth of the test organisms. A novel contribution of this study was the demonstration of the ability to quantify MWCNT bioaccumulation at low (submore » μg/kg) concentrations accomplished by employing accelerator mass spectrometry (AMS). After the treatments with MWCNTs at nominal concentrations of 0.01 mg/L and 1 mg/L, P. aeruginosa adsorbed considerable amounts of MWCNTs: (0.18 ± 0.04) μg/mg and (21.9 ± 4.2) μg/mg bacterial dry mass, respectively. At the administered MWCNT dose of 0.3 mg/L, T. thermophila accumulated up to (0.86 ± 0.3) μg/mg and (3.4 ± 1.1) μg/mg dry mass by trophic transfer and direct uptake, respectively.Finally, aAlthough MWCNTs did not biomagnify in the microbial food chain, MWCNTs bioaccumulated in the protozoan populations regardless of the feeding regime, which could make MWCNTs bioavailable for organisms at higher trophic levels.« less

Adaptation and adaptation transfer characteristics of five different saccade types in the monkey

PubMed Central

Fuchs, Albert F.; Soetedjo, Robijanto

2015-01-01

Shifts in the direction of gaze are accomplished by different kinds of saccades, which are elicited under different circumstances. Saccade types include targeting saccades to simple jumping targets, delayed saccades to visible targets after a waiting period, memory-guided (MG) saccades to remembered target locations, scanning saccades to stationary target arrays, and express saccades after very short latencies. Studies of human cases and neurophysiological experiments in monkeys suggest that separate pathways, which converge on a common locus that provides the motor command, generate these different types of saccade. When behavioral manipulations in humans cause targeting saccades to have persistent dysmetrias as might occur naturally from growth, aging, and injury, they gradually adapt to reduce the dysmetria. Although results differ slightly between laboratories, this adaptation generalizes or transfers to all the other saccade types mentioned above. Also, when one of the other types of saccade undergoes adaptation, it often transfers to another saccade type. Similar adaptation and transfer experiments, which allow inferences to be drawn about the site(s) of adaptation for different saccade types, have yet to be done in monkeys. Here we show that simian targeting and MG saccades adapt more than express, scanning, and delayed saccades. Adaptation of targeting saccades transfers to all the other saccade types. However, the adaptation of MG saccades transfers only to delayed saccades. These data suggest that adaptation of simian targeting saccades occurs on the pathway common to all saccade types. In contrast, only the delayed saccade command passes through the adaptation site of the MG saccade. PMID:25855693

Tracing subduction zone fluid-rock interactions using trace element and Mg-Sr-Nd isotopes

NASA Astrophysics Data System (ADS)

Wang, Shui-Jiong; Teng, Fang-Zhen; Li, Shu-Guang; Zhang, Li-Fei; Du, Jin-Xue; He, Yong-Sheng; Niu, Yaoling

2017-10-01

Slab-derived fluids play a key role in mass transfer and elemental/isotopic exchanges in subduction zones. The exhumation of deeply subducted crust is achieved via a subduction channel where fluids from various sources are abundant, and thus the chemical/isotopic compositions of these rocks could have been modified by subduction-zone fluid-rock interactions. Here, we investigate the Mg isotopic systematics of eclogites from southwestern Tianshan, in conjunction with major/trace element and Sr-Nd isotopes, to characterize the source and nature of fluids and to decipher how fluid-rock interactions in subduction channel might influence the Mg isotopic systematics of exhumed eclogites. The eclogites have high LILEs (especially Ba) and Pb, high initial 87Sr/86Sr (up to 0.7117; higher than that of coeval seawater), and varying Ni and Co (mostly lower than those of oceanic basalts), suggesting that these eclogites have interacted with metamorphic fluids mainly released from subducted sediments, with minor contributions from altered oceanic crust or altered abyssal peridotites. The positive correlation between 87Sr/86Sr and Pb* (an index of Pb enrichment; Pb* = 2*PbN/[CeN + PrN]), and the decoupling relationships and bidirectional patterns in 87Sr/86Sr-Rb/Sr, Pb*-Rb/Sr and Pb*-Ba/Pb spaces imply the presence of two compositionally different components for the fluids: one enriched in LILEs, and the other enriched in Pb and 87Sr/86Sr. The systematically heavier Mg isotopic compositions (δ26Mg = - 0.37 to + 0.26) relative to oceanic basalts (- 0.25 ± 0.07) and the roughly negative correlation of δ26Mg with MgO for the southwestern Tianshan eclogites, cannot be explained by inheritance of Mg isotopic signatures from ancient seafloor alteration or prograde metamorphism. Instead, the signatures are most likely produced by fluid-rock interactions during the exhumation of eclogites. The high Rb/Sr and Ba/Pb but low Pb* eclogites generally have high bulk-rock δ26Mg values, whereas high Pb* and 87Sr/86Sr eclogites have mantle-like δ26Mg values, suggesting that the two fluid components have diverse influences on the Mg isotopic systematics of these eclogites. The LILE-rich fluid component, possibly derived from mica-group minerals, contains a considerable amount of isotopically heavy Mg that has shifted the δ26Mg of the eclogites towards higher values. By contrast, the 87Sr/86Sr- and Pb-rich fluid component, most likely released from epidote-group minerals in metasediments, has little Mg so as not to modify the Mg isotopic composition of the eclogites. In addition, the influence of talc-derived fluid might be evident in a very few eclogites that have low Rb/Sr and Ba/Pb but slightly heavier Mg isotopic compositions. These findings represent an important step toward a broad understanding of the Mg isotope geochemistry in subduction zones, and contributing to understanding why island arc basalts have averagely heavier Mg isotopic compositions than the normal mantle.

Black carbon radiative forcing derived from AERONET measurements and models over an urban location in the southeastern Iberian Peninsula

NASA Astrophysics Data System (ADS)

Valenzuela, A.; Arola, A.; Antón, M.; Quirantes, A.; Alados-Arboledas, L.

2017-07-01

This paper provides an account of observed variations in Black carbon (BC) aerosol concentrations and their induced radiative forcing for the first time over Granada a measurement site in Southeastern Iberian Peninsula. Column-integrated BC concentrations were retrieved for the period 2005-2012. Monthly averages of BC concentrations (± one standard deviation) ranged from higher values in January and December with 4.0 ± 2.5 and 4 ± 3 mg/m2, respectively, to lower values in July and August with 1.6 ± 1.2 and 2.0 ± 0.5 mg/m2, respectively. This reduction is not only observed in the average values, but also in the median, third and first quartiles. The average BC concentration in winter (3.8 ± 0.6 mg/m2) was substantially higher than in summer (1.9 ± 0.3 mg/m2), being the eight-year average of 2.9 ± 0.9 mg/m2. The reduction in the use of fossil fuels during the economic crisis contributed significantly to reduced atmospheric loadings of BC. According to our analysis this situation persisted until 2010. BC concentration values were analyzed in terms of air mass influence using cluster analysis. BC concentrations for cluster 1 (local and regional areas) showed high correlations with air masses frequency in winter and autumn. In these seasons BC sources were related to the intense road traffic and increased BC emissions from domestic heating. High BC concentrations were found in autumn just when air mass frequencies for cluster 3 (Mediterranean region) were more elevated, suggesting that air masses coming from that area transport biomass burning particles towards Granada. BC aerosol optical properties were retrieved from BC fraction using aerosol AERONET size volume distribution and Mie theory. A radiative transfer model (SBDART) was used to estimate the aerosol radiative forcing separately for composite aerosol (total aerosols) and exclusively for BC aerosols. The mean radiative forcing for composite aerosol was + 23 ± 6 W/m2 (heating rate of + 0.21 ± 0.06 K/day) and + 15 ± 6 W/m2 for BC aerosol (heating rate of + 0.15 ± 0.06 K/day). These values of radiative forcing and heating rate for BC aerosol represent about 70% of their values for composite aerosol, which highlights the crucial role that BC aerosols play in modifying the radiation budget and climate.

Effect of aqueous fruit extract of Xylopia aethiopica on intestinal fluid and glucose transfer in rats.

PubMed

Okwari, O O; Nneli, R O; Osim, E E

2010-11-28

Intestinal fluid and glucose absorption was studied in jejunal and ileal segments in Xylopia aethiopica fed rats using inverted sac technique. Thirty male Wistar rats were assigned into three groups of 10 rats each; control, 100mg/kg and 200mg/kg Xylopia aethiopica treated groups. The control group received normal rat chow and water while the low dose and high dose groups received oral administration of Xylopia aethiopica extract at doses of 100mg/kg and 200mg/kg body weight respectively in addition to daily rat chow and water intake for 28 days. The results showed significant reduction and increase in fluid transfer in the jejunum and ileum respectively compared with control. 100mg/kg increased gut fluid uptake in the ileum while 200mg/kg treatment reduced uptake in jejunum compared with control. Both doses had significantly increased jejunal and ileal glucose transfer. Gut glucose uptake was increased in jejunum and ileum of Xylopia aethiopica treated groups. Both doses increased the crypt depth but significantly decreased the villus height in the ileum. In conclusion, increased ileal gut fluid uptake may be beneficial in diarrheal state while an enhanced glucose uptake implies that glucose substrate may be made available to cells for synthesize of ATP for cellular activities.

Kinetic Mechanism and Rate-Limiting Steps of Focal Adhesion Kinase-1

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schneck, Jessica L.; Briand, Jacques; Chen, Stephanie

2010-12-07

Steady-state kinetic analysis of focal adhesion kinase-1 (FAK1) was performed using radiometric measurement of phosphorylation of a synthetic peptide substrate (Ac-RRRRRRSETDDYAEIID-NH{sub 2}, FAK-tide) which corresponds to the sequence of an autophosphorylation site in FAK1. Initial velocity studies were consistent with a sequential kinetic mechanism, for which apparent kinetic values k{sub cat} (0.052 {+-} 0.001 s{sup -1}), K{sub MgATP} (1.2 {+-} 0.1 {micro}M), K{sub iMgATP} (1.3 {+-} 0.2 {micro}M), K{sub FAK-tide} (5.6 {+-} 0.4 {micro}M), and K{sub iFAK-tide} (6.1 {+-} 1.1 {micro}M) were obtained. Product and dead-end inhibition data indicated that enzymatic phosphorylation of FAK-tide by FAK1 was best described bymore » a random bi bi kinetic mechanism, for which both E-MgADP-FAK-tide and E-MgATP-P-FAK-tide dead-end complexes form. FAK1 catalyzed the {beta}{gamma}-bridge:{beta}-nonbridge positional oxygen exchange of [{gamma}-{sup 18}O{sub 4}]ATP in the presence of 1 mM [{gamma}-{sup 18}O{sub 4}]ATP and 1.5 mM FAK-tide with a progressive time course which was commensurate with catalysis, resulting in a rate of exchange to catalysis of k{sub x}/k{sub cat} = 0.14 {+-} 0.01. These results indicate that phosphoryl transfer is reversible and that a slow kinetic step follows formation of the E-MgADP-P-FAK-tide complex. Further kinetic studies performed in the presence of the microscopic viscosogen sucrose revealed that solvent viscosity had no effect on k{sub cat}/K{sub FAK-tide}, while k{sub cat} and k{sub cat}/K{sub MgATP} were both decreased linearly at increasing solvent viscosity. Crystallographic characterization of inactive versus AMP-PNP-liganded structures of FAK1 showed that a large conformational motion of the activation loop upon ATP binding may be an essential step during catalysis and would explain the viscosity effect observed on k{sub cat}/K{sub m} for MgATP but not on k{sub cat}/K{sub m} for FAK-tide. From the positional isotope exchange, viscosity, and structural data it may be concluded that enzyme turnover (k{sub cat}) is rate-limited by both reversible phosphoryl group transfer (k{sub forward} {approx} 0.2 s{sup -1} and k{sub reverse} {approx} 0.04 s{sup -1}) and a slow step (k{sub conf} {approx} 0.1 s{sup -1}) which is probably the opening of the activation loop after phosphoryl group transfer but preceding product release.« less

Some mineral stability relations in the system CaOMgOSiO2H2OHCl

USGS Publications Warehouse

Luce, R.W.; Cygan, G.L.; Hemley, J.J.; d'Angelo, W. M.

1985-01-01

Mineral-aqueous solution equilibria for the assemblages talc-quartz, tremolite-talc-quartz, diopside-tremolite-quartz, wollastonite-diopside-quartz and wollastonite-quartz have been studied at 2 kb total pressure, 500?? to 700??C and chloride concentrations from 0.03 to 6.0 molal. Most work was at 1 m chloride. Both buffered and unbuffered data were obtained and a recalibration of the Ag-AgCl buffer is presented. Log equilibrium quotients at 500??, 600?? and 700??C are respectively: Ta-Qz ( mMgCl2 mHCl2) 2.57, 1.71, 0.73; Tr-Ta-Qz and Di-Tr-Qz ( mCaCl2 mMgCl2mHCl2) 4.98, 3.99, 2.21 and 7.29, 5.30, 3.56; WoDi-Qz ( mCaCl2 mMgCl2) 3.30, 3.00, 2.79: Wo-Qz ( mCaCl2 mHCl2) 5.15, 3.95, 2.68. Mineral stability fields plotted in terms of these concentration data more tangibly represent the compositional character of real systems and the mass transfer capabilities of their fluids than do the analogous theoretical activity diagrams. Overall dissociation constants of MgCl2 and CaCl2 were calculated from the experimental data using the calculated ionic activity constants for the reactions and the established dissociation constants of HCl. The negative log values are respectively: 3.88. 6.63, 9.20 for CaCl2 and 4.60, 7.54, 10.37 for MgCl2 at 500??, 600?? and 700??C, 2 kb. The Ca values are about an order of magnitude more positive than the conductance-derived values by Frantz and Marshall (1982). The phase relations developed in this study have application to the genesis of talc, tremolite, and diopside-bearing assemblages in some regional metamorphic rocks, but more specifically to the calcsilicate skarn assemblages of many metasomatic aureoles. The equilibrium fluids are characterized by high concentrations of Ca relative to Mg and increasing Ca Mg ratios with decreasing temperatures. The stability fields of talc, tremolite, and quartz expand relative to those of diopside and wollastonite with decreasing temperature, hence their more common appearance as retrograde products in skarn systems. ?? 1985.

Optical properties of 3d transition-metal-doped MgAl2O4 spinels

NASA Astrophysics Data System (ADS)

Izumi, K.; Miyazaki, S.; Yoshida, S.; Mizokawa, T.; Hanamura, E.

2007-08-01

Strong emission bands in the visible region are observed in MgAl2O4 crystals doped with transition-metal ions under excitation at the band-to-band transitions. We report optical responses of Cr-, Co-, and Ni-doped MgAl2O4 and present optical models for M -doped MgAl2O4 ( M=Ti , V, Cr, Mn, Co, and Ni) to describe the charge-transfer transitions and the transitions between multiplet levels of 3d electrons, which are observed competitively or coexisting, depending on the number of 3d electrons. While the optical responses of Cr- and Ni-doped MgAl2O4 are dominated by the multiplet-multiplet transitions, those of Ti- and V-doped MgAl2O4 are governed by the charge-transfer transitions. The two kinds of transitions coexist in the Mn- and Co-doped MgAl2O4 . These behaviors are well understood based on the numerical results of unrestricted Hartree-Fock approximation.

Utilization of municipal wastewater for cooling in thermoelectric power plants

DOE Office of Scientific and Technical Information (OSTI.GOV)

Safari, Iman; Walker, Michael E.; Hsieh, Ming-Kai

2013-09-01

A process simulation model has been developed using Aspen Plus® with the OLI (OLI System, Inc.) water chemistry model to predict water quality in the recirculating cooling loop utilizing secondary- and tertiary-treated municipal wastewater as the source of makeup water. Simulation results were compared with pilot-scale experimental data on makeup water alkalinity, loop pH, and ammonia evaporation. The effects of various parameters including makeup water quality, salt formation, NH 3 and CO 2 evaporation mass transfer coefficients, heat load, and operating temperatures were investigated. The results indicate that, although the simulation model can capture the general trends in the loopmore » pH, experimental data on the rates of salt precipitation in the system are needed for more accurate prediction of the loop pH. It was also found that stripping of ammonia and carbon dioxide in the cooling tower can influence the cooling loop pH significantly. The effects of the NH 3 mass transfer coefficient on cooling loop pH appear to be more significant at lower values (e.g., k NH3 < 4×10 -3 m/s) when the makeup water alkalinity is low (e.g., <90 mg/L as CaCO 3). The effect of the CO2 mass transfer coefficient was found to be significant only at lower alkalinity values (e.g., k CO2<4×10 -6 m/s).« less

Assessment of metals bioavailability to vegetables under field conditions using DGT, single extractions and multivariate statistics

PubMed Central

2012-01-01

Background The metals bioavailability in soils is commonly assessed by chemical extractions; however a generally accepted method is not yet established. In this study, the effectiveness of Diffusive Gradients in Thin-films (DGT) technique and single extractions in the assessment of metals bioaccumulation in vegetables, and the influence of soil parameters on phytoavailability were evaluated using multivariate statistics. Soil and plants grown in vegetable gardens from mining-affected rural areas, NW Romania, were collected and analysed. Results Pseudo-total metal content of Cu, Zn and Cd in soil ranged between 17.3-146 mg kg-1, 141–833 mg kg-1 and 0.15-2.05 mg kg-1, respectively, showing enriched contents of these elements. High degrees of metals extractability in 1M HCl and even in 1M NH4Cl were observed. Despite the relatively high total metal concentrations in soil, those found in vegetables were comparable to values typically reported for agricultural crops, probably due to the low concentrations of metals in soil solution (Csoln) and low effective concentrations (CE), assessed by DGT technique. Among the analysed vegetables, the highest metal concentrations were found in carrots roots. By applying multivariate statistics, it was found that CE, Csoln and extraction in 1M NH4Cl, were better predictors for metals bioavailability than the acid extractions applied in this study. Copper transfer to vegetables was strongly influenced by soil organic carbon (OC) and cation exchange capacity (CEC), while pH had a higher influence on Cd transfer from soil to plants. Conclusions The results showed that DGT can be used for general evaluation of the risks associated to soil contamination with Cu, Zn and Cd in field conditions. Although quantitative information on metals transfer from soil to vegetables was not observed. PMID:23079133

A simple transferable adaptive potential to study phase separation in large-scale xMgO-(1-x)SiO2 binary glasses.

PubMed

Bidault, Xavier; Chaussedent, Stéphane; Blanc, Wilfried

2015-10-21

A simple transferable adaptive model is developed and it allows for the first time to simulate by molecular dynamics the separation of large phases in the MgO-SiO2 binary system, as experimentally observed and as predicted by the phase diagram, meaning that separated phases have various compositions. This is a real improvement over fixed-charge models, which are often limited to an interpretation involving the formation of pure clusters, or involving the modified random network model. Our adaptive model, efficient to reproduce known crystalline and glassy structures, allows us to track the formation of large amorphous Mg-rich Si-poor nanoparticles in an Mg-poor Si-rich matrix from a 0.1MgO-0.9SiO2 melt.

Long-term Records of Trace Metal Elements in Core Sediments: Anthropogenic Impacts in The Eure River Watershed

NASA Astrophysics Data System (ADS)

Gardes, T.; Debret, M.; Copard, Y.; Patault, E.; Deloffre, J.; Marcotte, S.; Develle, A. L.; Sabatier, P.; Chaumillon, E.; Coulombier, T.; Revillon, S.; Nizou, J.; Laberdesque, Y.; Koltalo, F.

2017-12-01

The Martot Dam is located in the Eure River Watershed (Normandy, France), few hundred meters upstream the Eure-Seine Rivers confluence. In the context of the European Water Framework Directive (2000/60/EC), the French Authorities planned to remove this dam in 2017. Nevertheless, impacts of the removal remain poorly studied. Classically, dam blocked sedimentary transfers downstream, but here, sediments are not blocked behind the dam but stored three hundred meters upstream in a hydraulic annex, called the Martot Pond. Furthermore, this pond is submitted to the tidal flow from the Seine Estuary despite the Martot Dam. The aim of the study is to evaluate the dam removal impacts on sedimentary transfers and re-suspension of contaminated sediments stored in the Martot Pond and the Eure River's channel. Concerning past transfers and sediments accumulation in the Eure River Watershed, sedimentary archives have been cored, before dam removal, at the Martot Pond and the Les Damps Pond (located 10km upstream the latter). Dating of sedimentary cores for both ponds indicates a sedimentation rate around 1 cm y-1. Trace metal elements quantification showed a wide metallic contamination with highest concentrations evidenced during the 1950-1960's (As: 13-22 mg kg-1; Cd: 40-55 mg kg-1; Cr: 170-210 mg kg-1; Cu: 400-490 mg kg-1; Hg: 2.3 mg kg-1; Mn: 1,280-2,200 mg kg-1; Ni: 64-75 mg kg-1; Zn: 905-990 mg kg-1) and the 1990-2000's (Cr: 95-215 mg kg-1; Ni: 100 mg kg-1; Pb: 670-855 mg kg-1). These variations of concentrations along cores can be associated with industrial past of the Eure River Watershed and sources of contamination can be identified. Thereby, Zn, Ni or Hg contamination could be associated with wastes of battery factory released in the Eure River during the economic recovery, while Pb contamination is linked to the activities of a cathode-ray tubes factory. Metals quantification in core materials highlighted anthropogenic impacts in the Eure River Watershed. These contaminated sediments could be re-suspended and transferred to the Seine River in case of remobilization in Martot Pond and the Eure River's channel after dam removal.

Use of avoidance response by rainbow trout to carbon dioxide for fish self-transfer between tanks

USGS Publications Warehouse

Clingerman, J.; Bebak, J.; Mazik, P.M.; Summerfelt, S.T.

2007-01-01

Convenient, economical, and reduced labor fish harvest and transfer systems are required to realize operating cost savings that can be achieved with the use of much larger and deeper circular culture tanks. To achieve these goals, we developed a new technology for transferring fish based on their avoidance behavior to elevated concentrations of dissolved carbon dioxide (CO2). We observed this behavioral response during controlled, replicated experiments that showed dissolved CO2 concentrations of 60-120 mg/L induced rainbow trout (Oncorhynchus mykiss) to swim out of their 11 m3 "growout" tank, through a transfer pipe carrying a flow with ???23 mg/L dissolved CO2, into a second 11 m3 "harvest" tank. The research was conducted using separate groups of rainbow trout held at commercially relevant densities (40-60 kg/m3). The average weight of fish ranged from 0.15 to 1.3 kg during the various trials. In all trials that used a constant flow of low CO2 water (???23 mg/L) entering the growout tank from the harvest tank, approximately 80-90% of the fish swam from the growout tank, through the transfer pipe, and into the harvest tank after the CO2 concentration in the growout tank had exceeded 60 mg/L. The fish that remained in the growout tank stayed within the area of relatively low CO2 water at the entrance of the transfer pipe. However, the rate of fish transfer from the growout tank to the harvest tank was more than doubled when the diameter of the transfer pipe was increased from 203 to 406 mm. To consistently achieve fish transfer efficiencies of 99%, water flow rate through the fish transfer pipe had to be reduced to 10-20% of the original flow just before the conclusion of each trial. Reducing the flow of relatively low CO2 water near the end of each fish transfer event, restricted the zone of relatively low CO2 water about the entrance of the fish transfer pipe, and provided the stimulus for all but a few remaining fish to swim out of the growout tank. Results indicate that the CO2 avoidance technique can provide a convenient, efficient, more economical, and reduced labor approach for fish transfer, especially in applications using large and well mixed circular culture tanks. ?? 2007 Elsevier B.V. All rights reserved.

Production of herbicide-resistant transgenic Panax ginseng through the introduction of the phosphinothricin acetyl transferase gene and successful soil transfer.

PubMed

Choi, Y E; Jeong, J H; In, J K; Yang, D C

2003-02-01

Herbicide-resistant transgenic Panax ginseng plants were produced by introducing the phosphinothricin acetyl transferase (PAT) gene that confers resistance to the herbicide Basta (bialaphos) through Agrobacterium tumefaciens co-cultivation. Embryogenic callus gathered from cotyledon explants of P. ginseng were pre-treated with 0.5 M sucrose or 0.05 M MgSO(4 )before Agrobacterium infection. This pre-treatment process markedly enhanced the transient expression of the beta-glucuronidase (GUS) gene. Embryogenic callus was initially cultured on MS medium supplemented with 400 mg/l cefotaxime for 3 weeks and subsequently subcultured five times to a medium containing 25 mg/l kanamycin and 300 mg/l cefotaxime. Somatic embryos formed on the surfaces of kanamycin-resistant callus. Upon development into the cotyledonary stage, these somatic embryos were transferred to a medium containing 50 mg/l kanamycin and 5 mg/l gibberellic acid to induce germination and strong selection. Integration of the transgene into the plants was confirmed by polymerase chain reaction and Southern analyses. Transfer of the transgenic ginseng plantlets to soil was successfully accomplished via acclimatization in autoclaved perlite. Not all of the plantlets survived in soil that had not been autoclaved because of fungal infection, particularly in the region between the roots and leaves. Transgenic plants growing in soil were observed to be strongly resistant to Basta application.

Enhancing the superconducting temperature of MgB2 by SWCNT dilution

NASA Astrophysics Data System (ADS)

Ma, Danhao; Jayasingha, Ruwantha; Hess, Dustin T.; Adu, Kofi W.; Sumanasekera, Gamini U.; Terrones, Mauricio

2014-02-01

We report, for the first time, an increase in the superconducting critical temperature, TC of commercial “dirty” MgB2 by a nonsubstitutional hole-doping of the MgB2 structure using minute, single-wall carbon nanotube (SWCNT) inclusions. We varied the SWCNTs concentration from 0.05 wt% to 5 wt% and investigated the temperature-dependent resistivity from 10 K to 300 K. We used micro-Raman spectroscopy, field-emission scanning electron microscopy, and X-ray diffraction to analyze the interfacial interactions between the SWCNTs and the MgB2 grains. We obtained an increase in TC from 33.0 to 37.8 K (ΔTC+=4.8 K), which is attributed to charge transfer from the MgB2 structure to the SWCNT structure. The charge transfer phenomenon is confirmed by micro-Raman analysis of the phonon states of the SWCNT tangential band frequency in the composites. We determined the charge transfer per carbon atom to be 0.0023/C, 0.0018/C and 0.0008/C for 0.05 wt%, 0.5 wt% and 5 wt% SWCNT inclusions, respectively, taking into account the contributions from the softening of the lattice constant and the nonadiabatic (dynamic) effects at the Fermi level. This report provides an experimental, alternative pathway to hole-doping of MgB2 without appealing to chemical substitution.

Weathering and transport of chromium and nickel from serpentinite in the Coast Range ophiolite to the Sacramento Valley, California, USA

USGS Publications Warehouse

Morrison, Jean M.; Goldhaber, Martin B.; Mills, Christopher T.; Breit, George N.; Hooper, Robert L.; Holloway, JoAnn M.; Diehl, Sharon F.; Ranville, James F.

2015-01-01

A soil geochemical study in northern California was done to investigate the role that weathering and transport play in the regional distribution and mobility of geogenic Cr and Ni, which are both potentially toxic and carcinogenic. These elements are enriched in ultramafic rocks (primarily serpentinite) and the soils derived from them (1700–10,000 mg Cr per kg soil and 1300–3900 mg Ni per kg soil) in the Coast Range ophiolite. Chromium and Ni have been transported eastward from the Coast Range into the western Sacramento Valley and as a result, valley soil is enriched in Cr (80–1420 mg kg−1) and Ni (65–224 mg kg−1) compared to median values of U.S. soils of 50 and 15 mg kg−1, respectively. Nickel in ultramafic source rocks and soils is present in serpentine minerals (lizardite, antigorite, and chrysotile) and is more easily weathered compared to Cr, which primarily resides in highly refractory chromite ([Mg,Fe2+][Cr3+,Al,Fe3+]2O4). Although the majority of Cr and Ni in soils are in refractory chromite and serpentine minerals, the etching and dissolution of these minerals, presence of Cr- and Ni-enriched clay minerals and development of nanocrystalline Fe (hydr)oxides is evidence that a significant fractions of these elements have been transferred to potentially more labile phases.

Energy transfer between Eu-Mn and photoluminescence properties of Ba0.75Al11O17.25-BaMgAl10O17:Eu2+,Mn2+ solid solution

NASA Astrophysics Data System (ADS)

Zhou, Jun; Wang, Yuhua; Liu, Bitao; Li, Feng

2010-08-01

In order to evaluate the energy transfer between Eu-Mn in Ba0.75Al11O17.25-BaMgAl10O17 solid solution, Ba0.75Al11O17.25-BaMgAl10O17:Eu2+,Mn2+ phosphors were prepared by flux method. The crystal structure and the morphology of the solid solution were demonstrated by x-ray dirrfactometer and scanning electron microscopy. The photoluminescence mechanisms were explained by the energy transfer of Eu2+ to Mn2+ and the Dexter theory. A redshift of green emission peak and a decrease in decay time with the increase in Mn2+ concentration were observed. These phenomena are attributed to the formation of Mn2+ paired centers after analysis by a method of Pade approximations.

[Impact of water pollution risk in water transfer project based on fault tree analysis].

PubMed

Liu, Jian-Chang; Zhang, Wei; Wang, Li-Min; Li, Dai-Qing; Fan, Xiu-Ying; Deng, Hong-Bing

2009-09-15

The methods to assess water pollution risk for medium water transfer are gradually being explored. The event-nature-proportion method was developed to evaluate the probability of the single event. Fault tree analysis on the basis of calculation on single event was employed to evaluate the extent of whole water pollution risk for the channel water body. The result indicates, that the risk of pollutants from towns and villages along the line of water transfer project to the channel water body is at high level with the probability of 0.373, which will increase pollution to the channel water body at the rate of 64.53 mg/L COD, 4.57 mg/L NH4(+) -N and 0.066 mg/L volatilization hydroxybenzene, respectively. The measurement of fault probability on the basis of proportion method is proved to be useful in assessing water pollution risk under much uncertainty.

Evaluation of the in vitro inhibitory impact of hypericin on placental glutathione S-transferase pi.

PubMed

Dalmizrak, Ozlem; Kulaksiz-Erkmen, Gulnihal; Ozer, Nazmi

2012-10-01

St John's Wort (SJW) extracts are herbal products which are available without prescription in most countries and widely used in the treatment of mild to moderate depression. Since it is a herbal product and available without prescription, use of SJW is common among pregnant and/or lactating woman. The principal of the study was to clarify the effects of hypericin, one of the components of SJW, on glutathione S-transferase-pi (GST-pi) purified from human placenta. The K (m) values of GST-pi were 0.21 ± 0.03 mM for glutathione (GSH) and 2.29 ± 0.54 mM for 1-chloro-2,4-dinitrobenzene (CDNB). At fixed [GSH], the V (m) value calculated was about 3 times higher than the conditions in which [CDNB] was fixed; 201 ± 30 U/mg protein versus 74 ± 3 U/mg protein. At constant substrate concentrations (1 mM), an average IC (50) value of 0.70 ± 0.02 μM was obtained. Hypericin inhibited GST-pi competitively with respect to both substrates. When GSH was the varied substrate a K (i) value of 0.31 ± 0.05 μM was found; when CDNB was the varied substrate, a K (i) value of 0.85 ± 0.02 μM was obtained. On the basis of these data considering transplacental transfer of hypericin and immature hepatic clearance of the baby, using this herbal product may cause abnormalites due to the inhibition of one of the most important placental detoxification enzymes, GST-pi.

Evaluation of five commercially available assays and measurement of serum total protein concentration via refractometry for the diagnosis of failure of passive transfer of immunity in foals.

PubMed

Davis, Rachel; Giguère, Steeve

2005-11-15

To determine and compare sensitivity, specificity, accuracy, and predictive values of measurement of serum total protein concentration by refractometry as well as 5 commercially available kits for the diagnosis of failure of passive transfer (FPT) of immunity in foals. Prospective study. 65 foals with various medical problems and 35 clinically normal foals. IgG concentration in serum was assessed by use of zinc sulfate turbidity (assay C), glutaraldehyde coagulation (assay D), 2 semiquantitative immunoassays (assays F and G), and a quantitative immunoassay (assay H). Serum total protein concentration was assessed by refractometry. Radial immunodiffusion (assays A and B) was used as the reference method. For detection of IgG < 400 mg/dL, sensitivity of assay H (100%) was not significantly different from that of assays C, E, and G (88.9%). Specificity of assays H (96.0%) and G (95.8%) was significantly higher than that of assays C (79.4%) and E (78.1 %). For detection of IgG < 800 mg/dL, sensitivities of assays H (976%), D (92.9%), C (81.0%), and G (81.0%) were significantly higher than that of assay F (52.4%). Specificity of assays F (100%), G (94.7%), and H (82.8%) was significantly higher than that of assays C (56.9%) and D (58.6%). Serum total protein concentration < or = 4.5 g/dL was suggestive of FPT, whereas values > or = 6.0 g/dL indicated adequate IgG concentrations. Most assays were adequate as initial screening tests. However, their use as a definitive test would result in unnecessary treatment of foals with adequate IgG concentrations.

Transfer Reactions on Neutron-rich Nuclei at REX-ISOLDE

DOE Office of Scientific and Technical Information (OSTI.GOV)

Kroell, Th.; Physik-Department E12, Technische Universitaet Muenchen, Garching; Bildstein, V.

2009-08-26

We report on one- and two-neutron transfer reactions to study the single-particle properties of nuclei at the border of the ''island of inversion.'' The (d, p)- and (t, p)-reactions in inverse kinematics on the neutron-rich isotope {sup 30}Mg, delivered as radioactive beam by the REX-ISOLDE facility, have been investigated. The outgoing protons have been detected and identified by a newly built array of Si detectors. The {gamma}-decay of excited states has been detected in coincidence by the MINIBALL array. First results for {sup 31}Mg and from the search for the second, spherical, 0{sup +} state in {sup 32}Mg are presented.

Ozone disinfection and color removal in waste water. Final report

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gan, H.B.

Various ozone contacting systems were evaluated. A sparger incorporated into a six-stage contacting system was found to be the most practical system. Over 80% ozone transfer efficiency was obtained in secondary effluent with an applied ozone dosage of 50 mg/l. Despite efficient mass transfer with the system, an ozone consumption in excess of 50 mg/l was found to be necessary to accomplish the disinfection goal of 2.2 MPN/100ml effluent. The color goal of 10 units was achieved at an ozone dose of 10 mg/l. The use of carbon filtration prior to ozonation reduced the ozone dosage required for adequate disinfectionmore » to as low as 1 mg/l. Pretreatment of the sand and carbon filters was also briefly investigated.« less

Structure-dependent magnetoresistance and spin-transfer torque in antiferromagnetic Fe |MgO |FeMn |Cu tunnel junctions

NASA Astrophysics Data System (ADS)

Jia, Xingtao; Tang, Huimin; Wang, Shizhuo; Qin, Minghui

2017-02-01

We predict large magnetoresistance (MR) and spin transfer torque (STT) in antiferromagnetic Fe |MgO |FeMn |Cu tunnel junctions based on first-principles scattering theory. MR as large as ˜100 % is found in one junction. Magnetic dynamic simulations show that STT acting on the antiferromagnetic order parameter dominates the spin dynamics, and an electronic bias of order 10-1mV and current density of order 105Acm-2 can switches a junction of three-layer MgO, they are about one order smaller than that in Fe |MgO |Fe junction with the same barrier thickness, respectively. The multiple scattering in the antiferromagnetic region is considered to be responsible for the enhanced spin torque and smaller switching current density.

Quantitative and Qualitative Aspects of Gas-Metal-Oxide Mass Transfer in High-Temperature Confocal Scanning Laser Microscopy

NASA Astrophysics Data System (ADS)

Piva, Stephano P. T.; Pistorius, P. Chris; Webler, Bryan A.

2018-05-01

During high-temperature confocal scanning laser microscopy (HT-CSLM) of liquid steel samples, thermal Marangoni flow and rapid mass transfer between the sample and its surroundings occur due to the relatively small sample size (diameter around 5 mm) and large temperature gradients. The resulting evaporation and steel-slag reactions tend to change the chemical composition in the metal. Such mass transfer effects can change observed nonmetallic inclusions. This work quantifies oxide-metal-gas mass transfer of solutes during HT-CSLM experiments using computational simulations and experimental data for (1) dissolution of MgO inclusions in the presence and absence of slag and (2) Ca, Mg-silicate inclusion changes upon exposure of a Si-Mn-killed steel to an oxidizing gas atmosphere.

Exposure assessment of a burning ground for chemical ammunition on the Great War battlefields of Verdun.

PubMed

Bausinger, Tobias; Bonnaire, Eric; Preuss, Johannes

2007-09-01

The destruction of arsenical shells from the 1914/18 war in the vicinity of Verdun (France) during the 1920s resulted in a locally limited but severe soil contamination by arsenic and heavy metals. At the study site, the main part of the contaminant inventory occurs in the upper 20 cm of the topsoil which is essentially composed of combustion residues. Besides, some Cu (cmax.=16,877 mg/kg) and Pb (cmax.=26,398 mg/kg) in this layer, As (cmax.=175,907 mg/kg) and Zn (cmax.=133,237 mg/kg) were detected in very high concentrations. The mobilities of Cu, Mn, Pb and Zn in the soil system were derived from ammonium nitrate eluates. They are strongly influenced by the soil pH and can be described by quadratic regression curves from which threshold pH values were calculated. Below these values more than 10% of the element content was available as mobile species. Within the examined pH range, this method could not be adopted for arsenic, because the mobility of As was only slightly controlled by the soil pH. In the heavily contaminated topsoil, Cu and Pb were fixed by the moderately acidic soil pH which varied from 4.8 to 5.8. No migration to the underlying horizons occurred. A different behavior was observed for As and Zn. The calculated threshold pH of Zn was 5.5, so certain amount of this element was transferred to the subsoil and the leachate (cmax.=350 microg/l). However, a major dispersion of Zn was prevented by a rise of the soil pH in the carbonate-containing subsoil. Elevated concentrations of As were found in all soil horizons up to a depth of 2 m and also in the leachate (cmax.=2377 microg/l). Contrary to Cu, Pb and Zn the mobility of As evidently was less affected by the subsoil. Regarding organic contaminants, nitroaromatic explosives were detected only in minor concentrations in the soil (cmax.=14.7 mg/kg) and the leachate (cmax.=13.5 microg/l). No aromatic organoarsenicals were detected in the soil and the leachate samples. The main hazard of the site is the severe arsenic contamination and the transfer of this carcinogen by leachate, surface runoff and probably by wind. Nevertheless, some studies on the effects of the contaminant inventory on the local vegetation revealed that ammonium nitrate elutable zinc is responsible for the spatial distribution of some tolerant plant species and not arsenic. Previously undetected buried munitions from the former delaboration facility can be an other source of environmental contaminants. This is supported by elevated concentrations of chlorate (cmax.=71 mg/l) and perchlorate (cmax.=0.8 mg/l) detected in the leachate samples. This is the second report about environmental contamination related to post-war ammunition destruction activities along the 1914/18 Western Front.

Optimising resolution for a preparative separation of Chinese herbal medicine using a surrogate model sample system.

PubMed

Ye, Haoyu; Ignatova, Svetlana; Peng, Aihua; Chen, Lijuan; Sutherland, Ian

2009-06-26

This paper builds on previous modelling research with short single layer columns to develop rapid methods for optimising high-performance counter-current chromatography at constant stationary phase retention. Benzyl alcohol and p-cresol are used as model compounds to rapidly optimise first flow and then rotational speed operating conditions at a preparative scale with long columns for a given phase system using a Dynamic Extractions Midi-DE centrifuge. The transfer to a high value extract such as the crude ethanol extract of Chinese herbal medicine Millettia pachycarpa Benth. is then demonstrated and validated using the same phase system. The results show that constant stationary phase modelling of flow and speed with long multilayer columns works well as a cheap, quick and effective method of optimising operating conditions for the chosen phase system-hexane-ethyl acetate-methanol-water (1:0.8:1:0.6, v/v). Optimum conditions for resolution were a flow of 20 ml/min and speed of 1200 rpm, but for throughput were 80 ml/min at the same speed. The results show that 80 ml/min gave the best throughputs for tephrosin (518 mg/h), pyranoisoflavone (47.2 mg/h) and dehydrodeguelin (10.4 mg/h), whereas for deguelin (100.5 mg/h), the best flow rate was 40 ml/min.

Calcium and magnesium isotope systematics in rivers draining the Himalaya-Tibetan-Plateau region: Lithological or fractionation control?

NASA Astrophysics Data System (ADS)

Tipper, Edward T.; Galy, Albert; Bickle, Mike J.

2008-02-01

In rivers draining the Himalaya-Tibetan-Plateau region, the 26Mg/ 24Mg ratio has a range of 2‰ and the 44Ca/ 42Ca ratio has a range of 0.6‰. The average δ26Mg values of tributaries from each of the main lithotectonic units (Tethyan Sedimentary Series (TSS), High Himalayan Crystalline Series (HHCS) and Lesser Himalayan Series (LHS)) are within 2 standard deviation analytical uncertainty (0.14‰). The consistency of average riverine δ26Mg values is in contrast to the main rock types (limestone, dolostone and silicate) which range in their average δ26Mg values by more than 2‰. Tributaries draining the dolostones of the LHS differ in their δ44Ca values compared to tributaries from the TSS and HHCS. The chemistry of these river waters is strongly influenced by dolostone (solute Mg/Ca close to unity) and both δ26Mg (-1.31‰) and δ44Ca (0.64‰) values are within analytical uncertainty of the LHS dolostone. These are the most elevated δ44Ca values in rivers and rock reported so far demonstrating that both riverine and bedrock δ44Ca values may show greater variability than previously thought. Although rivers draining TSS limestone have the lowest δ26Mgandδ44Ca values at -1.41 and 0.42‰, respectively, both are offset to higher values compared to bedrock TSS limestone. The average δ26Mg value of rivers draining mainly silicate rock of the HHCS is -1.25‰, lower by 0.63‰ than the average silicate rock. These differences are consistent with a fractionation of δ26Mg values during silicate weathering. Given that the proportion of Mg exported from the Himalaya as solute Mg is small, the difference in 26Mg/ 24Mg ratios between silicate rock and solute Mg reflects the 26Mg/ 24Mg isotopic fractionation factor ( αsilicate-dissolvedMg) between silicate and dissolved Mg during incongruent silicate weathering. The value of αsilicate-dissolvedMg of 0.99937 implies that in the TSS, solute Mg is primarily derived from silicate weathering, whereas the source of Ca is overwhelmingly derived from carbonate weathering. The average δ44Ca value in HHCS rivers is within uncertainty of silicate rock at 0.39‰. The widespread hot springs of the High Himalaya have an average δ26Mg value of -0.46‰ and an average δ44Ca value of 0.5‰, distinct from riverine values for δ26Mg but similar to riverine δ44Ca values. Although rivers draining each major rock type have δ44Ca and δ26Mg values in part inherited from bedrock, there is no correlation with proxies for carbonate or silicate lithology such as Na/Ca ratios, suggesting that Ca and Mg are in part recycled. However, in spite of the vast contrast in vegetation density between the arid Tibetan Plateau and the tropical Lesser Himalaya, the isotopic fractionation factor for Ca and Mg between solute and rocks are not systematically different suggesting that vegetation may only recycle a small amount of Ca and Mg in these catchments. The discrepancy between solute and solid Ca and Mg isotope ratios in these rivers from diverse weathering environments highlight our lack of understanding concerning the origin and subsequent path of Ca and Mg, bound as minerals in rock, and released as cations in rivers. The fractionation of Ca and Mg isotope ratios may prove useful for tracing mechanisms of chemical alteration. Ca isotope ratios of solute riverine Ca show a greater variability than previously acknowledged. The variability of Ca isotope ratios in modern rivers will need to be better quantified and accounted for in future models of global Ca cycling, if past variations in oceanic Ca isotope ratios are to be of use in constraining the past carbon cycle.

Phosphorus transfer in runoff following application of fertilizer, manure, and sewage sludge.

PubMed

Withers, P J; Clay, S D; Breeze, V G

2001-01-01

Phosphorus (P) transfer in surface runoff from field plots receiving either no P, triplesuperphoshate (TSP), liquid cattle manure (LCS), liquid anaerobically digested sludge (LDS), or dewatered sludge cake (DSC) was compared over a 2-yr period. Dissolved inorganic P concentrations in runoff increased from 0.1 to 0.2 mg L(-1) on control and sludge-treated plots to 3.8 and 6.5 mg L(-1) following application of LCS and TSP, respectively, to a cereal crop in spring. When incorporated into the soil in autumn, runoff dissolved P concentrations were typically < 0.5 mg L(-1) across all plots, and particulate P remained the dominant P form. When surface-applied in autumn to a consolidated seedbed, direct loss of LCS and LDS increased both runoff volume and P transfers, but release of dissolved P occurred only from LCS. The largest P concentrations (>70 mg L(-1)) were recorded following TSP application without any increase in runoff volume, while application of bulky DSC significantly reduced total P transfers by 70% compared with the control due to a reduced runoff volume. Treatment effects in each monitoring period were most pronounced in the first runoff event. Differences in the release of P from the different P sources were related to the amounts of P extracted by either water or sodium bicarbonate in the order TSP > LCS > LDS > DSC. The results suggest there is a lower risk of P transfer in land runoff following application of sludge compared with other agricultural P amendments at similar P rates.

Excitons in strongly correlated oxide nanocrystals NicMg1-cO

NASA Astrophysics Data System (ADS)

Sokolov, V. I.; Churmanov, V. N.; Pustovarov, V. A.; Gruzdev, N. B.; Uimin, M. A.; Byzov, I. V.; Zatsepin, A. F.; Kuznetsova, J. A.

2018-05-01

This paper reports about excitons in strongly correlated oxide nanocrystals NicMg1-cO (c = 0.008 and c = 1). At 8 K two weak peaks were firstly observed in the optical density spectrum of NiO nanocrystals at the energies of 3.510 eV and 3.543 eV. The intensity of the peaks subsides with an increase of temperature and a decrease of nanoparticle sizes from 25 nm to 10 nm. The peaks were attributed to the formation of p-d charge transfer excitons {d9h}. A tunneling annihilation for {d9h} excitons diminishes their lifetime drastically, even at low temperatures. This fact is considered as an inherent feature in the p-d charge transfer excitons {d9h}, which makes them significantly different from the Wannier-Mott excitons for semiconductors with direct allowed transitions. We believe that energy shift between two peaks originates due to the spin-orbit splitting of the top of the valence band, equals 33 meV. In p-d charge transfer photoluminescence excitation spectrum of NicMg1-cO (c = 0.008), we have revealed two [d9h] exciton lines near the charge transfer band edge. Energy shift of these lines (equals 25 meV) is due to the spin-orbit splitting of MgO valence band top.

Influence of Cytokinins in Combination with GA3 on Shoot Multiplication and Elongation of Tea Clone Iran 100 (Camellia sinensis (L.) O. Kuntze)

PubMed Central

Gonbad, Reza Azadi; Mohamad, Rosfarizan

2014-01-01

The use of in vitro culture has been accepted as an efficient technique for clonal propagation of many woody plants. In the present research, we report the results of a number of experiments aimed at optimizing micropropagation protocol for tea (Camellia sinensis (L.) O. Kuntze) (clone Iran 100) using nodal segments as the explant. The effect of different combinations and concentrations of plant growth regulators (PGR) (BAP, TDZ, GA3) on shoot multiplication and elongation was assessed. The influence of exposure to IBA in liquid form prior to transfer to solid media on rooting of tea microshoots was investigated. The results of this study showed that the best treatment for nodal segment multiplication in terms of the number of shoot per explant and shoot elongation was obtained using 3 mg/L BAP in combination with 0.5 mg/L GA3. TDZ was found to be inappropriate for multiplication of tea clone Iran 100 as it resulted in hyperhydricity especially at concentrations higher than 0.05 mg/L. Healthy shoots treated with 300 mg/L IBA for 30 min followed by transfer to 1/2 strength MS medium devoid of PGR resulted in 72.3% of shoots producing roots and upon transferring them to acclimatization chamber 65% survival was obtained prior to field transfer. PMID:24605069

BEOL compatible high tunnel magneto resistance perpendicular magnetic tunnel junctions using a sacrificial Mg layer as CoFeB free layer cap

DOE Office of Scientific and Technical Information (OSTI.GOV)

Swerts, J., E-mail: Johan.Swerts@imec.be; Mertens, S.; Lin, T.

Perpendicularly magnetized MgO-based tunnel junctions are envisaged for future generation spin-torque transfer magnetoresistive random access memory devices. Achieving a high tunnel magneto resistance and preserving it together with the perpendicular magnetic anisotropy during BEOL CMOS processing are key challenges to overcome. The industry standard technique to deposit the CoFeB/MgO/CoFeB tunnel junctions is physical vapor deposition. In this letter, we report on the use of an ultrathin Mg layer as free layer cap to protect the CoFeB free layer from sputtering induced damage during the Ta electrode deposition. When Ta is deposited directly on CoFeB, a fraction of the surface ofmore » the CoFeB is sputtered even when Ta is deposited with very low deposition rates. When depositing a thin Mg layer prior to Ta deposition, the sputtering of CoFeB is prevented. The ultra-thin Mg layer is sputtered completely after Ta deposition. Therefore, the Mg acts as a sacrificial layer that protects the CoFeB from sputter-induced damage during the Ta deposition. The Ta-capped CoFeB free layer using the sacrificial Mg interlayer has significantly better electrical and magnetic properties than the equivalent stack without protective layer. We demonstrate a tunnel magneto resistance increase up to 30% in bottom pinned magnetic tunnel junctions and tunnel magneto resistance values of 160% at resistance area product of 5 Ω.μm{sup 2}. Moreover, the free layer maintains perpendicular magnetic anisotropy after 400 °C annealing.« less

Effect of Two Oil Dispersants on Larval Grass Shrimp (Palaemonetes pugio) Development.

NASA Astrophysics Data System (ADS)

Betancourt, P.; Key, P. B.; Chung, K. W.; DeLorenzo, M. E.

2015-12-01

The study focused on the effects that two oil dispersants, Corexit® EC9500A and Finasol® OSR52, have on the development of larval grass shrimp, (Palaemonetes pugio). The hypothesis was that Finasol would have a greater effect on larval grass shrimp development than Corexit. The experiment was conducted using 300 grass shrimp larvae that were 24 hours old. Each larva was exposed individually. In total, five sub-lethal concentrations were tested for each dispersant (control, 1.25, 2.50, 5.0,10.0 mg/L). The larvae were exposed for five days then transferred to clean seawater until metamorphosis into the juvenile stage. Key data measurements recorded included number of days to become juveniles, number of instars, length, dry weight, and mortality. Data from exposed shrimp was compared to the results of the control for each dispersant concentration. Corexit and Finasol exposure treatments of 5 mg/L and 10 mg/L showed significantly higher values for number of days and number of instars to reach juvenile status than values obtained from unexposed, control shrimp. Overall, mortality was higher in the Finasol treatments but the two dispersants did not respond significantly different from one another. Future studies are needed to determine the long term effects of dispersant exposure on all grass shrimp life stages and how any dispersant exposure impacts grass shrimp populations. Grass shrimp serve as excellent toxicity indicators of estuaries, and further studies will help to develop better oil spill mitigation techniques.

Effect of organic loading rates and proton exchange membrane surface area on the performance of an up-flow cylindrical microbial fuel cell.

PubMed

Jana, Partha S; Behera, Manaswini; Ghangrekar, M M

2012-01-01

The effect of organic loading rates (OLRs) and proton exchange membrane (PEM) surface area on the performance of microbial fuel cells (MFCs) was evaluated. Three MFCs (MFC-1, MFC-2 and MFC-3) having PEM surface area of 10 cm2, 20 cm2 and 40 cm2, respectively, were used in the study. The MFCs were operated at influent chemical oxygen demand (COD) of 500 mg L(-1) and hydraulic retention time (HRT) of 20 h, 17 h, 13 h and 6 h in experimental Run-1 to Run-4. MFC-3, with highest PEM surface area showed highest power generation throughout the study. The optimum performancewas obtained at HRT of 13 h. In Run-5 and Run-6, the influent COD was increased to 1000 mg L(-1) and 1500 mg L(-1), respectively, maintaining the HRT at 13 h. Maximum volumetric powers of 4.26 W m(-3), 9.41 W m(-3) and 17.24 W m(-3) were obtained in MFC-1, MFC-2 and MFC-3, respectively, in Run-5 under the OLR of 1.84 kg COD m(-3) d(-1). These power values are among the higher values reported in literature; MFCs with higher PEM surface area showed better electricity generation, which clearly demonstrates that proton mass transfer is the main constraint in the MFCs which limits the power output. Combined effect of influent COD and HRT was found on electricity generation.

Radium-226 transfer factor from soils to crops and its simple estimation method using uranium and barium concentrations.

PubMed

Tagami, Keiko; Uchida, Shigeo

2009-09-01

Radium-226 ((226)Ra) should be assessed to determine the safety of geological disposal of high-level radioactive and transuranic wastes. Among the environmental transfer parameters that have been used in mathematical models for the environmental safety assessment, soil-to-plant transfer factor (F(v)) is of importance; it is defined as the plant/soil concentration ratio. Reported F(v) data for (226)Ra are still limited due to the low concentration of (226)Ra in plants in the natural environment. In this study, we collected F(v) of (226)Ra (F(v)-Ra) for crops and then applied a statistical approach to estimate F(v)-Ra instead of directly measuring the radionuclide. We found high correlations between (226)Ra and U concentrations in soils (because (226)Ra is a progeny in the (238)U series), and between (226)Ra and Ba concentrations in plants (because they are chemically similar in plant uptake). Using U in soil and Ba in plant values, we could estimate F(v)-Ra with good accuracy; the difference between estimated and measured F(v)-Ra values was a factor of 1.2 on average for crops. The method could estimate F(v)-Ra for the soil-to-plant systems where (226)Ra and Ba concentrations in soil are within the normal range, e.g. 8-100 Bq kg(-1)-dry for (226)Ra and 84-960 mg kg(-1)-dry for Ba.

Electrospun regenerated cellulose nanofibrous membranes surface-grafted with polymer chains/brushes via the atom transfer radical polymerization method for catalase immobilization.

PubMed

Feng, Quan; Hou, Dayin; Zhao, Yong; Xu, Tao; Menkhaus, Todd J; Fong, Hao

2014-12-10

In this study, an electrospun regenerated cellulose (RC) nanofibrous membrane with fiber diameters of ∼200-400 nm was prepared first; subsequently, 2-hydroxyethyl methacrylate (HEMA), 2-dimethylaminoethyl methacrylate (DMAEMA), and acrylic acid (AA) were selected as the monomers for surface grafting of polymer chains/brushes via the atom transfer radical polymerization (ATRP) method. Thereafter, four nanofibrous membranes (i.e., RC, RC-poly(HEMA), RC-poly(DMAEMA), and RC-poly(AA)) were explored as innovative supports for immobilization of an enzyme of bovine liver catalase (CAT). The amount/capacity, activity, stability, and reusability of immobilized catalase were evaluated, and the kinetic parameters (Vmax and Km) for immobilized and free catalase were determined. The results indicated that the respective amounts/capacities of immobilized catalase on RC-poly(HEMA) and RC-poly(DMAEMA) nanofibrous membranes reached 78 ± 3.5 and 67 ± 2.7 mg g(-1), which were considerably higher than the previously reported values. Meanwhile, compared to that of free CAT (i.e., 18 days), the half-life periods of RC-CAT, RC-poly(HEMA)-CAT, RC-poly(DMAEMA)-CAT, and RC-poly(AA)-CAT were 49, 58, 56, and 60 days, respectively, indicating that the storage stability of immobilized catalase was also significantly improved. Furthermore, the immobilized catalase exhibited substantially higher resistance to temperature variation (tested from 5 to 70 °C) and lower degree of sensitivity to pH value (tested from 4.0 and 10.0) than the free catalase. In particular, according to the kinetic parameters of Vmax and Km, the nanofibrous membranes of RC-poly(HEMA) (i.e., 5102 μmol mg(-1) min(-1) and 44.89 mM) and RC-poly(DMAEMA) (i.e., 4651 μmol mg(-1) min(-1) and 46.98 mM) had the most satisfactory biocompatibility with immobilized catalase. It was therefore concluded that the electrospun RC nanofibrous membranes surface-grafted with 3-dimensional nanolayers of polymer chains/brushes would be suitable/ideal as efficient supports for high-density and reusable enzyme immobilization.

Electron transfer mediators accelerated the microbiologically influence corrosion against carbon steel by nitrate reducing Pseudomonas aeruginosa biofilm.

PubMed

Jia, Ru; Yang, Dongqing; Xu, Dake; Gu, Tingyue

2017-12-01

Electron transfer is a rate-limiting step in microbiologically influenced corrosion (MIC) caused by microbes that utilize extracellular electrons. Cross-cell wall electron transfer is necessary to transport the electrons released from extracellular iron oxidation into the cytoplasm of cells. Electron transfer mediators were found to accelerate the MIC caused by sulfate reducing bacteria. However, there is no publication in the literature showing the effect of electron transfer mediators on MIC caused by nitrate reducing bacteria (NRB). This work demonstrated that the corrosion of anaerobic Pseudomonas aeruginosa (PAO1) grown as a nitrate reducing bacterium biofilm on C1018 carbon steel was enhanced by two electron transfer mediators, riboflavin and flavin adenine dinucleotide (FAD) separately during a 7-day incubation period. The addition of either 10ppm (w/w) (26.6μM) riboflavin or 10ppm (12.7μM) FAD did not increase planktonic cell counts, but they increased the maximum pit depth on carbon steel coupons considerably from 17.5μm to 24.4μm and 25.0μm, respectively. Riboflavin and FAD also increased the specific weight loss of carbon steel from 2.06mg/cm 2 to 2.34mg/cm 2 and 2.61mg/cm 2 , respectively. Linear polarization resistance, electrochemical impedance spectroscopy and potentiodynamic polarization curves all corroborated the pitting and weight loss data. Copyright © 2017 Elsevier B.V. All rights reserved.

Diffusion models for corona formation in metagabbros from the Western Grenville Province, Canada

NASA Astrophysics Data System (ADS)

Grant, Shona M.

1988-01-01

Metagabbro bodies in SW Grenville Province display a variety of disequilibrium corona textures between spinel-clouded plagioclase and primary olivine or opaque oxide. Textural evidence favours a single-stage, subsolidus origin for the olivine coronas and diffusive mass transfer is believed to have been the rate-controlling process. Irreversible thermodynamics have been used to model two different garnet symplectite-bearing corona sequences in terms of steady state diffusion. In the models the flux of each component is related to the chemical potential gradients of all diffusing species by the Onsager or L-coefficients for diffusion. These coefficients are analogous to experimentally determined diffusion coefficients ( d), but relate the flux of components to chemical potential rather than concentration gradients. The major constraint on the relative values of Onsager coefficients comes from the observed mole fraction, X, of garnet in the symplectites; in (amph-gt) symplectites X {Gt/Sym}˜0.80, compared with ˜0.75 in (cpx-gt) symplectites. Several models using simple oxide components, and two different modifications of the reactant plagioclase composition, give the following qualitative results: the very low mobility of aluminium appears to control the rate of corona formation. Mg and Fe have similar mobility, and Mg can be up to 6 8 times more mobile than sodium. Determination of calcium mobility is problematical because of a proposed interaction with cross-coefficient terms reflecting “uphill” Ca-diffusion, i.e., calcium diffusing up its own chemical potential gradient. If these terms are not introduced, it is difficult to generate the required proportions of garnet in the symplectite. However, at moderate values of the cross-coefficient ratios, Mg can be up to 4 6 times more mobile than calcium ( L MgMg/LCaCa<4 6) and calcium must be 3 4 times more mobile than aluminium ( L CaCa/LAlAl>3).

Low-temperature photoluminescence in NixMg1-xO nanocrystals

NASA Astrophysics Data System (ADS)

Churmanov, V. N.; Gruzdev, N. B.; Sokolov, V. I.; Pustovarov, V. A.; Ivanov, V. Yu.; Mironova-Ulmane, N. A.

2015-03-01

A study of the photoluminescence and photoluminescence excitation spectra of NixMg1-xO nanocrystals, at low-temperatures. We examine the processes of concentration quenching and supposed mechanisms of energy migration in NixMg1-xO. It is shown that the edge energies of the charge-transfer transitions in NixMg1-xO (x = 0.008) and NiO are practically identical.

Global Mapping of Mg-Number Derived from Clementine Data.

NASA Astrophysics Data System (ADS)

Cahill, J. T.; Lucey, P. G.; Gillis, J. J.; Steutel, D.

2004-12-01

The global mapping of the lunar surface using the petrological parameter Mg-number (Mg*) was undertaken because Mg*, or the ratio of Mg to the sum of Mg and Fe on an atomic basis, is an important disciminator in defining and understanding lunar rocks. The dominant lunar rock types, ferroan anorthosites (FAN), high-magnisium suite (HMS), and high-alkali suite (HAS) rocks all vary in Mg* depending upon the petrologic scenario that formed them. Of particular interest are FAN mineralogy and chemistry, which varies from high-Mg# (~70) troctolites to low-Mg# norites (~50) and for some time has been considered to represent a single magma frac-tionation trend. However, recent studies have also shown that the crystallization of FAN rocks may have been more complicated than originally thought. James et al. [1] found that instead of one simple fractionation trend for ferroan anorthosites, there may have been four. Studies by [2], [3], and [4] using Apollo and lunar meteorites for analysis have also eluded to the possibility that FAN rocks may have evolved from a more complex source or process. Therefore a global assessment of lithologies and corresponding Mg* is of great value for lunar petrology. In a remote sensing context, Mg* is the most important control on the spectral properties of lunar mafic silicates. For stoichiometric orthopyroxene and olivine, Mg* is mathematically linked to the Fe content that controls the overall reflectance and intensity of absorption. The changes in band centers and shape that accompany the structural changes as Fe substitutes for Mg along the solid solution series have long been recognized; these changes are highly correlated with Mg*. In clinopyroxene, the strong effect of Ca on structure makes this element important, but Mg* has the dominant effect on reflectance and a comparable effect on spectral shape. In this study, the lunar surface is quantitatively mapped using a theoretical treatment of mineralogic spectra and the effect of environmental space exposure on the optical properties of these minerals. This was accomplished using Clementine ultraviolet and visible (UVVIS) data and a Hapke radiative transfer mixing model. The major features evident in these maps are the strong distinction between mare and highland regions, the former showing low Mg* and the latter generally higher; a large northern highlands unit with low Mg*, and an Mg* high north of South Pole-Aitken basin. Mare units are not universally low, mare Frigoris in particular has elevated Mg* relative to other mare. The strongest variations in the highlands occur in plagioclase rich, low FeO units, that exhibit values ranging near 50 to near 100 in coherent units. The craters Tycho and Aristarchus also exhibit high Mg*; these gabbroic anomalies may indicate more extensive Mg-rich material at depth. Deposits within SPA are unremarkable relative to surroundings, and share the intermediate Mg* of most of the highlands. 1. James, O.B. et al. PLPSC. 1989.; 2.Bersch, M.G., et al., GRL, 1991.; 3. Floss, C., et al., GCA, 1998.; 4. Korotev, R.L., et al., GCA, 2003.

Correlation of Biological Activity and Reactor Performance in Biofiltration of Toluene with the Fungus Paecilomyces variotii CBS115145

PubMed Central

García-Peña, Inés; Hernández, Sergio; Auria, Richard; Revah, Sergio

2005-01-01

A biofiltration system inoculated with the mold Paecilomyces variotii CBS115145 showed a toluene elimination capacity (EC) of around 250 g/m3 of biofilter/h, which was higher than the values usually reported for bacteria. P. variotii assimilated m- and p-cresols but not the o isomer. Initial toluene hydroxylation occurred both on the methyl group and through the p-cresol pathway. These results were corroborated by detecting benzyl alcohol, benzaldehyde, and p-cresol as volatile intermediates. In liquid cultures with toluene as a substrate, the activity of toluene oxygenase (TO) was 5.6 nmol of O2/min/mg of biomass, and that of benzyl alcohol dehydrogenase was 16.2 nmol of NADH/min/mg of protein. Toluene biodegradation determined from the TO activity in the biofilter depended on the biomass distribution and the substrate concentration. The specific enzymatic activity decreased from 6.3 to 1.9 nmol of O2/min/mg of biomass along the reactor. Good agreement was found between the EC calculated from the TO activity and the EC measured on the biofilter. The results were confirmed by short-time biofiltration experiments. Average EC measured in different biofiltration experiments and EC calculated from the TO activity showed a linear relation, suggesting that in the biofilters, EC was limited by biological reaction. As the enzymatic activities of P. variotii were similar to those reported for bacteria, the high performance of the fungal biofilters can possibly be explained by the increased transfer of the hydrophobic compounds, including oxygen, from the gas phase to the mycelia, overcoming the transfer problems associated with the flat bacterial biofilms. PMID:16085815

Correlation of biological activity and reactor performance in biofiltration of toluene with the fungus Paecilomyces variotii CBS115145.

PubMed

García-Peña, Inés; Hernández, Sergio; Auria, Richard; Revah, Sergio

2005-08-01

A biofiltration system inoculated with the mold Paecilomyces variotii CBS115145 showed a toluene elimination capacity (EC) of around 250 g/m3 of biofilter/h, which was higher than the values usually reported for bacteria. P. variotii assimilated m- and p-cresols but not the o isomer. Initial toluene hydroxylation occurred both on the methyl group and through the p-cresol pathway. These results were corroborated by detecting benzyl alcohol, benzaldehyde, and p-cresol as volatile intermediates. In liquid cultures with toluene as a substrate, the activity of toluene oxygenase (TO) was 5.6 nmol of O2/min/mg of biomass, and that of benzyl alcohol dehydrogenase was 16.2 nmol of NADH/min/mg of protein. Toluene biodegradation determined from the TO activity in the biofilter depended on the biomass distribution and the substrate concentration. The specific enzymatic activity decreased from 6.3 to 1.9 nmol of O2/min/mg of biomass along the reactor. Good agreement was found between the EC calculated from the TO activity and the EC measured on the biofilter. The results were confirmed by short-time biofiltration experiments. Average EC measured in different biofiltration experiments and EC calculated from the TO activity showed a linear relation, suggesting that in the biofilters, EC was limited by biological reaction. As the enzymatic activities of P. variotii were similar to those reported for bacteria, the high performance of the fungal biofilters can possibly be explained by the increased transfer of the hydrophobic compounds, including oxygen, from the gas phase to the mycelia, overcoming the transfer problems associated with the flat bacterial biofilms.

Risk factors for fecal carriage of carbapenemase producing Enterobacteriaceae among intensive care unit patients from a tertiary care center in India.

PubMed

Mittal, Gajanand; Gaind, Rajni; Kumar, Deepak; Kaushik, Gaurav; Gupta, Kunj Bihari; Verma, P K; Deb, Monorama

2016-07-08

Resistance amongst the commensal flora is a serious threat because a very highly populated ecosystem like the gut, may at a later stage, be a source of extra intestinal infections, resistant strains may spread to other host or transfer genetic resistance element to other members of micro-biota including pathogens. This study was carried out to assess fecal colonization by carbapenemase producing Enterobacteriaceae (CPE) and associated risk factors among 100 patients admitted to intensive care unit (ICU). The phenotypic and molecular characterizations of CPE were also included. Colonization with CPE was observed in 6.6 % (8/122) controls. Among ICU patients, fecal carriage of CPE was significantly higher on day 4 (D4) (22 %) as compared to day 1 (D1) (11 %) (p value 0.002). The carbapenemase genes detected included OXA- 48, 181, KPC and NDM-1 with NDM-1 being the predominant carbapenemase in both ICU D1 and D4. Among the 50 CPE isolates, 8 (16 %) were susceptible to meropenem and imipenem (Minimum inhibitory concentration; MIC ≤ 1 mg/L) and all were susceptible to colistin (MIC range 0.125 - 1 mg/L) and tigecycline (MIC range 0.06- 1.5 mg/L). The risk factors associated with CPE carriage were duration of ICU stay, use of ventilator and aminoglycosides. Prior colonization with CPE could result in their influx and spread in ICU, challenging infection control measures. Exposure to ICU further increases risk of colonization with diverse carbapenemase-producing Enterobacteriaceae. Gut colonization with these strains may be a source of endogenous infection and horizontal transfer of these genes in future.

Quantum mechanical/molecular mechanical free energy simulations of the self-cleavage reaction in the hepatitis delta virus ribozyme.

PubMed

Ganguly, Abir; Thaplyal, Pallavi; Rosta, Edina; Bevilacqua, Philip C; Hammes-Schiffer, Sharon

2014-01-29

The hepatitis delta virus (HDV) ribozyme catalyzes a self-cleavage reaction using a combination of nucleobase and metal ion catalysis. Both divalent and monovalent ions can catalyze this reaction, although the rate is slower with monovalent ions alone. Herein, we use quantum mechanical/molecular mechanical (QM/MM) free energy simulations to investigate the mechanism of this ribozyme and to elucidate the roles of the catalytic metal ion. With Mg(2+) at the catalytic site, the self-cleavage mechanism is observed to be concerted with a phosphorane-like transition state and a free energy barrier of ∼13 kcal/mol, consistent with free energy barrier values extrapolated from experimental studies. With Na(+) at the catalytic site, the mechanism is observed to be sequential, passing through a phosphorane intermediate, with free energy barriers of 2-4 kcal/mol for both steps; moreover, proton transfer from the exocyclic amine of protonated C75 to the nonbridging oxygen of the scissile phosphate occurs to stabilize the phosphorane intermediate in the sequential mechanism. To explain the slower rate observed experimentally with monovalent ions, we hypothesize that the activation of the O2' nucleophile by deprotonation and orientation is less favorable with Na(+) ions than with Mg(2+) ions. To explore this hypothesis, we experimentally measure the pKa of O2' by kinetic and NMR methods and find it to be lower in the presence of divalent ions rather than only monovalent ions. The combined theoretical and experimental results indicate that the catalytic Mg(2+) ion may play three key roles: assisting in the activation of the O2' nucleophile, acidifying the general acid C75, and stabilizing the nonbridging oxygen to prevent proton transfer to it.

Geochemical background of zinc, cadmium and mercury in anthropically influenced soils in a semi-arid zone (SE, Spain)

NASA Astrophysics Data System (ADS)

García-Lorenzo, M. L.; Pérez-Sirvent, C.; Martínez-Sánchez, M. J.; Molina, J.; Tudela, M. L.; Hernández-Córdoba, M.

2009-04-01

This work seeks to establish the geochemical background for three potentially toxic trace elements (Zn, Cd and Hg) in a pilot zone included in the DesertNet project in the province of Murcia. The studied area, known as Campo de Cartagena, Murcia (SE Spain) is an area of intensive agriculture and has been much affected over the years by anthropic activity. The zone can be considered an experimental pilot zone for establishing background levels in agricultural soils. Sixty four samples were collected and corresponded to areas subjected to high and similar agricultural activity or soils with natural vegetation, which correspond to abandoned agricultural areas. The Zn content was determined by flame atomic absorption spectrometry. The Cd content was determined by electrothermal atomization atomic absorption spectrometry and mercury content was determined by atomic fluorescence spectrometry. Geostatistical analysis consisting of kriging and mapping was performed using the geostatistical analyst extension of ArcGIS 8.3. Zinc values ranged from 10 mg kg-1 to 151 mg kg-1, with an average value of 45 mg kg-1. Cadmium values ranged between 0.1 mg kg-1 and 0.9mg kg-1, with a mean value of 0.3 mg kg-1 and mercury values ranged from 0.1 mg kg-1 to 2.3 mg kg-1, with a mean value of 0.5 mg kg-1. At a national level, the Spanish Royal Decree 9/2005 proposes toxicological and statistical approaches to establish background values. According to the statistical approach, background values consist of the median value for the selected element. The background values for Zn, Cd and Hg in the studied area were 40 mg kg-1 for Zn, 0.3 mg kg-1 for Cd and 0.4 mg kg-1 for Hg.

A modified method for COD determination of solid waste, using a commercial COD kit and an adapted disposable weighing support.

PubMed

André, L; Pauss, A; Ribeiro, T

2017-03-01

The chemical oxygen demand (COD) is an essential parameter in waste management, particularly when monitoring wet anaerobic digestion processes. An adapted method to determine COD was developed for solid waste (total solids >15%). This method used commercial COD tubes and did not require sample dilution. A homemade plastic weighing support was used to transfer the solid sample into COD tubes. Potassium hydrogen phthalate and glucose used as standards showed an excellent repeatability. A small underestimation of the theoretical COD value (standard values around 5% lower than theoretical values) was also observed, mainly due to the intrinsic COD of the weighing support and to measurement uncertainties. The adapted COD method was tested using various solid wastes in the range of 1-8 mg COD , determining the COD of dried and ground cellulose, cattle manure, straw and a mixed-substrate sample. This new adapted method could be used to monitor and design dry anaerobic digestion processes.

Absence of evidence or evidence of absence? A transfer and depletion study of Sudan I in eggs.

PubMed

Piątkowska, Marta; Jedziniak, Piotr; Olejnik, Małgorzata; Żmudzki, Jan; Posyniak, Andrzej

2018-01-15

Sudan I is a carcinogenic industrial azo-dye, forbidden for use in food. However, it has been detected in food on several occasions, such as in paprika, used in animal husbandry to enhance egg yolk colour. Therefore, an animal experiment was designed to simulate the transfer of Sudan I to eggs after its unintentional administration to laying hens. A group of laying hens (n=18) received feed contaminated with Sudan I at the raising concentrations: 0.45mg/kg, 4.97mg/kg and 42.1mg/kg. Residues of Sudan I were detected in egg yolks (0.29±0.03µg/kg, mean±SD) only after the administration of the feed contaminated with the dye at the highest concentration. The determined concentrations were much lower than expected based on the compound's lipophilicity. In conclusion, the transfer of Sudan I to eggs was limited and strongly dependent on its concentration in feed. Copyright © 2017 Elsevier Ltd. All rights reserved.

Road deicing salt irreversibly disrupts osmoregulation of salamander egg clutches.

PubMed

Karraker, Nancy E; Gibbs, James P

2011-03-01

It has been postulated that road deicing salts are sufficiently diluted by spring rains to ameliorate any physiological impacts to amphibians breeding in wetlands near roads. We tested this conjecture by exposing clutches of the spotted salamander (Ambystoma maculatum) to three chloride concentrations (1 mg/L, 145 mg/L, 945 mg/L) for nine days, then transferred clutches to control water for nine days, and measured change in mass at three-day intervals. We measured mass change because water uptake by clutches reduces risks to embryos associated with freezing, predation, and disease. Clutches in controls sequestered water asymptotically. Those in the moderate concentrations lost 18% mass initially and regained 14% after transfer to control water. Clutches in high concentration lost 33% mass and then lost an additional 8% after transfer. Our results suggest that spring rains do not ameliorate the effects of deicing salts in wetlands with extremely high chloride concentrations. Copyright © 2010 Elsevier Ltd. All rights reserved.

Layered Crystal Structure, Color-Tunable Photoluminescence, and Excellent Thermal Stability of MgIn2P4O14 Phosphate-Based Phosphors.

PubMed

Zhang, Jing; Cai, Ge-Mei; Yang, Lv-Wei; Ma, Zhi-Yuan; Jin, Zhan-Peng

2017-11-06

Single-component white phosphors stand a good chance to serve in the next-generation high-power white light-emitting diodes. Because of low thermal stability and containing lanthanide ions with reduced valence state, most of reported phosphors usually suffer unstable color of lighting for practical packaging and comparably complex synthetic processes. In this work, we present a type of novel color-tunable blue-white-yellow-emitting MgIn 2 P 4 O 14 :Tm 3+ /Dy 3+ phosphor with high thermal stability, which can be easily fabricated in air. Under UV excitation, the MgIn 2 P 4 O 14 :Tm 0.02 Dy 0.03 white phosphor exhibits negligible thermal-quenching behavior, with a 99.5% intensity retention at 150 °C, relative to its initial value at room temperature. The phosphor host MgIn 2 P 4 O 14 was synthesized and reported for the first time. MgIn 2 P 4 O 14 crystallizes in the space group of C2/c (No. 15) with a novel layered structure built of alternate anionic and cationic layers. Its disordering structure, with Mg and In atoms co-occupying the same site, is believed to facilitate the energy transfer between rare-earth ions and benefit by sustaining the luminescence with increasing temperature. The measured absolute quantum yields of MgIn 2 P 4 O 14 :Dy 0.04 , MgIn 2 P 4 O 14 :Tm 0.01 Dy 0.04 , and MgIn 2 P 4 O 14 :Tm 0.02 Dy 0.03 phosphors under the excitation of 351 nm ultraviolet radiation are 70.50%, 53.24%, and 52.31%, respectively. Present work indicates that the novel layered MgIn 2 P 4 O 14 is a promising candidate as a single-component white phosphor host with an excellent thermal stability for near-UV-excited white-light-emitting diodes (wLEDs).

Treatment with proteasome inhibitor MG132 during cloning improves survival and pronuclear number of reconstructed rat embryos.

PubMed

Nakajima, Noriaki; Inomata, Tomo; Ito, Junya; Kashiwazaki, Naomi

2008-12-01

In several mammalian species including rats, successfully cloned animals have been generated using somatic cell nuclear transfer (SCNT). However, in the case of rats, additional treatment with MG132, a proteasome inhibitor, before enucleation of oocytes seems to be required for successful cloning because ovulated rat oocytes are spontaneously activated, and hence, their suppression is the key to successful cloning. A previous study on rats demonstrated that matured oocytes potentially possess lower cytostatic factor (CSF) activity compared to mouse oocytes, resulting in a low incidence of premature chromosome condensation in the reconstructed embryos after SCNT. It is known that mice having more than two pronuclei are generally observed in nuclear-transferred oocytes after induction of premature chromosome condensation, which implies successful reprogramming. This leads us to the hypothesis that MG132 treatment affects not only the inhibition of spontaneous activation but also the reprogramming and developmental ability of reconstructed rat embryos. If so, prolonged MG132 treatment during and/or after SCNT may further improve the survivability. However, the effect of MG132 treatment on reconstructed embryos after SCNT has been very limited in rats and other species. We show here that prolonged MG132 treatment during and after SCNT improves survival and the number of pronuclei in reconstructed rat embryos after activation. These reconstructed embryos treated before, during, and after SCNT showed significantly higher p34(cdc2) kinase activity involving CSF activity compared to that of the control embryos. On the other hand, p34(cdc2) kinase activity was not recovered in nuclear-transferred oocytes without MG132, which suggested that the enucleation had detrimental effects on the development of reconstructed oocytes. Taken together, MG132 treatment during SCNT increases survival and pronuclear numbers in reconstructed rat embryos via maintenance of high CSF activity. The data suggest that MG132 treatment is indispensable for at least rat SCNT.

First isolation and antinociceptive activity of a lipid transfer protein from noni (Morinda citrifolia) seeds.

PubMed

Campos, Dyély C O; Costa, Andrea S; Lima, Amanda D R; Silva, Fredy D A; Lobo, Marina D P; Monteiro-Moreira, Ana Cristina O; Moreira, Renato A; Leal, Luzia K A M; Miron, Diogo; Vasconcelos, Ilka M; Oliveira, Hermógenes D

2016-05-01

In this study a novel heat-stable lipid transfer protein, designated McLTP1, was purified from noni (Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg McLTP1 from 100g of noni seeds). McLTP1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of McLTP1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. McLTP1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 °C. Pretreatment of mice with McLTP1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of McLTP1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein. Copyright © 2016 Elsevier B.V. All rights reserved.

Charge Transfer and Orbital Level Alignment at Inorganic/Organic Interfaces: The Role of Dielectric Interlayers.

PubMed

Hollerer, Michael; Lüftner, Daniel; Hurdax, Philipp; Ules, Thomas; Soubatch, Serguei; Tautz, Frank Stefan; Koller, Georg; Puschnig, Peter; Sterrer, Martin; Ramsey, Michael G

2017-06-27

It is becoming accepted that ultrathin dielectric layers on metals are not merely passive decoupling layers, but can actively influence orbital energy level alignment and charge transfer at interfaces. As such, they can be important in applications ranging from catalysis to organic electronics. However, the details at the molecular level are still under debate. In this study, we present a comprehensive analysis of the phenomenon of charge transfer promoted by a dielectric interlayer with a comparative study of pentacene adsorbed on Ag(001) with and without an ultrathin MgO interlayer. Using scanning tunneling microscopy and photoemission tomography supported by density functional theory, we are able to identify the orbitals involved and quantify the degree of charge transfer in both cases. Fractional charge transfer occurs for pentacene adsorbed on Ag(001), while the presence of the ultrathin MgO interlayer promotes integer charge transfer with the lowest unoccupied molecular orbital transforming into a singly occupied and singly unoccupied state separated by a large gap around the Fermi energy. Our experimental approach allows a direct access to the individual factors governing the energy level alignment and charge-transfer processes for molecular adsorbates on inorganic substrates.

Through oven transfer adsorption-desorption interface for the analysis of methyl jasmonate in aromatic samples by on-line RPLC-GC.

PubMed

Flores, Gema; Blanch, Gracia Patricia; Ruiz del Castillo, Maria Luisa

2008-04-01

A fully automated method for the determination of medium volatility compounds in aromatic samples was developed. Specifically, the determination of methyl jasmonate in jasmine fragrances was performed by using the through oven transfer adsorption-desorption (TOTAD) interface for the on-line coupling between RPLC-GC. A study of the most relevant variables involved in the performance of the TOTAD interface for medium volatility compounds was carried out by testing different values of helium flow (100, 300, 400, and 500 mL/min), transfer speed (0.1, 0.3, 0.5, and 2.0 mL/min), and methanol/water percentages (86:14, 85:15, 83:17, 80:20, and 70:30). The method developed provided satisfactory repeatability (RSD for retention times of 0.15% and for peak areas of 9.4%) and recovery (71%) as well as excellent LOD (0.01 mg/L) for methyl jasmonate in commercial jasmine essence under the experimental conditions selected as optimum. Additional advantages of the automated RPLC-TOTAD-GC method proposed in the present work are its rapidness, reliability, and the possibility of directly introducing the sample with no further pretreatment.

Comparison of in vitro tests for evaluation of passive transfer of immunoglobulins in giraffe (Giraffa camelopardalis).

PubMed

Miller, M; Coville, B; Abou-Madi, N; Olsen, J

1999-03-01

Serum samples from captive giraffe (Giraffa camelopardalis) were tested to assess passive transfer of immunoglobulins using in vitro methods developed for domestic ruminants. Estimated immunoglobulin levels were compared using five tests (protein electrophoresis, total protein refractometry, zinc sulfate turbidity, glutaraldehyde coagulation, and sodium sulfite turbidity). A linear relationship was observed among total protein, gamma globulin (electrophoretic measurement), and immunoglobulin level based on spectrophotometric measurement of zinc sulfate turbidity. Nonquantitative assays also demonstrated statistical correlation with the quantitative methods. Using criteria similar to those established for domestic species, cutoff values for failure of passive transfer (FPT) were established for these tests in neonatal giraffe: 1) total protein <6.0 g/dl; 2) gamma globulin < 0.5 g/dl; 3) estimated immunoglobulin level < 1,000 mg/dl (zinc sulfate turbidity); 4) glutaraldehyde coagulation test negative; or 5) no visually detectable turbidity in 16% sodium sulfite or Bova-S negative. Retrospective examination of the medical histories showed a strong statistical association between animals designated as having FPT and those that were removed from their dams based on clinical assessment to be hand-reared. Application of these tests in the field should allow earlier detection and intervention for FPT in neonatal giraffe.

Optimization of ultrasound-assisted extraction to obtain mycosterols from Agaricus bisporus L. by response surface methodology and comparison with conventional Soxhlet extraction.

PubMed

Heleno, Sandrina A; Diz, Patrícia; Prieto, M A; Barros, Lillian; Rodrigues, Alírio; Barreiro, Maria Filomena; Ferreira, Isabel C F R

2016-04-15

Ergosterol, a molecule with high commercial value, is the most abundant mycosterol in Agaricus bisporus L. To replace common conventional extraction techniques (e.g. Soxhlet), the present study reports the optimal ultrasound-assisted extraction conditions for ergosterol. After preliminary tests, the results showed that solvents, time and ultrasound power altered the extraction efficiency. Using response surface methodology, models were developed to investigate the favourable experimental conditions that maximize the extraction efficiency. All statistical criteria demonstrated the validity of the proposed models. Overall, ultrasound-assisted extraction with ethanol at 375 W during 15 min proved to be as efficient as the Soxhlet extraction, yielding 671.5 ± 0.5mg ergosterol/100 g dw. However, with n-hexane extracts with higher purity (mg ergosterol/g extract) were obtained. Finally, it was proposed for the removal of the saponification step, which simplifies the extraction process and makes it more feasible for its industrial transference. Copyright © 2015 Elsevier Ltd. All rights reserved.

Transplacental transfer of polychlorinated biphenyls and polybrominated diphenyl ethers in arctic beluga whales (Delphinapterus leucas).

PubMed

Desforges, Jean-Pierre W; Ross, Peter S; Loseto, Lisa L

2012-02-01

This study found that arctic beluga whales (Delphinapterus leucas) transferred, on average, 11.4% (7.5 mg) and 11.1% (0.1 mg) of their polychlorinated biphenyl (PCB) and polybrominated diphenyl ether (PBDE) blubber burden to their near-term fetuses. A single physicochemical parameter, log K(OW), largely explained this transplacental transfer for PCBs (r(2) =0.79, p < 0.00001) and PBDEs (r(2) = 0.37, p = 0.007), with congeners having a log K(OW) < 6.5 preferentially transferred to the fetus. Blubber concentrations of 257 ng/g lipid weight (lw) PCBs and 3.8 ng/g (lw) PBDEs in beluga fetuses highlights the exposure to endocrine-disrupting compounds during a critical developmental stage. The implications of detecting these levels of legacy PCBs and the flame retardant PBDEs in unborn arctic beluga are unclear. Copyright © 2011 SETAC.

Excited state complex formation between methyl glyoxal and some aromatic bio-molecules: a fluorescence quenching study

NASA Astrophysics Data System (ADS)

Banerjee, D.; Mandal, A.; Mukherjee, S.

2003-01-01

Fluorescence quenching of some important aromatic bio-molecules (ABM) such as 3-aminophthalhydrazide (luminol), tryptophan (Try), phenylalanine and tyrosine (Tyr) by methyl glyoxal (MG) has been studied employing different spectroscopic techniques. The interaction of MG with ABM in the excited state has been analysed using Stern-Volmer (S-V) mechanism. In the case of MG-luminol system time correlated single photon counting (TCSPC) technique has also been applied to explain the S-V mechanism. The bimolecular rate constants obtained are found to be higher than the rate constant for diffusion controlled process. A plausible explanation of the quenching mechanism has been discussed on the basis of hydrogen bonding, charge transfer and energy transfer interaction between the colliding species.

Synthesis, energy transfer and luminescence properties of Ca{sub 2}MgWO{sub 6}:Sm{sup 3+}, Bi{sup 3+} phosphor

DOE Office of Scientific and Technical Information (OSTI.GOV)

Cao, Renping, E-mail: jxcrp@163.com; Xu, Haidong; Luo, Wenjie

Graphical abstract: PL spectra of Ca{sub 2}MgWO{sub 6}:Sm{sup 3+} and Ca{sub 2}MgWO{sub 6}:Sm{sup 3+}, Bi{sup 3+} phosphors with excitation at 407 nm, and the corresponding CIE chromaticity diagram and chromaticity coordinates. - Highlights: • Novel Ca{sub 2}MgWO{sub 6}:Sm{sup 3+}, Bi{sup 3+} phosphor is synthesized by solid-state reaction method in air. • Emission intensity of Ca{sub 2}MgWO{sub 6}:Sm{sup 3+} phosphor is enhanced ∼2 times after co-doped Bi{sup 3+} ion. • Charge compensation and energy transfer may be explained via luminescence properties. • Luminous mechanism is analyzed by energy level diagrams of WO{sub 6}{sup 6−} group, Sm{sup 3+} and Bi{sup 3+} ions.more » - Abstract: Novel Ca{sub 2}MgWO{sub 6}:Sm{sup 3+}, Bi{sup 3+} phosphor is synthesized by solid-state reaction method in air. Host Ca{sub 2}MgWO{sub 6} with excitation 300 nm emits blue light. Ca{sub 2}MgWO{sub 6}:Bi{sup 3+} phosphor with excitation 300 and 338 nm emits yellow light. Ca{sub 2}MgWO{sub 6}:Sm{sup 3+} phosphor with excitation 300 nm exhibits tunable emission from blue to red light by increasing Sm{sup 3+} doping concentration from 0 to 8 mol%, however, only emits red light with excitation 407 nm. Ca{sub 2}MgWO{sub 6}:Sm{sup 3+}, Bi{sup 3+} phosphor with excitation 300 and 338 nm emits red light. The optimal Sm{sup 3+} doping concentration is ∼5 mol% in Ca{sub 2}MgWO{sub 6}:Sm{sup 3+} phosphor. After Bi{sup 3+} ion is co-doped, luminescence properties of Ca{sub 2}MgWO{sub 6}:Sm{sup 3+} phosphor can be improved obviously because of Bi{sub 2}O{sub 3} as fluxing agent role and energy transfer from Bi{sup 3+} to Sm{sup 3+} ions. The possible luminous mechanism of Ca{sub 2}MgWO{sub 6}:Sm{sup 3+}, Bi{sup 3+} phosphor is analyzed and explained by simplified energy level diagrams of WO{sub 6}{sup 6−} group, Bi{sup 3+} and Sm{sup 3+} ions.« less

In-situ analysis of the slip activity during tensile deformation of cast and extruded Mg-10Gd-3Y-0.5Zr (wt.%) at 250 °C

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wang, H.; The State Key Laboratory of Metal Matrix Composites, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240; Department of Chemical Engineering and Materials Science, Michigan State University, East Lansing, MI 48824

The slip activity and slip interaction in tensile deformation of peak-aged cast and extruded Mg-10Gd-3Y-0.5Zr (wt.%) at 250 °C was investigated using in-situ scanning electron microscopy. Basal slip was the most likely system to be activated during the tensile deformation, while prismatic < a > and pyramidal < c + a > slip also contributed to the deformation. No twinning was observed. The number of non-basal slip systems accounted for ~ 36% of the total active slip systems for the cast alloy, while non-basal slip accounted for 12–17% of the total deformation observations in the extruded alloy. Multiple-slip was observedmore » within grains, and the basal/prismatic pairing type dominated the multiple-slip observations. Slip transfer occurred across grain boundaries and most of the slip transfer observations showed basal-basal type. The involved slip systems of slip transfer pairs were always associated with the same < a > direction. The slip transfer occurred more easily at low angle boundaries (LABs) and boundaries with misorientations greater than 75°. - Highlights: • Slip deformation of a Mg-RE alloy at 250 °C was investigated using in-situ SEM. • The extruded-T5 GW103 alloy did not exhibit a high anisotropic behavior. • Multiple-slip was observed within grains, and basal/prismatic type dominated. • Slip transfer occurred and most of the observations showed basal-basal type. • Slip transfer occurred more easily at LABs and boundaries with misorientations > 75°.« less

The effect of microbubbles on gas-liquid mass transfer coefficient and degradation rate of COD in wastewater treatment.

PubMed

Yao, Kangning; Chi, Yong; Wang, Fei; Yan, Jianhua; Ni, Mingjiang; Cen, Kefa

2016-01-01

A commonly used aeration device at present has the disadvantages of low mass transfer rate because the generated bubbles are several millimeters in diameter which are much bigger than microbubbles. Therefore, the effect of a microbubble on gas-liquid mass transfer and wastewater treatment process was investigated. To evaluate the effect of each bubble type, the volumetric mass transfer coefficients for microbubbles and conventional bubbles were determined. The volumetric mass transfer coefficient was 0.02905 s(-1) and 0.02191 s(-1) at a gas flow rate of 0.67 L min(-1) in tap water for microbubbles and conventional bubbles, respectively. The degradation rate of simulated municipal wastewater was also investigated, using aerobic activated sludge and ozone. Compared with the conventional bubble generator, the chemical oxygen demand (COD) removal rate was 2.04, 5.9, 3.26 times higher than those of the conventional bubble contactor at the same initial COD concentration of COD 200 mg L(-1), 400 mg L(-1), and 600 mg L(-1), while aerobic activated sludge was used. For the ozonation process, the rate of COD removal using microbubble generator was 2.38, 2.51, 2.89 times of those of the conventional bubble generator. Based on the results, the effect of initial COD concentration on the specific COD degradation rate were discussed in different systems. Thus, the results revealed that microbubbles could enhance mass transfer in wastewater treatment and be an effective method to improve the degradation of wastewater.

Environmental Controls on Mg/Ca in Neogloboquadrina incompta: A Core-Top Study From the Subpolar North Atlantic

NASA Astrophysics Data System (ADS)

Morley, Audrey; Babila, Tali L.; Wright, James; Ninnemann, Ulysses; Kleiven, Kikki; Irvali, Nil; Rosenthal, Yair

2017-12-01

Magnesium/calcium paleothermometry is an established tool for reconstructing past surface and deep-sea temperatures. However, our understanding of nonthermal environmental controls on the uptake of Mg into the calcitic lattice of foraminiferal tests remains limited. Here we present a combined analysis of multiple trace element/calcium ratios and stable isotope (δ18O and δ13C) geochemistry on the subpolar planktonic foraminifera Neogloboquadrina incompta to assess the validity of Mg/Ca as a proxy for surface ocean temperature. We identify small size-specific offsets in Mg/Ca and δ18Oc values for N. incompta that are consistent with depth habitat migration patterns throughout the life cycle of this species. Additionally, an assessment of nonthermal controls on Mg/Ca values reveals that (1) the presence of volcanic ash, (2) the addition of high-Mg abiotic overgrowths, and (3) ambient seawater carbonate chemistry can have a significant impact on the Mg/Ca-to-temperature relationship. For carbonate-ion concentrations of values > 200 μmol kg-1, we find that temperature exerts the dominant control on Mg/Ca values, while at values < 200 μmol kg-1 the carbonate-ion concentration of seawater increases the uptake of Mg, thereby resulting in higher-than-expected Mg/Ca values at low temperatures. We propose two independent correction schemes to remove the effects of volcanic ash and carbonate-ion concentration on Mg/Ca values in N. incompta within the calibration data set. Applying the corrections improves the fidelity of past ocean temperature reconstructions.

Origin of interfacial perpendicular magnetic anisotropy in MgO/CoFe/metallic capping layer structures

NASA Astrophysics Data System (ADS)

Peng, Shouzhong; Wang, Mengxing; Yang, Hongxin; Zeng, Lang; Nan, Jiang; Zhou, Jiaqi; Zhang, Youguang; Hallal, Ali; Chshiev, Mairbek; Wang, Kang L.; Zhang, Qianfan; Zhao, Weisheng

2015-12-01

Spin-transfer-torque magnetic random access memory (STT-MRAM) attracts extensive attentions due to its non-volatility, high density and low power consumption. The core device in STT-MRAM is CoFeB/MgO-based magnetic tunnel junction (MTJ), which possesses a high tunnel magnetoresistance ratio as well as a large value of perpendicular magnetic anisotropy (PMA). It has been experimentally proven that a capping layer coating on CoFeB layer is essential to obtain a strong PMA. However, the physical mechanism of such effect remains unclear. In this paper, we investigate the origin of the PMA in MgO/CoFe/metallic capping layer structures by using a first-principles computation scheme. The trend of PMA variation with different capping materials agrees well with experimental results. We find that interfacial PMA in the three-layer structures comes from both the MgO/CoFe and CoFe/capping layer interfaces, which can be analyzed separately. Furthermore, the PMAs in the CoFe/capping layer interfaces are analyzed through resolving the magnetic anisotropy energy by layer and orbital. The variation of PMA with different capping materials is attributed to the different hybridizations of both d and p orbitals via spin-orbit coupling. This work can significantly benefit the research and development of nanoscale STT-MRAM.

Origin of interfacial perpendicular magnetic anisotropy in MgO/CoFe/metallic capping layer structures.

PubMed

Peng, Shouzhong; Wang, Mengxing; Yang, Hongxin; Zeng, Lang; Nan, Jiang; Zhou, Jiaqi; Zhang, Youguang; Hallal, Ali; Chshiev, Mairbek; Wang, Kang L; Zhang, Qianfan; Zhao, Weisheng

2015-12-11

Spin-transfer-torque magnetic random access memory (STT-MRAM) attracts extensive attentions due to its non-volatility, high density and low power consumption. The core device in STT-MRAM is CoFeB/MgO-based magnetic tunnel junction (MTJ), which possesses a high tunnel magnetoresistance ratio as well as a large value of perpendicular magnetic anisotropy (PMA). It has been experimentally proven that a capping layer coating on CoFeB layer is essential to obtain a strong PMA. However, the physical mechanism of such effect remains unclear. In this paper, we investigate the origin of the PMA in MgO/CoFe/metallic capping layer structures by using a first-principles computation scheme. The trend of PMA variation with different capping materials agrees well with experimental results. We find that interfacial PMA in the three-layer structures comes from both the MgO/CoFe and CoFe/capping layer interfaces, which can be analyzed separately. Furthermore, the PMAs in the CoFe/capping layer interfaces are analyzed through resolving the magnetic anisotropy energy by layer and orbital. The variation of PMA with different capping materials is attributed to the different hybridizations of both d and p orbitals via spin-orbit coupling. This work can significantly benefit the research and development of nanoscale STT-MRAM.

Somatic embryogenesis, pigment accumulation, and synthetic seed production in Digitalis davisiana Heywood.

PubMed

Verma, Sandeep Kumar; Sahin, Gunce; Gurel, Ekrem

2016-04-01

Digitalis davisiana, commonly called Alanya foxglove, from Turkey, is an important medicinal herb as the main source of cardiac glycosides, cardenolides, anthraquinones, etc. It is also known in the Indian Medicine for treatment of wounds and burns. It has ornamental value as well. Overexploitation of D. davisiana has led this species to be declared protected, and thereby encouraged various methods for its propagation. In this study, an optimized and efficient plant tissue culture protocol was established using cotyledonary leaf, hypocotyl and root explants of D. davisiana. Callus tissues were obtained from the cotyledonary leaf, hypocotyl and root segments cultured on Murashige and Skoog's (MS) medium containing different plant growth regulators. The maximum number of somatic embryos were achieved by the MS medium containing 6-benzyladenine (1.0 mg/L BAP) or 2,4-dichlorophenoxy acetic acids (0.1 mg/L 2,4-D), which produced an average of 8.3 ± 1.5 or 5.3 ± 1.5 embryos per cotyledonary leaf, respectively. After 3 wk of culture in MS medium supplemented with 1.0 mg/L 2,4-D, callus showed a clear accumulation of orange pigmentation. Shoot regeneration was remarkably higher (14.3 indirect shoots) in a combination of α-naphthalene acetic acid (0.25 mg/L NAA) plus 3.0 mg/L BAP than 2.0 mg/L zeatin (10.3 ± 0.5 direct shoots) alone. The shoots were successfully rooted on MS medium supplemented with NAA (0.1-1.0 mg/L). In addition, synthetic seeds were produced by encapsulating shoot tips in 4% sodium alginate solution. Maximum conversion frequency of 76.6% was noted from encapsulated shoot tips cultured on 0.25 mg/L NAA with 1.0 mg/L BAP. The encapsulated shoot tips could be stored up to 60 days at 4 °C. Regenerated plantlets of D. davisiana were successfully acclimatized and transferred to soil. This study has demonstrated successful preservation of elite genotypes of D. davisiana.

Diffusion coefficients of Mg isotopes in MgSiO3 and Mg2SiO4 melts calculated by first-principles molecular dynamics simulations

NASA Astrophysics Data System (ADS)

Liu, Xiaohui; Qi, Yuhan; Zheng, Daye; Zhou, Chen; He, Lixin; Huang, Fang

2018-02-01

The mass dependence of diffusion coefficient (D) can be described in the form of Di/Dj = (mj/mi)β, where m denotes masses of isotope i and j, and β is an empirical parameter as used to quantify the diffusive transport of isotopes. Recent advances in computation techniques allow theoretically calculation of β values. Here, we apply first-principles Born-Oppenheimer molecular dynamics (MD) and pseudo-isotope method (taking mj/mi = 1/24, 6/24, 48/24, 120/24) to estimate β for MgSiO3 and Mg2SiO4 melts. Our calculation shows that β values for Mg calculated with 24Mg and different pseudo Mg isotopes are identical, indicating the reliability of the pseudo-isotope method. For MgSiO3 melt, β is 0.272 ± 0.005 at 4000 K and 0 GPa, higher than the value calculated using classical MD simulations (0.135). For Mg2SiO4 melt, β is 0.184 ± 0.006 at 2300 K, 0.245 ± 0.007 at 3000 K, and 0.257 ± 0.012 at 4000 K. Notably, β values of MgSiO3 and Mg2SiO4 melts are significantly higher than the value in basalt-rhyolite melts determined by chemical diffusion experiments (0.05). Our results suggest that β values are not sensitive to the temperature if it is well above the liquidus, but can be significantly smaller when the temperature is close to the liquidus. The small difference of β between silicate liquids with simple compositions of MgSiO3 and Mg2SiO4 suggests that the β value may depend on the chemical composition of the melts. This study shows that first-principles MD provide a promising tool to estimate β of silicate melts.

Electrically driven ion separations and nanofiltration through membranes coated with polyelectrolyte multilayers

NASA Astrophysics Data System (ADS)

White, Nicholas

Polyelectrolyte multilayer (PEM) films deposited using the layer-by-layer (LBL) method are attractive for their simple deposition, tailorable nature, scalability, and charge or size-based selectivity for solutes. This dissertation explores ion separations in electrodialysis (ED) and solute removal through nanofiltration with PEMs deposited on polymer membranes. ED membranes typically exhibit modest selectivities between monovalent and divalent ions. In contrast, this work shows that K+/Mg 2+ ED selectivities reach values >1000 when using Nafion 115 cation-exchange membranes coated with multilayer poly(4-styrenesulfonate) (PSS)/protonated poly(allylamine) (PAH) films. For comparison, the corresponding K+ /Mg2+ selectivity of bare Nafion 115 is <2. However, water-splitting at strongly overlimiting current densities may lead to a local pH increase close to the membrane surface and alter film permeability or allow passage of Mg(OH)x species to decrease selectivity. When the source phase contains high salt concentrations, the K+ transference number approaches unity and the K+/Mg2+ selectivity is >20,000, presumably because the applied current is below the limiting value for K+ and H+ transport is negligible at this high K+ concentration. The high selectivities of these membranes may enable electrodialysis applications such as purification of salts that contain divalent or trivalent ions. The high ED selectivities of (PAH/PSS)5PAH-coated Nafion membranes translate to separations with Li+/Co2+ and K +/La3+. Even with adsorption of only 3 polyelectrolyte layers, Nafion membranes exhibit a Li+/Co2+ selectivity >23. However, the resistance to monovalent-ion passage does not decrease significantly with fewer polyelectrolyte layers. At overlimiting currents, hydroxides from water splitting form insoluble metal hydroxides to foul the membrane. With 0.1 M source-phase salt concentrations, transference numbers for monovalent cations approach unity and selectivities are >5000 because the diffusion-limited K+ or Li+ currents exceed the applied current. However, ED selectivities gradually decline with time. Thus, future research should aim to increase membrane stability and limiting currents to fully exploit the remarkable selectivity of these membranes. PEMs deposited on commercial ultrafiltration (UF) membranes also show high rejections of organic dyes. Coating the surface of polyethersulfone (PES) membranes imparts a selective barrier to dye molecules used in textile production. These films achieve dye rejections >98% and may be useful for wastewater treatment and dye recovery. Other studies in microfluidic channels exploit ion transport phenomena in the vicinity of ion-selective junctions, such as cation-exchange membranes. These studies suggest that ion concentration polarization (ICP) could remove charged species from feed streams.

Compressibility and thermal expansion of hydrous ringwoodite with 2.5(3) wt% H[subscript 2]O

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ye, Yu; Brown, David A.; Smyth, Joseph R.

Ringwoodite ({gamma}-Mg{sub 2}SiO{sub 4}) is the stable polymorph of olivine in the transition zone between 525-660 km depth, and can incorporate weight percent amounts of H{sub 2}O as hydroxyl, with charge compensated mainly by Mg vacancies (Mg{sup 2+} = 2H{sup +}), but also possibly as (Si{sup 4+} = 4H{sup +} and Mg{sup 2+} + 2H{sup +} = Si{sup 4+}). We synthesized pure Mg ringwoodite containing 2.5(3) wt% H{sub 2}O, measured by secondary ion mass spectrometry (SIMS), and determined its compressibility at 300 K by single-crystal and powder X-ray diffraction (XRD), as well as its thermal expansion behavior between 140 andmore » 740 K at room pressure. A third-order Birch-Murnaghan equation of state (BM3 EOS) fits values of the isothermal bulk modulus K{sub T0} = 159(7) GPa and (dK{sub T}/dP){sub P = 0} = K' = 6.7(7) for single-crystal XRD; K{sub T0} = 161(4) GPa and K' = 5.4(6) for powder XRD, with K{sub T0} = 160(2) GPa and K' = 6.2(3) for the combined data sets. At room pressure, hydrous ringwoodite breaks down by an irreversible unit-cell expansion above 586 K, which may be related to dehydration and changes in the disorder mechanisms. Single-crystal intensity data were collected at various temperatures up to 736 K, and show that the cell volume V(cell) has a mean thermal expansion coefficient {alpha}{sub V0} of 40(4) x 10{sup -6}/K (143-736 K), and 29(2) x 10{sup -6}/K (143-586 K before irreversible expansion). V(Mg) have {alpha}{sub 0} values of 41(3) x 10{sup -6}/K (143-736 K), and V(Si) has {alpha}{sub 0} values of 20(3) x 10{sup -6}/K (143-586 K) and 132(4) x 10{sup -6}K (586-736 K). Based on the experimental data and previous work from {sup 29}Si NMR, we propose that during the irreversible expansion, a small amount of H{sup +} cations in Mg sites transfer to Si sites without changing the cubic spinel structure of ringwoodite, and the substituted Si{sup 4+} cations move to the normally vacant octahedral site at (1/2, 1/2, 0). Including new SIMS data on this and several Mg-ringwoodite samples from previous studies, we summarize volume-hydration data and show that the Mg{sup 2+} = 2H{sup +} dominates up to about 2 wt% H{sub 2}O, where a discontinuity in the volume vs. H{sub 2}O content trend suggests that other hydration mechanisms become important at very high H{sub 2}O contents.« less

Radiation tolerant 1 micron CMOS technology

NASA Astrophysics Data System (ADS)

Crevel, P.; Rodde, K.

1991-03-01

Starting from a standard one micron Complementary Metal Oxide Semiconductor (CMOS) for high density, low power memory applications, the degree of radiation tolerance of the baseline process is evaluated. Implemented process modifications to improve latchup sensitivity under heavy ion irradiation as well as total dose effects without changing layout rules are described. By changing doping profiles in Metal Nitride Oxide Semiconductors (MNOS) and P-channel MOS (PMOS) device regions, it is possible to guarantee data sheet specification of a 64 K low power static RAM for total gamma dose up to 35 krad (Si) (and even higher values for the gate array family) without latch up for Linear Energy Transfer LET up to 115 MeV/(mg/cm squared).

26 CFR 1.679-4 - Exceptions to general rule.

Code of Federal Regulations, 2010 CFR

2010-04-01

... property to a foreign trust to the extent the transfer is for fair market value. (b) Transfers for fair market value—(1) In general. For purposes of this section, a transfer is for fair market value only to... trust are transfers for fair market value only to the extent that the payments reflect an arm's length...

Evaluation of chlorpyrifos transferred from contaminated feed to duck commodities and dietary risks to Chinese consumers.

PubMed

Li, Rui; Ji, Xiaofeng; He, Liang; Liu, Zhiqiang; Wei, Wei; Qiang, Mingrong; Wang, Qiang; Yuan, Yuwei

2015-06-03

The present study describes chlorpyrifos residues in duck commodities through the duck food chain, transfer factors, and dietary risks to Chinese consumers. After duck feeding experiments with pellet feed that lasted for 42 days, chlorpyrifos residues found in all samples collected from the ducks on maximum estimated dose group (3.20 mg/kg level) were from <0.0005 to 0.019 mg/kg. The residue levels of the fat, intestine, and tongue were obviously higher than those of the meat and other edible tissues. The transfer factors of all duck commodities were from 0.0001 to 0.0049 among different contamination levels, which indicated that chlorpyrifos had a low persistency in duck meat and metabolism organs. The chronic exposure assessment revealed that only 0.034-0.150% of the acceptable daily intake (ADI; 0-0.01 mg/kg/bw/day) of chlorpyrifos was consumed via the duck commodities for different age and gender groups in China. The acute exposure assessments of different age and gender groups were only 0.019-0.082% of the acute reference dose (ARfD; 0-0.1 mg/kg/bw). The results show that the single dietary exposure risk of chlorpyrifos raised by the intake of duck commodities was quite low in China.

Assessing the effect of sodium dichloroisocyanurate concentration on transfer of Salmonella enterica serotype Typhimurium in wash water for production of minimally processed iceberg lettuce (Lactuca sativa L.).

PubMed

Maffei, D F; Sant'Ana, A S; Monteiro, G; Schaffner, D W; Franco, B D G M

2016-06-01

This study evaluated the impact of sodium dichloroisocyanurate (5, 10, 20, 30, 40, 50 and 250 mg l(-1) ) in wash water on transfer of Salmonella Typhimurium from contaminated lettuce to wash water and then to other noncontaminated lettuces washed sequentially in the same water. Experiments were designed mimicking the conditions commonly seen in minimally processed vegetable (MPV) processing plants in Brazil. The scenarios were as follows: (1) Washing one inoculated lettuce portion in nonchlorinated water, followed by washing 10 noninoculated portions sequentially. (2) Washing one inoculated lettuce portion in chlorinated water followed by washing five noninoculated portions sequentially. (3) Washing five inoculated lettuce portions in chlorinated water sequentially, followed by washing five noninoculated portions sequentially. (4) Washing five noninoculated lettuce portions in chlorinated water sequentially, followed by washing five inoculated portions sequentially and then by washing five noninoculated portions sequentially in the same water. Salm. Typhimurium transfer from inoculated lettuce to wash water and further dissemination to noninoculated lettuces occurred when nonchlorinated water was used (scenario 1). When chlorinated water was used (scenarios 2, 3 and 4), no measurable Salm. Typhimurium transfer occurred if the sanitizer was ≥10 mg l(-1) . Use of sanitizers in correct concentrations is important to minimize the risk of microbial transfer during MPV washing. In this study, the impact of sodium dichloroisocyanurate in the wash water on transfer of Salmonella Typhimurium from inoculated lettuce to wash water and then to other noninoculated lettuces washed sequentially in the same water was evaluated. The use of chlorinated water, at concentration above 10 mg l(-1) , effectively prevented Salm. Typhimurium transfer under several different washing scenarios. Conversely, when nonchlorinated water was used, Salm. Typhimurium transfer occurred in up to at least 10 noninoculated batches of lettuce washed sequentially in the same water. © 2016 The Society for Applied Microbiology.

[Pollutants produced in municipal refuse container during transfer process].

PubMed

Wang, Xiao-Yuan; Liu, Yin-Hua; Wang, Fei; Huang, Chang-Ying; Lu, Feng; Xie, Bing

2014-05-01

The generation and variation of the secondary pollutants in containers during seasons of a year were investigated in a municipal refuse transfer station of Shanghai. The results showed that the primary odors, the concentration of H2S was in a range of 0.3-10.3 mg.m-3, CH4 was in a range of 0.02% -2.97% and NH3 was in a range of 0.7-4.5 mg m-3, and their concentrations all reached the peak in the summer. The pH of the leachate was in a range of 5.4-6. 3, COD was 41 633-84 060 mgL- 1, and BOD, was 18 116-34 130 mg.L , the concentration of pollutants were all higher in winter than that in summer. The ammonia concentration of leachate was in a range of 537-1222 mg.L'', while the TP fluctuated acutely in a range of 17.98-296 mg L-1, exhibiting the relationship with seasonal variation. Extreme temperatures especially the high temperature in summer significantly affected air pollution producing, which indicated that containers should be kept against high temperature exposure and long residence time in order to prevent flammable gases and other pollutants generated largely.

Strain effect on the adsorption, diffusion, and molecular dissociation of hydrogen on Mg (0001) surface

NASA Astrophysics Data System (ADS)

Lei, Huaping; Wang, Caizhuang; Yao, Yongxin; Wang, Yangang; Hupalo, Myron; McDougall, Dan; Tringides, Michael; Ho, Kaiming

2013-12-01

The adsorption, diffusion, and molecular dissociation of hydrogen on the biaxially strained Mg (0001) surface have been systematically investigated by the first principle calculations based on density functional theory. When the strain changes from the compressive to tensile state, the adsorption energy of H atom linearly increases while its diffusion barrier linearly decreases oppositely. The dissociation barrier of H2 molecule linearly reduces in the tensile strain region. Through the chemical bonding analysis including the charge density difference, the projected density of states and the Mulliken population, the mechanism of the strain effect on the adsorption of H atom and the dissociation of H2 molecule has been elucidated by an s-p charge transfer model. With the reduction of the orbital overlap between the surface Mg atoms upon the lattice expansion, the charge transfers from p to s states of Mg atoms, which enhances the hybridization of H s and Mg s orbitals. Therefore, the bonding interaction of H with Mg surface is strengthened and then the atomic diffusion and molecular dissociation barriers of hydrogen decrease accordingly. Our works will be helpful to understand and to estimate the influence of the lattice deformation on the performance of Mg-containing hydrogen storage materials.

Density functional theory study of small X-doped Mg(n) (X = Fe, Co, Ni, n = 1-9) bimetallic clusters: equilibrium structures, stabilities, electronic and magnetic properties.

PubMed

Kong, Fanjie; Hu, Yanfei

2014-03-01

The geometries, stabilities, and electronic and magnetic properties of Mg(n) X (X = Fe, Co, Ni, n = 1-9) clusters were investigated systematically within the framework of the gradient-corrected density functional theory. The results show that the Mg(n)Fe, Mg(n)Co, and Mg(n)Ni clusters have similar geometric structures and that the X atom in Mg(n)X clusters prefers to be endohedrally doped. The average atomic binding energies, fragmentation energies, second-order differences in energy, and HOMO-LUMO gaps show that Mg₄X (X = Fe, Co, Ni) clusters possess relatively high stability. Natural population analysis was performed and the results showed that the 3s and 4s electrons always transfer to the 3d and 4p orbitals in the bonding atoms, and that electrons also transfer from the Mg atoms to the doped atoms (Fe, Co, Ni). In addition, the spin magnetic moments were analyzed and compared. Several clusters, such as Mg₁,₂,₃,₄,₅,₆,₈,₉Fe, Mg₁,₂,₄,₅,₆,₈,₉Co, and Mg₁,₂,₅,₆,₇,₉Ni, present high magnetic moments (4 μ(B), 3 μ(B), and 2 μ(B), respectively).

Understanding the initial stages of reversible Mg deposition and stripping in inorganic nonaqueous electrolytes

DOE PAGES

Canepa, Pieremanuele; Gautam, Gopalakrishnan Sai; Malik, Rahul; ...

2015-04-08

Multivalent (MV) battery architectures based on pairing a Mg metal anode with a high-voltage (~3 V) intercalation cathode offer a realistic design pathway toward significantly surpassing the energy storage performance of traditional Li-ion-based batteries, but there are currently only few electrolyte systems that support reversible Mg deposition. Using both static first-principles calculations and ab initio molecular dynamics, we perform a comprehensive adsorption study of several salt and solvent species at the interface of Mg metal with an electrolyte of Mg 2+ and Cl–dissolved in liquid tetrahydrofuran (THF). Our findings not only provide a picture of the stable species at themore » interface but also explain how this system can support reversible Mg deposition, and as such, we provide insights in how to design other electrolytes for Mg plating and stripping. Furthermore, the active depositing species are identified to be (MgCl) + monomers coordinated by THF, which exhibit preferential adsorption on Mg compared to possible passivating species (such as THF solvent or neutral MgCl 2 complexes). We found that upon deposition, the energy to desolvate these adsorbed complexes and facilitate charge transfer is shown to be small (~61–46.2 kJ mol –1 to remove three THF from the strongest adsorbing complex), and the stable orientations of the adsorbed but desolvated (MgCl) + complexes appear to be favorable for charge transfer. Lastly, observations of Mg–Cl dissociation at the Mg surface at very low THF coordinations (0 and 1) suggest that deleterious Cl incorporation in the anode may occur upon plating. In the stripping process, this is beneficial by further facilitating the Mg removal reaction.« less

Understanding the initial stages of reversible Mg deposition and stripping in inorganic nonaqueous electrolytes

DOE Office of Scientific and Technical Information (OSTI.GOV)

Canepa, Pieremanuele; Gautam, Gopalakrishnan Sai; Malik, Rahul

Multivalent (MV) battery architectures based on pairing a Mg metal anode with a high-voltage (~3 V) intercalation cathode offer a realistic design pathway toward significantly surpassing the energy storage performance of traditional Li-ion-based batteries, but there are currently only few electrolyte systems that support reversible Mg deposition. Using both static first-principles calculations and ab initio molecular dynamics, we perform a comprehensive adsorption study of several salt and solvent species at the interface of Mg metal with an electrolyte of Mg 2+ and Cl–dissolved in liquid tetrahydrofuran (THF). Our findings not only provide a picture of the stable species at themore » interface but also explain how this system can support reversible Mg deposition, and as such, we provide insights in how to design other electrolytes for Mg plating and stripping. Furthermore, the active depositing species are identified to be (MgCl) + monomers coordinated by THF, which exhibit preferential adsorption on Mg compared to possible passivating species (such as THF solvent or neutral MgCl 2 complexes). We found that upon deposition, the energy to desolvate these adsorbed complexes and facilitate charge transfer is shown to be small (~61–46.2 kJ mol –1 to remove three THF from the strongest adsorbing complex), and the stable orientations of the adsorbed but desolvated (MgCl) + complexes appear to be favorable for charge transfer. Lastly, observations of Mg–Cl dissociation at the Mg surface at very low THF coordinations (0 and 1) suggest that deleterious Cl incorporation in the anode may occur upon plating. In the stripping process, this is beneficial by further facilitating the Mg removal reaction.« less

Study of astrophysical α +22 Ne reaction using alpha transfer with TIARA and MDM spectrometer

NASA Astrophysics Data System (ADS)

Ota, Shuya; Christian, Gregory A.; Bennett, Eames B.; Jayatissa, Heshani; Hooker, Joshua; Hunt, Curtis; Magana, Cordero; Rogachev, Grigory; Saastamoinen, Antti; Upadhyayula, Sriteja; Catford, Wilton N.; Hallam, Sam; Lotay, Gavin; Mouhkaddam, Mohamad; Wilkinson, Ryan

2017-09-01

In core He burning and C-shell burning of massive stars, the 22Ne(α,n)25Mg reaction is considered to be a main neutron source driving the synthesis of nuclides in the A =60-90 mass range during the s process. While a variety of attempts to experimentally determine the rate for this reaction at the Gamow window corresponding to s process temperatures have been made either through direct 22Ne(α,n)25Mg measurements or indirect measurements, uncertainties of some resonance parameters in 26Mg has remained a longstanding problem. To address this problem, we performed an experiment using the 6Li(22Ne,26Mg) d α -transfer reaction at K150 cyclotron of Texas A&M University. A 6LiF target was bombarded with a 7 MeV/u 22Ne beam. Deuterons, gamma-rays, and recoil Mg ions were detected in coincidence using a large Si detector array, TIARA, HPGe clover detectors, and an MDM spectrometer backed by an ionization chamber, respectively. Preliminary data from the experiment will be presented.

Plant regeneration from cell suspension-derived protoplasts of Primula malacoides and Primula obconica.

PubMed

Mizuhiro, M; Kenichi, Y; Ito, K; Kadowaki, S; Ohashi, H; Mii, M

2001-05-01

Protoplasts were isolated from cell suspension cultures of Primula malacoides cv. 'Lovely Tokyo' and P. obconica cv. 'Aalsmeer Giant White'. P. obconica protoplasts were embedded in 0.1% (w/v) gellan gum-solidified discs comprising MS medium supplemented with 3 mg/l of 2,4-D or picloram, 0.1 mg/l of zeatin, 0.2 M glucose and 0.2 M mannitol, and surrounded by a liquid medium of the same composition except for the addition of 0.1% (w/v) activated charcoal. The protoplasts formed visible colonies, which were transferred to the regeneration medium containing 30 g/l of sucrose, 0.1 mg/l of picloram and 2 mg/l of zeatin for shoot induction. P. malacoides protoplasts formed visible colonies when cultured in disc culture using 0.1% (w/v) gellan gum-solidified MS medium containing 5 mg/l of 2,4-D, 1 mg/l of NAA, 0.1 mg/l of zeatin and 0.4 M glucose. Small calli were transferred to MS medium supplemented with 5 mg/l of zeatin for shoot regeneration. The shoots of both species readily rooted on plant growth regulator-free 1/2 MS medium and successfully acclimatized to greenhouse conditions. The protoplast-derived plants showed some alterations in morphological characteristics from those of the in-vitro-germinated control plants.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mortimer, Monika; Petersen, Elijah J.; Buchholz, Bruce A.

We report that consumer goods contain multiwall carbon nanotubes (MWCNTs) that could be released during product life cycles into the environment, where their effects are uncertain. Here, we assessed MWCNT bioaccumulation in the protozoan Tetrahymena thermophila via trophic transfer from bacterial prey (Pseudomonas aeruginosa) versus direct uptake from growth media. The experiments were conducted using 14C-labeled MWCNT ( 14C-MWCNT) doses at or below 1 mg/L, which proved subtoxic since there were no adverse effects on the growth of the test organisms. A novel contribution of this study was the demonstration of the ability to quantify MWCNT bioaccumulation at low (submore » μg/kg) concentrations accomplished by employing accelerator mass spectrometry (AMS). After the treatments with MWCNTs at nominal concentrations of 0.01 mg/L and 1 mg/L, P. aeruginosa adsorbed considerable amounts of MWCNTs: (0.18 ± 0.04) μg/mg and (21.9 ± 4.2) μg/mg bacterial dry mass, respectively. At the administered MWCNT dose of 0.3 mg/L, T. thermophila accumulated up to (0.86 ± 0.3) μg/mg and (3.4 ± 1.1) μg/mg dry mass by trophic transfer and direct uptake, respectively.Finally, aAlthough MWCNTs did not biomagnify in the microbial food chain, MWCNTs bioaccumulated in the protozoan populations regardless of the feeding regime, which could make MWCNTs bioavailable for organisms at higher trophic levels.« less

Lead and cadmium contamination and exposure risk assessment via consumption of vegetables grown in agricultural soils of five-selected regions of Pakistan

PubMed Central

Rehman, Zahir Ur; Khan, Sardar; Brusseau, Mark L; Shah, Mohammad Tahir

2017-01-01

Rapid urbanization and industrialization result in serious contamination of soil with toxic metals such as lead (Pb) and cadmium (Cd), which can lead to deleterious health impacts in the exposed population. This study aimed to investigate Pb and Cd contamination in agricultural soils and vegetables in five different agricultural sites in Pakistan. The metal transfer from soil-to-plant, average daily intake of metals, and health risk index (HRI) were also characterized. The Pb concentrations for all soils were below the maximum allowable limits (MAL 350 mg kg−1) set by the State Environmental Protection Administration of China (SEPA), for soils in China. Conversely, Cd concentrations in the soils exceeded the MAL set by SEPA (0.6 mg kg−) and the European Union (1.5 mg kg−1) by 62-74% and 4-34%, respectively. The mean Pb concentration in edible parts of vegetables ranged from 1.8-11 mgkg−1. The Pb concentrations for leafy vegetables were higher than the fruiting and pulpy vegetables. The Pb concentrations exceeded the MAL (0.3 mg kg−1) for leafy vegetables and the MAL for fruity and rooty/tuber vegetables (0.1 mg kg−1) set by FAO/WHO-CODEX.. Likewise, all vegetables except Pisum sativum (0.12 mg kg−1) contained Cd concentrations that exceeded the MAL set by SEPA. The HRI values for Pb and Cd were <1 for both adults and children for most of the vegetable species except Luffa acutangula, Solanum lycopersicum, Benincasa hispada, Momordi charantia, Aesculantus malvaceae, Cucumis sativus, Praecitrullus fistulosus, Brassica oleracea, and Colocasia esculanta for children. Based on these results, consumption of these Pb and Cd contaminated vegetables poses a potential health risk to the local consumers. PMID:27939659

Kinetics and the mass transfer mechanism of hydrogen sulfide removal by biochar derived from rice hull.

PubMed

Shang, Guofeng; Liu, Liang; Chen, Ping; Shen, Guoqing; Li, Qiwu

2016-05-01

The biochar derived from rice hull was evaluated for its abilities to remove hydrogen sulfide (H2S) from gas phase. The surface area and pH of the biochar were compared. The biochar derived from rice hull was evaluated for its abilities to remove hydrogen sulfide (H2S) from gas phase. The surface area and pH of the biochar were compared. The different pyrolysis temperature has great influence on the adsorption of H2S. At the different pyrolysis temperature, the H2S removal efficiency of rice hull-derived biochar was different. The adsorption capacities of biochar were 2.09 mg·g(-1), 2.65 mg·g(-1), 16.30 mg·g(-1), 20.80 mg·g(-1), and 382.70 mg·g(-1), which their pyrolysis temperatures were 100 °C, 200 °C, 300 °C, 400 °C and 500 °C respectively. Based on the Yoon-Nelson model, it analyzed the mass transfer mechanism of hydrogen sulfide adsorption by biochar. The paper focuses on the biochar derived from rice hull-removed hydrogen sulfide (H2S) from gas phase. The surface area and pH of the biochar were compared. The different pyrolysis temperatures have great influence on the adsorption of H2S. At the different pyrolysis temperatures, the H2S removal efficiency of rice hull-derived biohar was different. The adsorption capacities of biochar were 2.09, 2.65, 16.30, 20.80, and 382.70 mg·g(-1), and their pyrolysis temperatures were 100, 200, 300, 400, and 500 °C, respectively. Based on the Yoon-Nelson model, the mass transfer mechanism of hydrogen sulfide adsorption by biochar was analyzed.

Mg isotope fractionation during microbe-mineral interactions

NASA Astrophysics Data System (ADS)

Kim, Insu; Ryu, Jong-sik; Lee, Kwang-sik; Lee, Dongho

2014-05-01

Magnesium is involved in various biogeochemical processes important to the global climate change over geological time-scale. Mg isotopes allow us to directly trace the Mg cycle in the Earth's surface but the factors controlling Mg isotopic compositions have not fully understood yet. Here, we conducted a batch experiment using two bacterial species (Shewanella putrefaciens and Burkholderia fungorum) and three major Mg-bearing minerals (biotite, dolomite and hornblende). All elemental concentrations increased by 336 h and then reached to steady-state values, of which Mg concentrations varied depending on minerals and bacterial species. This result indicates that the mineral dissolution is affect by the presence of microbes, which either provide organic acids or attach onto mineral surface. The Mg isotopic compositions of initial minerals biotite, dolomite and hornblende are -0.35o of biotite, -0.99o of dolomite, and -0.24o of hornblende, in δ26Mg. Similarly, δ26Mg values increased by 336 h and reached to steady-state values, which also varied with minerals and microbes. During dissolution of three minerals, the light isotope of Mg is preferentially incorporated into the dissolved phases and then the dissolved δ26Mg values become consistent with those of minerals with the time.

Comparative study on toxicity of methylmercury chloride and methylmercury hydroxide to the human neuroblastoma cell line SH-SY5Y.

PubMed

Patnaik, Rajashree; Padhy, Rabindra N

2018-05-11

Toxicities of methylmercury chloride (CH 3 HgCl) and methylmercury hydroxide (CH 3 HgOH) to cultured neuroblastoma cell line SH-SY5Y in vitro are evaluated. This is the comparative study between two methylmercury compounds to find out the extent of toxicity of these compounds are toxic to SH-SY5Y cell line. Both cytotoxicity and genotoxicity experiments were carried out to find out the more toxic compound. For cytotoxicity study, four staining assay methods independently with trypan blue (TB), acridine orange/ethidium bromide (AO/EB), 3-(4,5-dimethylthiazol-2-yl) 2,5-diphenyl tetrazolium bromide (MTT), and neutral red (NR) were used and the comet assay method was done for genotoxicity study. The obtained toxicity data were used for probit analysis. In cytotoxicity, CH 3 HgCl had minimum inhibitory concentration (MIC) value in each assay method as 3 mg/L invariably; LC 25 values were in the range 7.41 to 10.23 mg/L, and LC 50 values were 14.79 to 15.48 mg/L; while LC 75 values were 20.89 to 26.91 mg/L. Moreover, LC 100 value was 30 mg/L, known from comet assay experiments for CH 3 HgCl. Similarly for CH 3 HgOH, the MIC value in each assay method was invariably 3 mg/L, the LC 25 values were in the range 12.58 to 16.59 mg/L, and LC 50 values were 19.49 to 23.44 mg/L; LC 75 values were 27.54 to 30.90 mg/L and LC 100 value was 42 mg/L in each assay done for cytotoxicity and genotoxicity studies. Computed DNA fragmentation indices in comet assays were 98.6 ± 0.57 30 mg/L with CH 3 HgCl and 76 ± 5.29 30 mg/L with CH 3 HgOH. This study clearly indicated that methylmercury chloride is more toxic than methylmercury hydroxide to SH-SY5Y cell line. Toxicity of Hg had been quantified with in vitro cultured human neuroblastoma cell line; since it has neurotoxic effects, its neural evaluation has implications in environmental health issues.

Biomarkers of Alpha Particle Radiation Exposure

DTIC Science & Technology

2014-04-01

Total Protein (TP) g/dL 7.3 7.2 7 7.1 TRIG mg/dL 203 198 203 194 Uric Acid (UA) mg/dL 4 4.1 4.1 4.1 VLDL mg/dL 41 40 41 39 3.1.4 PBMN and WBC...Quantitative Real-Time PCR Radiological Dispersal Device Linear Energy Transfer Deoxyribo Nucleic Acid Fetal Bovine Serum Phosphate Buffered Saline

Low-current-density spin-transfer switching in Gd{sub 22}Fe{sub 78}-MgO magnetic tunnel junction

DOE Office of Scientific and Technical Information (OSTI.GOV)

Kinjo, Hidekazu, E-mail: kinjou.h-lk@nhk.or.jp; Machida, Kenji; Aoshima, Ken-ichi

2014-05-28

Magnetization switching of a relatively thick (9 nm) Gd-Fe free layer was achieved with a low spin injection current density of 1.0 × 10{sup 6} A/cm{sup 2} using MgO based magnetic tunnel junction devices, fabricated for light modulators. At about 560 × 560 nm{sup 2} in size, the devices exhibited a tunneling magnetoresistance ratio of 7%. This low-current switching is mainly attributed to thermally assisted spin-transfer switching in consequence of its thermal magnetic behavior arising from Joule heating.

Direct Observation of Charge Transfer at a MgO(111) Surface

NASA Astrophysics Data System (ADS)

Subramanian, A.; Marks, L. D.; Warschkow, O.; Ellis, D. E.

2004-01-01

Transmission electron diffraction (TED) combined with direct methods have been used to study the √(3)×√(3)R30° reconstruction on the polar (111) surface of MgO and refine the valence charge distribution. The surface is nonstoichiometric and is terminated by a single magnesium atom. A charge-compensating electron hole is localized in the next oxygen layer and there is a nominal charge transfer from the oxygen atoms to the top magnesium atom. The partial charges that we obtain for the surface atoms are in reasonable agreement with empirical bond-valence estimations.

Release of ethanol to the atmosphere during use of consumer cleaning products

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wooley, J.; Nazaroff, W.W.; Hodgson, A.T.

1990-08-01

Liquid laundry and hand dish washing detergents contain volatile organic compounds, including ethanol, that may be liberated during use and contribute to photochemical air pollution. In this study, the release of ethanol to the atmosphere during simulated household use of liquid detergents was measured. Three replicate experiments, plus a blank, were conducted in a 20-m{sup 3} environmental chamber for each of four conditions: typical dish washing (DT), high-release dish washing (DH), typical laundry (LT), and high-release laundry (LH). Average amounts of ethanol transferred to the atmosphere per use (and the fraction of ethanol used so liberated) were 32 mg (0.038)more » for DT, 100 mg (0.049) for DH, 18 mg (0.002) for LT, and 110 mg (0.011) for LH. Thus, a large fraction of the ethanol added to wash solutions with liquid detergents is discharged to the sewer rather than transferred to the atmosphere during use.« less

Toxicity of binary chemical munition destruction products: methylphosphonic acid, methylphosphinic acid, 2-diisopropylaminoethanol, DF neutralent, and QL neutralent.

PubMed

Watson, Rebecca E; Hafez, Ahmed M; Kremsky, Jonathan N; Bizzigotti, George O

2007-01-01

This paper reports the toxicity and environmental impact of neutralents produced from the hydrolysis of binary chemical agent precursor chemicals DF (methylphosphonic difluoride) and QL (2-[bis(1-methylethyl)amino]ethyl ethyl methylphosphonite). Following a literature review of the neutralent mixtures and constituents, basic toxicity tests were conducted to fill data gaps, including acute oral and dermal median lethal dose assays, the Ames mutagenicity test, and ecotoxicity tests. For methylphosphonic acid (MPA), a major constituent of DF neutralent, the acute oral LD(50) in the Sprague-Dawley rat was measured at 1888 mg/kg, and the Ames test using typical tester strains of Salmonella typhimurium and Escherichia coli was negative. The 48-h LC(50) values for pH-adjusted DF neutralent with Daphnia magna and Cyprinodon variegatus were > 2500 mg/L and 1593 mg/L, respectively. The acute oral LD(50) values in the rat for QL neutralent constituents methylphosphinic acid (MP) and 2-diisopropylaminoethanol (KB) were both determined to be 940 mg/kg, and the Ames test was negative for both. Good Laboratory Practice (GLP)-compliant ecotoxicity tests for MP and KB gave 48-h D. magna EC(50) values of 6.8 mg/L and 83 mg/L, respectively. GLP-compliant 96-h C. variegatus assays on MP and KB gave LC(50) values of 73 and 252 mg/L, respectively, and NOEC values of 22 and 108 mg/L. QL neutralent LD(50) values for acute oral and dermal toxicity tests were both > 5000 mg/kg, and the 48-h LD(50) values for D. magna and C. variegatus were 249 and 2500 mg/L, respectively. Using these data, the overall toxicity of the neutralents was assessed.

40 CFR Appendix 5 to Subpart A of... - Determination of Crude Oil Contamination in Non-Aqueous Drilling Fluids by Gas Chromatography...

Code of Federal Regulations, 2011 CFR

2011-07-01

.... 6.2.2Analytical balance—Capable of weighing 0.1 mg. 6.2.3Glassware. 6.2.3.1Disposable pipettes... standard at 62.5 mg/mL in methylene chloride. Prepare a medium concentration SPTM standard at 1.25 mg/mL by transferring 1.0 mL of the 62.5 mg/mL solution into a 50 mL volumetric flask and diluting to the mark with...

Computational Investigation of the Interplay of Substrate Positioning and Reactivity in Catechol O-Methyltransferase

PubMed Central

Patra, Niladri; Ioannidis, Efthymios I.

2016-01-01

Catechol O-methyltransferase (COMT) is a SAM- and Mg2+-dependent methyltransferase that regulates neurotransmitters through methylation. Simulations and experiments have identified divergent catecholamine substrate orientations in the COMT active site: molecular dynamics simulations have favored a monodentate coordination of catecholate substrates to the active site Mg2+, and crystal structures instead preserve bidentate coordination along with short (2.65 Å) methyl donor-acceptor distances. We carry out longer dynamics (up to 350 ns) to quantify interconversion between bidentate and monodentate binding poses. We provide a systematic determination of the relative free energy of the monodentate and bidentate structures in order to identify whether structural differences alter the nature of the methyl transfer mechanism and source of enzymatic rate enhancement. We demonstrate that the bidentate and monodentate binding modes are close in energy but separated by a 7 kcal/mol free energy barrier. Analysis of interactions in the two binding modes reveals that the driving force for monodentate catecholate orientations in classical molecular dynamics simulations is derived from stronger electrostatic stabilization afforded by alternate Mg2+ coordination with strongly charged active site carboxylates. Mixed semi-empirical-classical (SQM/MM) substrate C-O distances (2.7 Å) for the bidentate case are in excellent agreement with COMT X-ray crystal structures, as long as charge transfer between the substrates, Mg2+, and surrounding ligands is permitted. SQM/MM free energy barriers for methyl transfer from bidentate and monodentate catecholate configurations are comparable at around 21–22 kcal/mol, in good agreement with experiment (18–19 kcal/mol). Overall, the work suggests that both binding poses are viable for methyl transfer, and accurate descriptions of charge transfer and electrostatics are needed to provide balanced relative barriers when multiple binding poses are accessible, for example in other transferases. PMID:27564542

Critical current densities of powder-in-tube MgB2 tapes fabricated with nanometer-size Mg powder

NASA Astrophysics Data System (ADS)

Yamada, H.; Hirakawa, M.; Kumakura, H.; Matsumoto, A.; Kitaguchi, H.

2004-03-01

We fabricated powder-in-tube MgB2/Fe tapes using a powder mixture of nanometer-size Mg and commercial amorphous B and investigated the transport properties. High-purity nanometer-size Mg powder was fabricated by applying the thermal plasma method. 5-10 mol % SiC powder doping was tried to enhance the Jc properties. We found that the use of nanometer-size Mg powder was effective to increase the Jc values. The transport Jc values of the nondoped and 10 mol % SiC-doped tapes prepared with nanometer-size Mg powder reached 90 and 250 A/mm2 at 4.2 K and 10 T, respectively. These values were about five times higher than those of the tapes prepared with commercial Mg powder.

Did the formation of D″ cause the Archaean-Proterozoic transition?

NASA Astrophysics Data System (ADS)

Campbell, Ian H.; Griffiths, Ross W.

2014-02-01

The MgO content of the highest MgO plume-related komatiites and picrites remained constant at 32±2.5% between 3.5 and 2.7 Ga, then fell to 21±3% by ca. 2.0 Ga, a value similar to the present day value. Because there is a linear relationship between the liquidus temperature of dry magmas and their MgO content this observation implies that the temperature of mantle plumes changed little between 3.5 and 2.7 Ga, and then fell by 200-250 °C between 2.7 and 2.0 Ga to a temperature similar to that of present plumes. We suggest that Archaean plumes originate from the core-mantle boundary and that their temperature remained constant because the temperature of the outer core was buffered by solidification of the Fe-Ni inner core. At about 2.7 Ga dense former basaltic crust began to accumulate at the core and eventually covered it to produce an insulating layer that reduced the heat flux out of the core and lowered the temperature of mantle plumes. The temperature of mantle plumes fell as the dense layer above the core thickened until it exceeded the critical thickness required for convection. Because heat is transferred rapidly across the convecting part of the insulating layer, any further increase in its thickness by the addition more basaltic material has no influence on the temperature at the top of the layer, which is the source of Post-Archaean mantle plumes. We equate the dense layer above the core with the seismically identified layer D″. Our analyses suggest the drop in plume temperatures produced by a dense insulating layer above the core will be about 40% once it starts to convect, which is consistent with the observed drop inferred from the decrease in the MgO content of komatiites and picrites at that time.

Treatability study of the effluent containing reactive blue 21 dye by ozonation and the mass transfer study of ozone

NASA Astrophysics Data System (ADS)

Velpula, Priyadarshini; Ghuge, Santosh; Saroha, Anil K.

2018-04-01

Ozonation is a chemical treatment process in which ozone reacts with the pollutants present in the effluent by infusion of ozone into the effluent. This study includes the effect of various parameters such as inlet ozone dose, pH of solution and initial concentration of dye on decolorization of dye in terms CRE. The maximum CRE of 98.62% with the reaction rate constant of 0.26 min-1 is achieved in 18 minutes of reaction time at inlet ozone dose of 11.5 g/m3, solution pH of 11 and 30 mg/L of initial concentration of dye. The presence of radical scavenger (Tertiary Butyl Alcohol) suppressed the CRE from 98.62% to 95.4% at high pH values indicates that the indirect mechanism dominates due to the presence of hydroxyl radicals which are formed by the decomposition of ozone. The diffusive and convective mass transfer coefficients of ozone are calculated as 1.78 × 10-5 cm2/sec and 0.075 min-1. It is observed that the fraction of resistance offered by liquid is very much high compared to gas phase indicates that the ozonation is a liquid phase mass transfer controlled operation.

In vitro biosynthesis of galactans by membrane-bound galactosyltransferase from radish ( Raphanus sativus L.) seedlings.

PubMed

Kato, Hideaki; Takeuchi, Yoshimi; Tsumuraya, Yoichi; Hashimoto, Yohichi; Nakano, Hirofumi; Kovác, Pavol

2003-06-01

We investigated a galactosyltransferase (GalT) involved in the synthesis of the carbohydrate portion of arabinogalactan-proteins (AGPs), which consist of a beta-(1-->3)-galactan backbone from which consecutive (1-->6)-linked beta-Gal p residues branch off. A membrane preparation from 6-day-old primary roots of radish ( Raphanus sativus L.) transferred [(14)C]Gal from UDP-[(14)C]Gal onto a beta-(1-->3)-galactan exogenous acceptor. The reaction occurred maximally at pH 5.9-6.3 and 30 degrees C in the presence of 15 mM Mn(2+) and 0.75% Triton X-100. The apparent K(m) and V(max) values for UDP-Gal were 0.41 mM and 1,000 pmol min(-1) (mg protein)(-1), respectively. The reaction with beta-(1-->3)-galactan showed a bi-phasic kinetic character with K(m) values of 0.43 and 2.8 mg ml(-1). beta-(1-->3)-Galactooligomers were good acceptors and enzyme activity increased with increasing polymerization of Gal residues. In contrast, the enzyme was less efficient on beta-(1-->6)-oligomers. The transfer reaction for an AGP from radish mature roots was negligible but could be increased by prior enzymatic or chemical removal of alpha- l-arabinofuranose (alpha- l-Ara f) residues or both alpha- l-Ara f residues and (1-->6)-linked beta-Gal side chains. Digestion of radiolabeled products formed from beta-(1-->3)-galactan and the modified AGP with exo-beta-(1-->3)-galactanase released mainly radioactive beta-(1-->6)-galactobiose, indicating that the transfer of [(14)C]Gal occurred preferentially onto consecutive (1-->3)-linked beta-Gal chains through beta-(1-->6)-linkages, resulting in the formation of single branching points. The enzyme produced mainly a branched tetrasaccharide, Galbeta(1-->3)[Galbeta(1-->6)] Galbeta(1-->3)Gal, from beta-(1-->3)-galactotriose by incubation with UDP-Gal, confirming the preferential formation of the branching linkage. Localization of the GalT in the Golgi apparatus was revealed on a sucrose density gradient. The membrane preparation also incorporated [(14)C]Gal into beta-(1-->4)-galactan, indicating that the membranes contained different types of GalT isoform catalyzing the synthesis of different types of galactosidic linkage.

Loads Limits Values of Soils with Petroleum Hydrocarbons

NASA Astrophysics Data System (ADS)

Dumitru, Mihail; Vladimirescu, Andreea

2017-04-01

The high demand for oil and associated products as a source of energy, resulting in increased oil exploitation, producing, refining, transportation, storage, marketing and use led to high levels of environmental pollution. The optimum bioremediation variant proved to be the one in which fertilizer (potassium humate in NPK matrix with microelements and 8% monosaccharides) applied in a 650 l/ha dose was used together with the Zeba absorbent in 32 kg/ha dose, where the TPH level dropped by 58% in 45 days from the pollution with 3% crude oil. Most of these areas are affected by historical pollution. Many organic contaminants may undergo an ongoing process in the soil, whereby over time contaminant become less and less subject to decomposition even though relatively can still be detected in the laboratory analyses. In Romania about 50.000 ha are polluted with oil and/or brine. The bioremediation was the main method of rehabilitation. The Regulation on the assessment of environmental pollution, the following are presented as guide values for total oil hydrocarbons content in soil: - normal: less than 100 mg/kg; - alert values for sensitive soils: 200 mg/kg; - alert values for less sensitive soils: 1000 mg/kg; - intervention values for sensitive soils: 500 mg/kg; - intervention values for less sensitive soils: 2000 mg/kg. Researches done in laboratory monitored the effect of various concentrations of oil (under 2000 mg/kg, 3000 mg/kg, 5000 mg/kg, 7000 mg/kg, 10 000 mg/kg) on germination of wheat seeds at 5 and 7 days after seeding and (fresh and dry) biomass production after 40 days. Tree experiments were done: one with recently contaminated light oil, one with recently contaminated heavy oil and one with old contamination. After 5 days from sowing, the largest number of germinated seeds was found in the experiments with old contamination. The fewest germinated seeds was found in the experience with light oil. The experience with heavy oil showed an intermediate number of emerged plants. In all cases fertilization led to a significant increase of the wheat biomass. After 40 days, the level of total hydrocarbons was reduced on average by 55% in the case of contamination with light oil, by 42% for heavy oil contamination and 12% for old contamination. The BTEX concentration in soil had the lowest values in the experiment with heavy oil contamination, intermediate values in the experiment with historic contamination and higher values within experiment with light oil. We make proposal to change intervention thresholds for sensitive land uses from 500 mg/kg for total oil hydrocarbons to 1000 mg/kg for recently pollution and 2000 mg/kg for old pollution (historical > 5 years). For less sensitive land uses intervention thresholds from 2000 mg/kg of total oil hydrocarbons, values increase to 500 mg/kg for recently pollution and 1000 mg/kg old pollution.

Localized surface plasmon-enhanced ultraviolet electroluminescence from n-ZnO/i-ZnO/p-GaN heterojunction light-emitting diodes via optimizing the thickness of MgO spacer layer

NASA Astrophysics Data System (ADS)

Liu, W. Z.; Xu, H. Y.; Zhang, L. X.; Zhang, C.; Ma, J. G.; Wang, J. N.; Liu, Y. C.

2012-10-01

Localized surface plasmon (LSP)-enhanced ultraviolet light-emitting diodes were manufactured by introducing Ag nanoparticles and MgO spacer layer into n-ZnO/i-ZnO/p-GaN heterostructures. By optimizing the MgO thickness, which can suppress the undesired charge transfer and nonradiative Förster resonant energy transfer between Ag and ZnO, a 7-fold electroluminescence enhancement was achieved. Time-resolved and temperature-dependent photoluminescence measurements reveal that both spontaneous emission rate and internal quantum efficiency are increased as a result of coupling between ZnO excitons and Ag LSPs, and simple calculations, based on experimental data, also indicate that most of LSP's energy can be converted into the photon energy.

Disposition of cimicoxib in plasma and milk of whelping bitches and in their puppies.

PubMed

Schneider, M; Kuchta, A; Dron, F; Woehrlé, F

2015-07-31

Caesarean section of bitches is a well recognized painful condition in dogs and it can be classified as a soft tissue surgery. Cimicoxib, a newly registered NSAID in European Union has a claim for the relief of pain in peri-operative conditions. However, in case of caesarean section, the main concerns of using NSAIDs are the transfer of the drugs into milk and its impact on the suckling pups. Thus, the aim of the present work was to evaluate the transfer of cimicoxib into the milk of 6 lactating bitches after a single oral administration of the drug on day 0 (just after whelping) and on day 28 at the target dose of 2 mg/kg. Another aim of the study was to evaluate the transfer of the drug from the milk into the suckling pups. Blood and milk samples were collected from the bitches after each administration on day 0 and day 28 and blood samples were drawn from the pups after suckling on day 28. All bitches whelped without any complication and gave birth to 38 pups. After administration on D0, the mean observed plasma Cmax in bitches was 0.5323 μg/mL and the mean area under the concentration-time curve extrapolated to the infinity, AUCINF, was 2.411 μg.h/mL. After administration on D28, only AUCINF was significantly higher with a value of 3.747 μg.h/mL. In milk, after administration on D0, the mean observed Cmax was 0.9974 μg/mL and the mean area under the concentration-time curve until the last measurable time point, AUClast, was 4.205 μg.h/mL. Out of 24 sampled pups on D28, only 2 animals had a sample with very low cimicoxib concentrations slightly above the limit of quantification (0.01 μg/mL). The presented data show that cimicoxib given by oral route to lactating bitches at a single dose of 2 mg/kg had a high transfer rate into the milk with a milk to plasma ratio of 1.7 to 1.9. The transfer rate to the suckling pups was low and no clinical abnormalities were detected in both bitches and pups.

45 CFR 2530.60 - What is the impact of transferring or receiving a transferred education award on an individual's...

Code of Federal Regulations, 2010 CFR

2010-10-01

... does not reduce the aggregate value of education awards the transferring individual is considered to... individual revokes, in whole or in part, a transfer, the value of the education award considered to have been... transferred education award on an individual's eligibility to receive additional education awards? 2530.60...

[Modelling of phosphorus transfers during haemodialysis].

PubMed

Chazot, Guillaume; Lemoine, Sandrine; Juillard, Laurent

2017-04-01

Chronic kidney disease causes hyperphosphatemia, which is associated with increased cardiovascular risk and mortality. In patients with end-stage renal disease, haemodialysis allows the control of hyperphosphatemia. During a 4-h haemodialysis session, between 600 and 700mg of phosphate are extracted from the plasma, whereas the latter contains only 90mg of inorganic phosphate. The precise origin of phosphates remains unknown. The modelling of phosphorus transfers allows to predict the outcome after changes in dialysis prescription (duration, frequency) with simple two-compartment models and to describe the transfers between the different body compartments with more complex models. Work using 31 P nuclear magnetic resonance spectroscopy performed in animals showed an increase in intracellular phosphate concentration and a decrease in intracellular ATP during a haemodialysis session suggesting an intracellular origin of phosphates. Copyright © 2017. Published by Elsevier Masson SAS.

Effects of soil properties on the transfer of cadmium from soil to wheat in the Yangtze River delta region, China--a typical industry-agriculture transition area.

PubMed

Wang, Cheng; Ji, Junfeng; Yang, Zhongfang; Chen, Lingxiao; Browne, Patrick; Yu, Ruilian

2012-08-01

In order to identify the effects of soil properties on the transfer of Cd from soil to wheat under actual field conditions, 126 pairs of topsoil and wheat samples were collected from the Yangtze River delta region, China. Relevant parameters (Cd, Ca, Mg, Fe, Mn, Zn, N, P, K, S, pH, total organic carbon, and speciation of soil Cd) in soil and wheat tissues were analyzed, and the results were treated by statistical methods. Soil samples (19.8%) and 14.3% of the wheat grain samples exceeded the relevant maximum permissible Cd concentrations in China for agricultural soil and wheat grain, respectively. The major speciations of Cd in soil were exchangeable, bound to carbonates and fulvic and humic acid fraction, and they were readily affected by soil pH, total Ca, Mg, S and P, DTPA-Fe, Ex-Ca, and Ex-Mg. Cadmium showed a strong correlation with Fe, S, and P present in the grain and the soil, whereas there was no significant correlation in the straw or root. Generally, soil pH, Ca, Mg, Mn, P, and slowly available K restricted Cd transfer from soil to wheat, whereas soil S, N, Zn, DTPA-Fe, and total organic carbon enhance Cd uptake by wheat.

Antagonistic Effect of Monovalent Cations in Maintenance of Cellular Integrity of a Marine Bacterium1

PubMed Central

De Voe, Irving W.; Oginsky, Evelyn L.

1969-01-01

The susceptibility of a marine bacterium, designated isolate c-A1, to lysis in distilled water and in salt solutions has been found to be a function of Na+ concentration. Optical densities of cells pre-exposed to 0.05 m MgCl2 were maintained in 1.0 m KCl, whereas those of cells pre-exposed to 1.0 m NaCl were not maintained at any KCl concentration tested. Cells transferred from MgCl2 to low concentrations of NaCl underwent more extensive lysis than did those transferred to distilled water. The degree of disruption of cells transferred to distilled water from mixtures of 0.05 m MgCl2 and NaCl (0 to 1.0 m) was dependent on the concentration of NaCl; similar results were obtained with LiCl, but not with KCl. In electron micrographs of thin sections, c-A1 cell envelopes consisted of two double-track layers which fractured and peeled apart on lysis after pre-exposure to NaCl-MgCl2 mixtures. Envelope eruptions or “hernias” occurred only in lysed cells pre-exposed to NaCl alone. No evidence for a functional lytic enzyme was found. Comparative studies on a terrestrial pseudomonad with a multilayered envelope indicated that preexposure to NaCl did not enhance the susceptibility of this cell to lysis in distilled water. The lytic susceptibility of the marine bacterium is considered to be the consequence of competition between specific monovalent cations and Mg++ for electrostatic interactions with components of the cell envelope of this organism. Images PMID:5788707

Behaviour of radiocaesium in coastal rivers of the Fukushima Prefecture (Japan) during conditions of low flow and low turbidity--Insight on the possible role of small particles and detrital organic compounds.

PubMed

Eyrolle-Boyer, Frédérique; Boyer, Patrick; Garcia-Sanchez, Laurent; Métivier, Jean-Michel; Onda, Yuichi; De Vismes, Anne; Cagnat, Xavier; Boulet, Béatrice; Cossonnet, Catherine

2016-01-01

To investigate riverine transfers from contaminated soils of the Fukushima Prefecture in Japan to the marine environment, suspended sediments, filtered water, sediments and detrital organic macro debris deposited onto river beds were collected in November 2013 within small coastal rivers during conditions of low flow rates and low turbidity. River waters were directly filtered on the field and high efficiency well-type Ge detectors were used to analyse radiocaesium concentrations in very small quantities of suspended particles and filtered water (a few mg to a few g). For such base-flow conditions, our results show that the watersheds studied present similar hydro-sedimentary behaviours at their outlets and that the exports of dissolved and particulate radiocaesium are comparable. Moreover, the contribution of these rivers to the instantaneous export of radiocaesium to the ocean is similar to that of the Abukuma River. Our preliminary results indicate that, in the estuaries, radiocaesium concentrations in suspended sediments would be reduced by more than 80%, while radiocaesium concentration in filtered waters would be maintained. Significant correlations between radiocaesium concentrations and radiocaesium inventories in the soils of the catchments indicate that there was at that time little intra and inter-watershed variability in the transfer processes of radiocaesium from lands to rivers at this regional scale. The apparent liquid-solid partition coefficient (KD) values acquired for the lowest loads/finest particles complement the values acquired by using sediment traps and highlight the strong capacity of the smallest particles to transfer radiocaesium. Finally, but not least, our observations suggest that there could be a significant transfer of highly contaminated detrital biomass from forest litter to the downstream rivers in a rather conservative way. Copyright © 2015 Elsevier Ltd. All rights reserved.

Mineralogy, early marine diagenesis, and the chemistry of shallow-water carbonate sediments

NASA Astrophysics Data System (ADS)

Higgins, J. A.; Blättler, C. L.; Lundstrom, E. A.; Santiago-Ramos, D. P.; Akhtar, A. A.; Crüger Ahm, A.-S.; Bialik, O.; Holmden, C.; Bradbury, H.; Murray, S. T.; Swart, P. K.

2018-01-01

Shallow-water carbonate sediments constitute the bulk of sedimentary carbonates in the geologic record and are widely used archives of Earth's chemical and climatic history. One of the main limitations in interpreting the geochemistry of ancient carbonate sediments is the potential for post-depositional diagenetic alteration. In this study, we use paired measurements of calcium (44Ca/40Ca or δ44Ca) and magnesium (26Mg/24Mg or δ26Mg) isotope ratios in sedimentary carbonates and associated pore-fluids as a tool to understand the mineralogical and diagenetic history of Neogene shallow-water carbonate sediments from the Bahamas and southwest Australia. We find that the Ca and Mg isotopic composition of bulk carbonate sediments at these sites exhibits systematic stratigraphic variability that is related to both mineralogy and early marine diagenesis. The observed variability in bulk sediment Ca isotopes is best explained by changes in the extent and style of early marine diagenesis from one where the composition of the diagenetic carbonate mineral is determined by the chemistry of the fluid (fluid-buffered) to one where the composition of the diagenetic carbonate mineral is determined by the chemistry of the precursor sediment (sediment-buffered). Our results indicate that this process, together with variations in carbonate mineralogy (aragonite, calcite, and dolomite), plays a fundamental and underappreciated role in determining the regional and global stratigraphic expressions of geochemical tracers (δ13C, δ18O, major, minor, and trace elements) in shallow-water carbonate sediments in the geologic record. Our results also provide evidence that a large shallow-water carbonate sink that is enriched in 44Ca can explain the mismatch between the δ44/40Ca value of rivers and deep-sea carbonate sediments and call into question the hypothesis that the δ44/40Ca value of seawater depends on the mineralogy of primary carbonate precipitations (e.g. 'aragonite seas' and 'calcite seas'). Finally, our results for sedimentary dolomites suggest that paired measurements of Ca and Mg isotopes may provide a unique geochemical fingerprint of mass transfer during dolomitization to better understand the paleo-environmental information preserved in these enigmatic but widespread carbonate minerals.

Continuum simulation of heat transfer and solidification behavior of AlSi10Mg in Direct Metal Laser Sintering Process

NASA Astrophysics Data System (ADS)

Ojha, Akash; Samantaray, Mihir; Nath Thatoi, Dhirendra; Sahoo, Seshadev

2018-03-01

Direct Metal Laser Sintering (DMLS) process is a laser based additive manufacturing process, which built complex structures from powder materials. Using high intensity laser beam, the process melts and fuse the powder particles makes dense structures. In this process, the laser beam in terms of heat flux strikes the powder bed and instantaneously melts and joins the powder particles. The partial solidification and temperature distribution on the powder bed endows a high cooling rate and rapid solidification which affects the microstructure of the build part. During the interaction of the laser beam with the powder bed, multiple modes of heat transfer takes place in this process, that make the process very complex. In the present research, a comprehensive heat transfer and solidification model of AlSi10Mg in direct metal laser sintering process has been developed on ANSYS 17.1.0 platform. The model helps to understand the flow phenomena, temperature distribution and densification mechanism on the powder bed. The numerical model takes into account the flow, heat transfer and solidification phenomena. Simulations were carried out for sintering of AlSi10Mg powders in the powder bed having dimension 3 mm × 1 mm × 0.08 mm. The solidification phenomena are incorporated by using enthalpy-porosity approach. The simulation results give the fundamental understanding of the densification of powder particles in DMLS process.

Gas-liquid transfer data used to analyze hydrophobic hydration and find the nature of the Kauzmann-Tanford hydrophobic factor.

PubMed

Baldwin, Robert L

2012-05-08

Hydrophobic free energy for protein folding is currently measured by liquid-liquid transfer, based on an analogy between the folding process and the transfer of a nonpolar solute from water into a reference solvent. The second part of the analogy (transfer into a nonaqueous solvent) is dubious and has been justified by arguing that transfer out of water probably contributes the major part of the free energy change. This assumption is wrong: transfer out of water contributes no more than half the total, often less. Liquid-liquid transfer of the solute from water to liquid alkane is written here as the sum of 2 gas-liquid transfers: (i) out of water into vapor, and (ii) from vapor into liquid alkane. Both gas-liquid transfers have known free energy values for several alkane solutes. The comparable values of the two different transfer reactions are explained by the values, determined in 1991 for three alkane solutes, of the cavity work and the solute-solvent interaction energy. The transfer free energy is the difference between the positive cavity work and the negative solute-solvent interaction energy. The interaction energy has similar values in water and liquid alkane that are intermediate in magnitude between the cavity work in water and in liquid alkane. These properties explain why the transfer free energy has comparable values (with opposite signs) in the two transfers. The current hydrophobic free energy is puzzling and poorly defined and needs a new definition and method of measurement.

Gas-liquid transfer data used to analyze hydrophobic hydration and find the nature of the Kauzmann-Tanford hydrophobic factor

PubMed Central

Baldwin, Robert L.

2012-01-01

Hydrophobic free energy for protein folding is currently measured by liquid-liquid transfer, based on an analogy between the folding process and the transfer of a nonpolar solute from water into a reference solvent. The second part of the analogy (transfer into a nonaqueous solvent) is dubious and has been justified by arguing that transfer out of water probably contributes the major part of the free energy change. This assumption is wrong: transfer out of water contributes no more than half the total, often less. Liquid-liquid transfer of the solute from water to liquid alkane is written here as the sum of 2 gas-liquid transfers: (i) out of water into vapor, and (ii) from vapor into liquid alkane. Both gas-liquid transfers have known free energy values for several alkane solutes. The comparable values of the two different transfer reactions are explained by the values, determined in 1991 for three alkane solutes, of the cavity work and the solute-solvent interaction energy. The transfer free energy is the difference between the positive cavity work and the negative solute-solvent interaction energy. The interaction energy has similar values in water and liquid alkane that are intermediate in magnitude between the cavity work in water and in liquid alkane. These properties explain why the transfer free energy has comparable values (with opposite signs) in the two transfers. The current hydrophobic free energy is puzzling and poorly defined and needs a new definition and method of measurement. PMID:22529345

Unconditional Seasonal Cash Transfer Increases Intake of High-Nutritional-Value Foods in Young Burkinabe Children: Results of 24-Hour Dietary Recall Surveys within the Moderate Acute Malnutrition Out (MAM'Out) Randomized Controlled Trial.

PubMed

Tonguet-Papucci, Audrey; Houngbe, Freddy; Huybregts, Lieven; Ait-Aissa, Myriam; Altare, Chiara; Kolsteren, Patrick; Huneau, Jean-François

2017-07-01

Background: Cash transfer programs have the potential to improve dietary intake by improving accessibility to food. However, quantitative data on the impact of cash transfer programs on children's energy and nutrient intakes are lacking. Objective: The aim of this study was to evaluate the effect of seasonal unconditional cash transfers on children's energy, micro- and macronutrient, and food group intakes during the lean season in Burkina Faso. Methods: Within the framework of the MAM'Out (Moderate Acute Malnutrition Out) cluster-randomized controlled trial, two 24-h dietary recall surveys were conducted in July and August 2014. Daily energy and macro- and micronutrient intakes, breastfeeding practices, and food group consumption were analyzed for 322 children aged 14-27 mo from an intervention group (benefiting from unconditional cash transfer during the lean season in 2013 and 2014) and a control group by using mixed linear, logistic, and Poisson regression models or a γ-generalized linear model with log-link. A dietary diversity score was calculated on the basis of 7 food groups. Results: Unconditional cash transfers during the lean season improved the diets of rural children through a higher consumption of eggs (11.3 ± 1.55 compared with 3.25 ± 0.79 g; P < 0.001), fat (20.6 ± 0.80 compared with 16.5 ± 0.89 g; P < 0.01), and vitamin B-12 (0.40 ± 0.02 compared with 0.34 ± 0.02 mg; P < 0.001) compared with controls and higher proportions of children consuming dairy products (OR: 4.14; 95% CI: 1.48, 11.6; P < 0.05), flesh foods (OR: 2.09; 95% CI: 1.18, 3.70; P < 0.05), and iron-rich or iron-fortified foods (OR: 2.23; 95% CI: 1.20, 4.13; P < 0.05). No difference was found in energy intake between the 2 groups. The minimum dietary diversity of two-thirds of the children who benefited from cash transfers was adequate compared with only one-third in the control group ( P < 0.001). Conclusions: Unconditional seasonal cash transfer increases intakes of high-nutritional-value foods in Burkinabe children aged 14-27 mo. As such, their use can be recommended in actions addressing children's dietary intake during the lean season. This trial was registered at clinicaltrials.gov as NCT01866124. © 2017 American Society for Nutrition.

Establishment of the regeneration system for Vicia faba L.

PubMed

Bahgat, Shimaa; Shabban, Omer A; El-Shihy, Osama; Lightfoot, David A; El-Shemy, Hany A

2009-01-01

A reliable regeneration system for faba bean has been difficult to establish and therefore, the genetic improvement of Vicia faba L. was delayed. The paper describes a method of somatic embryo induction in callus of V. faba. Two Egyptian faba bean cultivars 'Giza 2' and '24 Hyto' were used. Callus was induced from epicotyls and shoot tips cultured on MS or Gamborg medium supplemented with 3% sucrose and 0.025% (w/v) for each of ascorbic and citric acid, 0.8% agar and different concentrations of 10 mg/l BAP, 0.5 mg/l of each NAA and 2,4-dichlorophenoxyacetic acid (M1) and 1 mg/l BAP and 0.5 mg/l NAA (M2) . The media with BAP, NAA and 2,4-D were optimal for embryogenic callus induction. Somatic embryos developed after transfer of the callus to 1/2 B5 medium with no plant growth regulators. There were various stages of somatic embryo development present including globular, heart-shaped, torpedo, and cotyledonary stages. Embryos developed into plantlets and plants were regenerated. RAPD analyses were performed to investigate the genetic stability of the regenerated plants obtained from different treatments and different explants. The cultivar Giza 2 exhibited more genetic stability than cultivar 24 Hyto. In conclusion, a regeneration system was established suitable for both gene transformation and the isolation of somaclonal mutants. The regeneration system will be used in order to improve the nutritional value of faba bean.

Evolving from reactive to proactive medicine: community lead (Pb) and clinical disparities in pre- and post-Katrina New Orleans.

PubMed

Mielke, Howard W; Gonzales, Christopher; Powell, Eric; Mielke, Paul W

2014-07-21

In 2012 the U.S. Centers for Disease Control (CDC) set the blood Pb reference value at ≥5 µg/dL. Clinical analysis of children's blood Pb levels is the common way to diagnose environmental Pb contamination, and intervention ensues with education and household dust cleanup. Recent review indicates that education and household dust cleanup are not effective at reducing children's Pb exposure. Here we review mapping environmental Pb and children's blood Pb response as an alternative approach for proactive Pb dust intervention. New Orleans was divided into a high (≥100 mg/kg) and low (<100 mg/kg) soil Pb communities. The children's blood Pb prevalence ≥5 µg/dL for the high and low Pb domains were 58.5% and 24.8% respectively pre-Katrina vs. 29.6% and 7.5% post-Katrina. Elevated soil Pb (mg/kg) and consequently Pb loading (µg/square area) permeates the high Pb domain and outdoor locations lack Pb dust safe play areas. The U.S. EPA 400 mg/kg soil Pb standard poses an outside Pb dust loading burden >37 times larger than allowed on interior residential floor environments. Environmental Pb dust is decreasing because of the transfer of large quantities of low Pb soil into selected communities. City-scale soil Pb mapping is an alternative diagnostic tool that provides information for planning proactive medicine to prevent clinical Pb exposure in the first place.

Evolving from Reactive to Proactive Medicine: Community Lead (Pb) and Clinical Disparities in Pre- and Post-Katrina New Orleans

PubMed Central

Mielke, Howard W.; Gonzales, Christopher; Powell, Eric; Mielke, Paul W.

2014-01-01

In 2012 the U.S. Centers for Disease Control (CDC) set the blood Pb reference value at ≥5 µg/dL. Clinical analysis of children’s blood Pb levels is the common way to diagnose environmental Pb contamination, and intervention ensues with education and household dust cleanup. Recent review indicates that education and household dust cleanup are not effective at reducing children’s Pb exposure. Here we review mapping environmental Pb and children’s blood Pb response as an alternative approach for proactive Pb dust intervention. New Orleans was divided into a high (≥100 mg/kg) and low (<100 mg/kg) soil Pb communities. The children’s blood Pb prevalence ≥5 µg/dL for the high and low Pb domains were 58.5% and 24.8% respectively pre-Katrina vs. 29.6% and 7.5% post-Katrina. Elevated soil Pb (mg/kg) and consequently Pb loading (µg/square area) permeates the high Pb domain and outdoor locations lack Pb dust safe play areas. The U.S. EPA 400 mg/kg soil Pb standard poses an outside Pb dust loading burden >37 times larger than allowed on interior residential floor environments. Environmental Pb dust is decreasing because of the transfer of large quantities of low Pb soil into selected communities. City-scale soil Pb mapping is an alternative diagnostic tool that provides information for planning proactive medicine to prevent clinical Pb exposure in the first place. PMID:25050655

Structures and Electrochemical Hydrogen Storage Properties of the As-Spun RE-Mg-Ni-Co-Al-Based AB2-Type Alloys Applied to Ni-MH Battery

NASA Astrophysics Data System (ADS)

Zhang, Yanghuan; Yuan, Zeming; Shang, Hongwei; Li, Yaqin; Qi, Yan; Zhao, Dongliang

2017-05-01

In this paper, the La0.8- x Ce0.2Y x MgNi3.5Co0.4Al0.1 ( x = 0, 0.05, 0.1, 0.15, 0.2) alloys were synthesized via smelting and melt spinning. The effect of Y content on the structure and electrochemical hydrogen storage characteristics of the as-cast and spun alloys was investigated. The identifications of XRD and SEM demonstrate that the experimental alloys possess a major phase LaMgNi4 and a minor phase LaNi5. The variation of Y content results in an obvious transformation of the phase abundance rather than phase composition in the alloys, namely LaMgNi4 phase increases while LaNi5 phase decreases with Y content growing. Furthermore, the replacement of Y for La causes the lattice constants and cell volume to clearly decrease and markedly refines the alloy grains. The electrochemical tests reveal that these alloys can obtain the maximum values of discharge capacity at the first cycling without any activation needed. With Y content growing, the discharge capacity of the alloys obviously declines, but its cycle stability remarkably improves. Moreover, the electrochemical dynamics of the alloys, involving the high-rate discharge ability, hydrogen diffusion coefficient ( D), limiting current density ( I L), and charge transfer rate, initially augment and then decrease with rising Y content.

Coast Guard exposure to gasoline, MTBE, and benzene vapors during inspection of tank barges.

PubMed

Davenport, A C; Glynn, T J; Rhambarose, H

2000-01-01

A field study was conducted June through August 1996 in an attempt to quantify short-term exposure levels to Coast Guard personnel performing routine inspection activities aboard commercial tank barges carrying gasoline. Transfer and fleeting operations were monitored in the ports of Pittsburgh, Pa., Huntington, W.Va., Baton Rouge, La., and Galveston, Tex. A total of 43 personal and 68 area samples were analyzed for benzene and total hydrocarbons as gasoline ("gasoline"). Results can be summarized as follows: Personal exposure to benzene gave 15-min time-weighted-average (TWA) results ranging from <0.10 to 0.50 ppm. Area benzene levels ranged from <0.04 to 170 ppm. Personal monitoring for gasoline revealed a range of <2.0 to 590 mg/m3 with a GM of 23 mg/m3. Area sample results for gasoline ranged from 1.7 to 90,000 mg/m3. Twelve personal samples were collected for methyl-tert butyl ether (MTBE). Only two of these were above the limit of detection and had 15-min time-weighted averages of 22 ppm and 1.3 ppm. Eighteen MTBE area samples ranged in value from <3.0 to 38 ppm. Although none of the personal samples met or exceeded proposed or established short-term exposure standards, many of the area sampling results indicated that a significant risk of acute exposure exists in the vicinity of valves, pressure lines, and connections. This includes anticipated sources such as pressure vent valves as well as unexpected sources resulting from structural deficiencies onboard the vessels. These results further emphasize the value of safe work practices and proper vessel maintenance in controlling exposure to harmful chemicals.

Effect of paleoseawater composition on hydrothermal exchange in midocean ridges

NASA Astrophysics Data System (ADS)

Antonelli, Michael A.; Pester, Nicholas J.; Brown, Shaun T.; DePaolo, Donald J.

2017-11-01

Variations in the Mg, Ca, Sr, and SO4 concentrations of paleoseawater can affect the chemical exchange between seawater and oceanic basalt in hydrothermal systems at midocean ridges (MOR). We present a model for evaluating the nature and magnitude of these previously unappreciated effects, using available estimates of paleoseawater composition over Phanerozoic time as inputs and 87Sr/86Sr of ophiolite epidosites and epidote-quartz veins as constraints. The results suggest that modern hydrothermal fluids are not typical due to low Ca and Sr relative to Mg and SO4 in modern seawater. At other times during the last 500 million years, particularly during the Cretaceous and Ordovician, hydrothermal fluids had more seawater-derived Sr and Ca, a prediction that is supported by Sr isotope data. The predicted 87Sr/86Sr of vent fluids varies cyclically in concert with ocean chemistry, with some values much higher than the modern value of ˜0.7037. The seawater chemistry effects can be expressed in terms of the transfer efficiency of basaltic Ca and Sr to seawater in hydrothermal systems, which varies by a factor of ˜1.6 over the Phanerozoic, with minima when seawater Mg and SO4 are low. This effect provides a modest negative feedback on seawater composition and 87Sr/86Sr changes. For the mid-Cretaceous, the low 87Sr/86Sr of seawater requires either exceptionally large amounts of low-temperature exchange with oceanic crust or that the weathering flux of continentally derived Sr was especially small. The model also has implications for MOR hydrothermal systems in the Precambrian, when low-seawater SO4 could help explain low seawater 87Sr/86Sr.

Effect of paleoseawater composition on hydrothermal exchange in midocean ridges

DOE Office of Scientific and Technical Information (OSTI.GOV)

Antonelli, Michael A.; Pester, Nicholas J.; Brown, Shaun T.

Variations in the Mg, Ca, Sr, and SO 4 concentrations of paleoseawater can affect the chemical exchange between seawater and oceanic basalt in hydrothermal systems at midocean ridges (MOR). Here, we present a model for evaluating the nature and magnitude of these previously unappreciated effects, using available estimates of paleoseawater composition over Phanerozoic time as inputs and 87Sr/ 86Sr of ophiolite epidosites and epidote-quartz veins as constraints. The results suggest that modern hydrothermal fluids are not typical due to low Ca and Sr relative to Mg and SO 4 in modern seawater. At other times during the last 500 millionmore » years, particularly during the Cretaceous and Ordovician, hydrothermal fluids had more seawater-derived Sr and Ca, a prediction that is supported by Sr isotope data. The predicted 87Sr/ 86Sr of vent fluids varies cyclically in concert with ocean chemistry, with some values much higher than the modern value of ~0.7037. The seawater chemistry effects can be expressed in terms of the transfer efficiency of basaltic Ca and Sr to seawater in hydrothermal systems, which varies by a factor of ~1.6 over the Phanerozoic, with minima when seawater Mg and SO 4 are low. This effect provides a modest negative feedback on seawater composition and 87Sr/ 86Sr changes. For the mid-Cretaceous, the low 87Sr/ 86Sr of seawater requires either exceptionally large amounts of low-temperature exchange with oceanic crust or that the weathering flux of continentally derived Sr was especially small. Lastly, the model also has implications for MOR hydrothermal systems in the Precambrian, when low-seawater SO 4 could help explain low seawater 87Sr/ 86Sr.« less

Effect of paleoseawater composition on hydrothermal exchange in midocean ridges

DOE PAGES

Antonelli, Michael A.; Pester, Nicholas J.; Brown, Shaun T.; ...

2017-11-06

Variations in the Mg, Ca, Sr, and SO 4 concentrations of paleoseawater can affect the chemical exchange between seawater and oceanic basalt in hydrothermal systems at midocean ridges (MOR). Here, we present a model for evaluating the nature and magnitude of these previously unappreciated effects, using available estimates of paleoseawater composition over Phanerozoic time as inputs and 87Sr/ 86Sr of ophiolite epidosites and epidote-quartz veins as constraints. The results suggest that modern hydrothermal fluids are not typical due to low Ca and Sr relative to Mg and SO 4 in modern seawater. At other times during the last 500 millionmore » years, particularly during the Cretaceous and Ordovician, hydrothermal fluids had more seawater-derived Sr and Ca, a prediction that is supported by Sr isotope data. The predicted 87Sr/ 86Sr of vent fluids varies cyclically in concert with ocean chemistry, with some values much higher than the modern value of ~0.7037. The seawater chemistry effects can be expressed in terms of the transfer efficiency of basaltic Ca and Sr to seawater in hydrothermal systems, which varies by a factor of ~1.6 over the Phanerozoic, with minima when seawater Mg and SO 4 are low. This effect provides a modest negative feedback on seawater composition and 87Sr/ 86Sr changes. For the mid-Cretaceous, the low 87Sr/ 86Sr of seawater requires either exceptionally large amounts of low-temperature exchange with oceanic crust or that the weathering flux of continentally derived Sr was especially small. Lastly, the model also has implications for MOR hydrothermal systems in the Precambrian, when low-seawater SO 4 could help explain low seawater 87Sr/ 86Sr.« less

Evaluating pasture and soil allowance of manganese for Kajli rams grazing in semi-arid environment.

PubMed

Khan, Zafar Iqbal; Ahmad, Kafeel; Ashraf, Muhammad; Naqvi, Syed Ali Hassan; Seidavi, Alireza; Akram, Nudrat Aisha; Laudadio, Vito; Tufarelli, Vincenzo

2015-03-01

The current research on the manganese (Mn) transfer from soil to plant as well as to grazing Kajli rams in the form of sampling periods was carried out under semi-arid environmental conditions. Forage, soil and blood plasma samples were collected during 4 months of the year after a 1-month interval, and Mn concentrations were assessed after wet digestion using an atomic absorption spectrophotometer. Results showed that Mn concentration in soil ranged from 48.28 to 59.44 mg/kg, with incoherent augment and decline across sampling periods, and effect of sampling period on soil Mn was also found to be significant (P < 0.05). The mean levels of Mn in soil appeared higher than the critical value and sufficient for forage crop requirement. The Mn concentration in forage ranged between 24.8 and 37.2 mg/kg, resulting deficient based on the requirement allowance of Mn for livestock grazing animals, therein with almost unchanged forage Mn concentration. The Mn values in blood plasma of rams varied from 0.066 to 0.089 mg/l, with a consistent increase based on sampling period, and the effect of sampling periods on plasma Mn was found to be highly significant (P < 0.05). The Mn levels in ram blood plasma were lesser than the normal level suggesting reasonable need for supplementation. Our study revealed the role of Mn availability in soil and plant species amassing capability on the transport of Mn in the soil-plant-animal system. Results indicated a much higher accumulation rate at the sampling characterized by vegetation dominated by legumes in comparison to grasses, crop residues and mixed pasture and a pronounced seasonal supply of Mn at the four sampling period of grazing land of diverse botanical composition.

Hot Extruded Polycrystalline Mg2Si with Embedded XS2 Nano-particles (X: Mo, W)

NASA Astrophysics Data System (ADS)

Bercegol, A.; Christophe, V.; Keshavarz, M. K.; Vasilevskiy, D.; Turenne, S.; Masut, R. A.

2017-05-01

Due to their abundant, inexpensive and non-toxic constituent elements, magnesium silicide and related alloys are attractive for large-scale thermoelectric (TE) applications in the 500-800 K temperature range, in particular for energy conversion. In this work, we propose a hot extrusion method favorable for large-scale production, where the starting materials (Mg2Si and XS2, X: W, Mo) are milled together in a sealed vial. The MoS2 nano-particles (0.5-2 at.%) act as solid lubricant during the extrusion process, thus facilitating material densification, as confirmed by density measurements based on Archimedes' method. Scanning electron microscopy images of bulk extruded specimens show a wide distribution of grain size, covering the range from 0.1 μm to 10 μm, and energy dispersive spectroscopy shows oxygen preferentially distributed at the grain boundaries. X-ray diffraction analysis shows that the major phase is the expected cubic structure of Mg2Si. The TE properties of these extruded alloys have been measured by the Harman method between 300 K and 700 K. Resistivity values at 700 K vary between 370 μΩ m and 530 μΩ m. The ZT value reaches a maximum of 0.26 for a sample with 2 at.% MoS2. Heat conductivity is reduced for extruded samples containing MoS2, which most likely behave as scattering centers for phonons. The reason why the WS2 particles do not bring any enhancement, for either densification or heat transfer reduction, might be linked to their tendency to agglomerate. These results open the way for further investigation to optimize the processing parameters for this family of TE alloys.

Using Cf-252 for single event upset testing

NASA Astrophysics Data System (ADS)

Howard, J. W.; Chen, R.; Block, R. C.; Becker, M.; Costantine, A. G.; Smith, L. S.; Soli, G. A.; Stauber, M. C.

An improved system using Cf-252 and associated nuclear instrumentation has been used to determine single event upset (SEU) cross section versus linear energy transfer (LET) curve for several static random access memory (SRAM) devices. Through the use of a thin-film scintillator, providing energy information on each fission fragment, individual SEU's and ion energy can be associated to calculate the cross section curves. Results are presented from tests of several SRAM's over the 17-43 MeV-cm squared/mg LET range. Values obtained for SEU cross sections and LET thresholds are in good agreement with the results from accelerator testing. The equipment is described, the theory of thin-film scintillation detector response is summarized, experimental procedures are reviewed, and the test results are discussed.

Repaglinide in type 2 diabetes: a 24-week, fixed-dose efficacy and safety study.

PubMed

Jovanovic, L; Dailey, G; Huang, W C; Strange, P; Goldstein, B J

2000-01-01

In this 24-week multicenter, double-blind, randomized, fixed-dose trial, 361 patients having type 2 diabetes received daily preprandial treatment with placebo (n = 75), repaglinide 1 mg (n = 140), or repaglinide 4 mg (n = 146). By a last-observation carried-forward calculation, repaglinide 1 mg or 4 mg treatment decreased mean fasting plasma glucose (FPG) values (by -47 mg/dL or -49 mg/dL) while the placebo group had increased FPG values (by 19 mg/dL). For the repaglinide treatment groups at the end of the study, changes in HbA1c from baseline values ranged from 1.8 to 1.9 percentage points lower than the placebo group. There were no events of severe hypoglycemia. Nearly all hypoglycemic symptom episodes had blood glucose levels above 45 mg/dL. Repaglinide was well tolerated in a preprandial fixed-dose regimen of 1 mg or 4 mg, assigned without adjustment for clinical parameters.

Litter mercury deposition in the Amazonian rainforest.

PubMed

Fostier, Anne Hélène; Melendez-Perez, José Javier; Richter, Larissa

2015-11-01

The objective of this work was to assess the flux of atmospheric mercury transferred to the soil of the Amazonian rainforest by litterfall. Calculations were based on a large survey of published and unpublished data on litterfall and Hg concentrations in litterfall samples from the Amazonian region. Litterfall based on 65 sites located in the Amazon rainforest averaged 8.15 ± 2.25 Mg ha(-1) y(-1). Average Hg concentrations were calculated from nine datasets for fresh tree leaves and ten datasets for litter, and a median concentration of 60.5 ng Hg g(-1) was considered for Hg deposition in litterfall, which averaged 49 ± 14 μg m(-2) yr(-1). This value was used to estimate that in the Amazonian rainforest, litterfall would be responsible for the annual removing of 268 ± 77 Mg of Hg, approximately 8% of the total atmospheric Hg deposition to land. The impact of the Amazon deforestation on the Hg biogeochemical cycle is also discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

Changes in the contents of four active diterpenoids at different growth stages in Andrographis paniculata (Burm.f.) Nees (Chuanxinlian)

PubMed Central

2013-01-01

Background The therapeutic activities of Andrographis paniculata are attributed to four major active diterpenoids: andrographolide (AP1), 14-deoxy-11,12-didehydroandrographolide (AP3), neoandrographolide (AP4), and 14-deoxyandrographolide (AP6). This study aims to quantify the four active diterpenoids in various plant organs of A. paniculata at different growth stages in greenhouse and field experiments, with a developed HPLC-diode array detector (HPLC-DAD) method for simultaneous determination of these diterpenoids. Methods Plants were grown in greenhouse and in field conditions, harvested at different growth stages, and separated into different organs for determination of the four active diterpenoids by an HPLC-DAD method. Results The most abundant diterpenoid was AP6 between seedling and vegetative stages in the greenhouse experiment (13.38 to 23.71 mg/g in 2006 and 10.67 to 24.54 mg/g in 2007). High levels of AP6 were also detected in leaves at the transfer stage in the greenhouse experiment (36.05 ± 0.69 mg/g) and field experiment (30.59 ± 1.39 mg/g). The levels of AP6 then decreased as plants matured. The highest content of AP4 was in cotyledons (16.65 ± 4.48 mg/g) at the transfer stage. The highest contents of AP1 were detected in leaves at seed-forming stage in greenhouse experiment (24.72 ± 1.89 mg/g) and vegetative stage in field experiment (43.16 ± 0.92 mg/g). Flowers of A. paniculata contained high levels of AP1 (21.42 ± 3.74 mg/g). AP3 and AP4 were at low levels in leaves at all growth stages. Conclusion In A. paniculata, AP6 was at the highest level in leaves at transfer stage in both greenhouse and field experiments. AP1 was at the highest level in leaves at vegetative stage and seed-forming stage in field and greenhouse experiments, respectively. The contents of AP3 and AP4 in leaves were low at all growth stages. PMID:23320627

Amount of balance necessary for the independence of transfer and stair-climbing in stroke inpatients.

PubMed

Fujita, Takaaki; Sato, Atsushi; Ohashi, Yuji; Nishiyama, Kazutaka; Ohashi, Takuro; Yamane, Kazuhiro; Yamamoto, Yuichi; Tsuchiya, Kenji; Otsuki, Koji; Tozato, Fusae

2018-05-01

The purpose of this study was to clarify the amount of balance necessary for the independence of transfer and stair-climbing in stroke patients. This study included 111 stroke inpatients. Simple and multiple regression analyses were conducted to establish the association between the FIM ® instrument scores for transfer or stair-climbing and Berg Balance Scale. Furthermore, receiver operating characteristic curves were used to elucidate the amount of balance necessary for the independence of transfer and stair-climbing. Simple and multiple regression analyses showed that the FIM ® instrument scores for transfer and stair-climbing were strongly associated with Berg Balance Scale. On comparison of the independent and supervision-dependent groups, Berg Balance Scale cut-off values for transfer and stair-climbing were 41/40 and 54/53 points, respectively. On comparison of the independent-supervision and dependent groups, the cut-off values for transfer and stair-climbing were 30/29 and 41/40 points, respectively. The calculated cut-off values indicated the amount of balance necessary for the independence of transfer and stair-climbing, with and without supervision, in stroke patients. Berg Balance Scale has a good discriminatory ability and cut-off values are clinically useful to determine the appropriate independence levels of transfer and stair-climbing in hospital wards. Implications for rehabilitation The Berg Balance Scale's (BBS) strong association with transfer and stair-climbing independence and performance indicates that establishing cut-off values is vitally important for the established use of the BBS clinically. The cut-off values calculated herein accurately demonstrate the level of balance necessary for transfer and stair-climbing independence, with and without supervision, in stroke patients. These criteria should be employed clinically for determining the level of independence for transfer and stair-climbing as well as for setting balance training goals aimed at improving transfer and stair-climbing.

Dissipation, transfer and safety evaluation of emamectin benzoate in tea.

PubMed

Zhou, Li; Luo, Fengjian; Zhang, Xinzhong; Jiang, Yaping; Lou, Zhengyun; Chen, Zongmao

2016-07-01

The dissipation and residue of emamectin benzoate in tea leaves and the residue transfer from tea leaves to tea brew were investigated by modified QuEChERS (quick, easy, cheap, effective, rugged and safe) combined with ultra performance liquid chromatography tandem mass (UPLC-MS/MS). The average recoveries ranged 85.3-101.3% with relative standard deviation (RSD) less than 15%. The limits of quantification (LOQ) were 0.005mgkg(-1) in tea leaves and 0.0004mgL(-1) in brew. Emamectin benzoate dissipated rapidly in tea with half-life (t1/2) of 1.0-1.3days. The terminal residues of emamectin benzoate were less than 0.062mgkg(-1). The leaching rate of emamectin benzoate from freshly-made tea to brew was <5%. The risk of emamectin benzoate at the recommended dosage was negligible to humans depending on risk quotient (RQ) value, that was lower than 1 significantly. This study could provide guidance for the safe use of emamectin benzoate and serve as a reference for the establishment of maximum residue limits (MRLs) in China. Copyright © 2016. Published by Elsevier Ltd.

Multilayer graphene growth on polar dielectric substrates using chemical vapour deposition

NASA Astrophysics Data System (ADS)

Karamat, S.; Çelik, K.; Shah Zaman, S.; Oral, A.

2018-06-01

High quality of graphene is necessary for its applications at industrial scale production. The most convenient way is its direct growth on dielectrics which avoid the transfer route of graphene from metal to dielectric substrate usually followed by graphene community. The choice of a suitable dielectric for the gate material which can replace silicon dioxide (SiO2) is in high demand. Various properties like permittivity, thermodynamic stability, film morphology, interface quality, bandgap and band alignment of other dielectrics with graphene needs more exploration. A potential dielectric material is required which could be used to grow graphene with all these qualities. Direct growth of graphene on magnesium oxide (MgO) substrates is an interesting idea and will be a new addition in the library of 2D materials. The present work is about the direct growth of graphene on MgO substrates by an ambient pressure chemical vapour deposition (CVD) method. We address the surface instability issue of the polar oxides which is the most challenging factor in MgO. Atomic force microscopy (AFM) measurements showed the topographical features of the graphene coated on MgO. X-ray photoelectron spectroscopy (XPS) study is carried out to extract information regarding the presence of necessary elements, their bonding with substrates and to confirm the sp-2 hybridization of carbon, which is a characteristic feature of graphene film. The chemical shift is due to the surface reconstruction of MgO in the prepared samples. For graphene-MgO interface, valence band offset (VBO) and conduction band offset (CBO) extracted from valence band spectra reported. Further, we predicted the energy band diagram for single layer and thin film of graphene. By using the room-temperature energy band gap values of MgO and graphene, the CBO is calculated to be 6.85 eV for single layer and 5.66 eV for few layer (1-3) of graphene layers.

In vitro callus induction and plantlet regeneration of Achyranthes aspera L., a high value medicinal plant

PubMed Central

Sen, Monokesh Kumer; Nasrin, Shamima; Rahman, Shahedur; Jamal, Abu Hena Mostofa

2014-01-01

Objective To study callus induction from different explants (internode, leaf, root) and in vitro plantlets propagation from medicinally important plant Achyranthes aspera L. Methods Sterilized explants were prepared by using 0.1% HgCl2 and 0.5% Bavistin and callus was obtained when cultured onto Murashige Skoog's (MS) medium by using different concentrations and combination of 2,4-D, NAA, BAP, IAA, IBA with 3% sucrose and 0.8% agar. Induced callus was immediately transferred to MS medium containing at different concentrations of phytohormones for shootlets and rootlets induction respectively. Results Sterilization treatment of 0.1% HgCl2 for 2-3 min and Bavistin 0.5% for 10-12 min showed the highest percentage of asepsis and survival rate. Maximum induction of callus was obtained from a combination of 2.0 mg/L 2,4-D and 0.5 mg/L NAA from leaf. Highest shootlets number (4.83±0.17) and length (3.8±0.16) cm were observed on full strength MS medium when fortified with BAP 4.0 mg/L and KIN 0.5 mg/L. Concerted efforts of BAP 2.0 mg/L and NAA 0.5 mg/L on full strength MS medium showed highest leaf number (6.77±0.94). In vitro raised shoots were allowed to root on different strengths of MS medium fortified with IAA and IBA at different concentrations. Experimentally, 3.0 mg/L IBA was enabled to induce maximum rootlets number (10.0±9.82) on full strength MS medium. Afterwards, regenerated shoots with well developed roots were successfully subjected to hardening process and were acclimatized. The survived plantlets showed 66.67% survival frequency without any morphological abnormality. Conclusions The results demonstrated that different explants were good source of callus induction, morphology analysis as well as indirect plantlets regeneration. PMID:24144129

Lead and cadmium contamination and exposure risk assessment via consumption of vegetables grown in agricultural soils of five-selected regions of Pakistan.

PubMed

Rehman, Zahir Ur; Khan, Sardar; Brusseau, Mark L; Shah, Mohammad Tahir

2017-02-01

Rapid urbanization and industrialization result in serious contamination of soil with toxic metals such as lead (Pb) and cadmium (Cd), which can lead to deleterious health impacts in the exposed population. This study aimed to investigate Pb and Cd contamination in agricultural soils and vegetables in five different agricultural sites in Pakistan. The metal transfer from soil-to-plant, average daily intake of metals, and health risk index (HRI) were also characterized. The Pb concentrations for all soils were below the maximum allowable limits (MAL 350 mg kg -1 ) set by State Environmental Protection Administration of China (SEPA), for soils in China, while Cd concentrations in the soils were exceeded the MAL (61.7-73.7% and 4.39-34.3%) set by SEPA (0.6 mg kg - ), and European Union, (1.5 mg kg -1 ) respectively. The mean Pb concentration in edible parts of vegetables ranged from 1.8 to 11 mg kg -1 . The Pb concentrations for leafy vegetables were higher than the fruiting and pulpy vegetables. The Pb concentrations exceeded the MAL (0.3 mg kg -1 ) for leafy vegetables and the 0.1 mg kg -1 MAL for fruity and rooty/tuber vegetables set by FAO/WHO-CODEX. Likewise, all vegetables except Pisum sativum (0.12 mg kg -1 ) contained Cd concentrations that exceeded the MAL set by SEPA. The HRI values for Pb and Cd were <1 for both adults and children for most of the vegetable species except Luffa acutangula, Solanum lycopersicum, Benincasa hispada, Momordi charantia, Aesculantus malvaceae, Cucumis sativus, Praecitrullus fistulosus, Brassica oleracea, and Colocasia esculanta for children. Based on these results, consumption of these Pb and Cd contaminated vegetables poses a potential health risk to the local consumers. Copyright © 2016 Elsevier Ltd. All rights reserved.

Three-State Quantum Dot Gate FETs Using ZnS-ZnMgS Lattice-Matched Gate Insulator on Silicon

NASA Astrophysics Data System (ADS)

Karmakar, Supriya; Suarez, Ernesto; Jain, Faquir C.

2011-08-01

This paper presents the three-state behavior of quantum dot gate field-effect transistors (FETs). GeO x -cladded Ge quantum dots (QDs) are site-specifically self-assembled over lattice-matched ZnS-ZnMgS high- κ gate insulator layers grown by metalorganic chemical vapor deposition (MOCVD) on silicon substrates. A model of three-state behavior manifested in the transfer characteristics due to the quantum dot gate is also presented. The model is based on the transfer of carriers from the inversion channel to two layers of cladded GeO x -Ge quantum dots.

Total fume and metal concentrations during welding in selected factories in Jeddah, Saudi Arabia.

PubMed

Balkhyour, Mansour Ahmed; Goknil, Mohammad Khalid

2010-07-01

Welding is a major industrial process used for joining metals. Occupational exposure to welding fumes is a serious occupational health problem all over the world. The degree of risk to welder's health from fumes depends on composition, concentration, and the length of exposure. The aim of this study was to investigate workers' welding fume exposure levels in some industries in Jeddah, Saudi Arabia. In each factory, the air in the breathing zone within 0.5 m from welders was sampled during 8-hour shifts. Total particulates, manganese, copper, and molybdenum concentrations of welding fumes were determined. Mean values of eight-hour average particulate concentrations measured during welding at the welders breathing zone were 6.3 mg/m(3) (Factory 1), 5.3 mg/m(3) (Factory 2), 11.3 mg/m(3) (Factory 3), 6.8 mg/m(3) (Factory 4), 4.7 mg/m(3) (Factory 5), and 3.0 mg/m(3) (Factory 6). Mean values of airborne manganese, copper, and molybdenum levels measured during welding were in the range of 0.010 mg/m(3)-0.477 mg/m(3), 0.001 mg/m(3)-0.080 mg/m(3) and 0.001 mg/m(3)-0.058 mg/m(3) respectively. Mean values of calculated equivalent exposure values were: 1.50 (Factory 1), 1.56 (Factory 2), 5.14 (Factory 3), 2.21 (Factory 4), 2.89 (Factory 5), and 1.20 (Factory 6). The welders in factories 1, 2, 3, and 4 were exposed to welding fume concentration above the SASO limit value, which may increase the risk of respiratory health problems.

The effect of changing seawater Ca and Mg concentrations upon the distribution coefficients of Mg and Sr in the skeletons of the scleractinian coral Pocillopora damicornis

NASA Astrophysics Data System (ADS)

Giri, Sharmila J.; Swart, Peter K.; Devlin, Quinn B.

2018-02-01

The skeletal composition of calcifying organisms, in particular Mg/Ca and Sr/Ca ratios, have been widely used to understand fluctuations in seawater chemistry throughout the Phanerozoic. While the success of applying these data to the geologic record depends on a knowledge of the distribution coefficients for these elements (DMg and DSr), there are scarcely any studies which have described how these values vary as a result of changing seawater Mg/Ca ratios. To address this, we have cultured the scleractinian coral, Pocillopora damicornis, in seawater with ranges of Mg and Ca concentrations. Here, we demonstrate that Mg/Ca and Sr/Ca ratios of coral skeletons correlate with total seawater Mg/Ca and Sr/Ca molar ratios, but that apparent DMg and DSr values do not remain constant across the range of experimental seawater treatments, with DMg values significantly increasing with seawater Mg/Ca ratios and DSr values significantly increasing with seawater Ca concentrations. These trends are not rate dependent and may be best explained by a Rayleigh distillation model, in which the calcifying space is semi-isolated from seawater during skeletogenesis (i.e. leaky). As there is a slight increase in DMg and decrease in DSr values between our "Jurassic" and "Modern" seawater treatments, the application of a constant distribution coefficient to estimate changes in ancient seawater chemistry may underestimate seawater Mg/Ca ratios and overestimate Sr/Ca throughout the Mesozoic and Cenozoic. We suggest that interpretations of seawater chemistry from fossil corals may be improved by using the relationships derived for skeletal and seawater Mg/Ca and Sr/Ca ratios established by our experiments, as they incorporate the effect of seawater Mg/Ca ratios on skeletal Mg/Ca and Sr/Ca ratios.

Analysis and comparison of the cost-effectiveness of statins according to the baseline low-density lipoprotein cholesterol level in Korea.

PubMed

Jeong, Y J; Kim, H; Baik, S J; Kim, T M; Yang, S J; Lee, S-H; Cho, J-H; Lee, H; Yim, H W; Choi, I Y; Yoon, K-H; Kim, H-S

2017-06-01

There are a few Korean studies on the economics of statins based on reduction in low-density lipoprotein cholesterol (LDL-C) data from other countries. This study aimed to analyse and compare the cost-effectiveness of statins according to the baseline LDL-C level in Korea. Between January 2009 and December 2015, the data of patients who were prescribed statins for the first time were extracted from electronic medical records. We performed a cost-effectiveness analysis (CEA) based on the LDL-C reduction rate (CEA-RR) and target achievement rate. Among high-intensity statins, the CEA-RR value of rosuvastatin (20 mg) was significantly lower than that of atorvastatin (40 mg) at all baseline LDL-C levels, except levels of 160-189 mg/dL. Additionally, at baseline LDL-C levels of 130-159 mg/dL, the CEA-RR value of rosuvastatin (20 mg) was three times lower than that of atorvastatin (40 mg) (9·1 ± 2·5 $/% vs. 31·7 ± 15·0 $/%, P < 0·001). Among moderate-to-low-intensity statins, rosuvastatin (5 mg) showed the lowest CEA-RR value (4·0 ± 0·6 $/%), and the value significantly increased for pitavastatin (2 mg) (8·0 ± 0·6 $/%), atorvastatin (10 mg) (9·5 ± 0·5 $/%), simvastatin (10·8 ± 1·1 $/%) and pravastatin (40 mg) (11·5 ± 0·9 $/%) in order (P < 0·0001). On changing from atorvastatin (10 mg) to atorvastatin (20 mg), the additional yearly cost was 16·0 and additional CEA-RR value was 2·74 $/%. On the other hand, on changing from atorvastatin (10 mg) to rosuvastatin (10 mg), the additional yearly cost was -16·3 and additional CEA-RR value was -1·8 $/%. We successfully compared the cost-effectiveness of statins according to the baseline LDL-C level in Korea. It is expected that our findings will help clinical decision-making with regard to statin prescription, and this will help reduce national medical expenditure. © 2017 John Wiley & Sons Ltd.

New Reference Values for Vitamin C Intake.

PubMed

2015-01-01

The German, Austrian, and Swiss nutrition societies are the editors of the 'reference values for nutrient intake'. They have revised the reference values for the intake of vitamin C and published them in February 2015. The average vitamin C requirement in healthy adults is considered to be the vitamin C amount that compensates for the metabolic losses of vitamin C, and ensures a fasting ascorbate plasma level of 50 µmol/l. Based on the present data from studies with non-smoking men, metabolic losses of 50 mg/day are assumed, as well as an absorption rate of 80% and an urinary excretion of 25% of the vitamin C intake. Taking this into account, the calculated average requirement in men is 91 mg/day. Considering a coefficient of variation of 10%, a reference value (recommended intake) of 110 mg/day for men is derived. The vitamin C requirement in women as well as in children and adolescents is extrapolated from the requirement in men and in relation to their body weight. This results in a recommended intake of about 95 mg/day for adult women. Because the requirement in pregnant and lactating women is increased, higher recommended intakes are derived for them, 105 mg/day for pregnant women from the fourth month on and 125 mg/day for lactating women, respectively. For boys and girls at the age of 1 to under 15 years, there are increasing recommended intake values from 20 to 85 mg/day. For male and female adolescents, at the age of 15 to under 19 years, the recommended intake is 105 and 90 mg, respectively. As smokers have higher metabolic losses and lower plasma levels of vitamin C than non-smokers (turnover is 40% higher), the reference value for vitamin C intake is set to 135 mg/day for female smokers and 155 mg/day for male smokers. For infants in their first year of life, the reference value (estimated value) is set to 20 mg vitamin C/ day, based upon the lowest observed vitamin C intake for infants in the United Kingdom and the United States, that obviously meets the requirement in infants and that is 3 times higher than the amount necessary to prevent scurvy (7 mg/day). © 2015 S. Karger AG, Basel.

Malaysian brown seaweeds Sargassum siliquosum and Sargassum polycystum: Low density lipoprotein (LDL) oxidation, angiotensin converting enzyme (ACE), α-amylase, and α-glucosidase inhibition activities.

PubMed

Nagappan, Hemlatha; Pee, Poh Ping; Kee, Sandra Hui Yin; Ow, Ji Tsong; Yan, See Wan; Chew, Lye Yee; Kong, Kin Weng

2017-09-01

Two Malaysian brown seaweeds, Sargassum siliquosum and Sargassum polycystum were first extracted using methanol to get the crude extract (CE) and further fractionated to obtain fucoxanthin-rich fraction (FRF). Samples were evaluated for their phenolic, flavonoid, and fucoxanthin contents, as well as their inhibitory activities towards low density lipoprotein (LDL) oxidation, angiotensin converting enzyme (ACE), α-amylase, and α-glucosidase. In LDL oxidation assay, an increasing trend in antioxidant activity was observed as the concentration of FRF (0.04-0.2mg/mL) and CE (0.2-1.0mg/mL) increased, though not statistically significant. As for serum oxidation assay, significant decrease in antioxidant activity was observed as concentration of FRF increased, while CE showed no significant difference in inhibitory activity across the concentrations used. The IC 50 values for ACE inhibitory activity of CE (0.03-0.42mg/mL) were lower than that of FRF (0.94-1.53mg/mL). When compared to reference drug Voglibose (IC 50 value of 0.61mg/mL) in the effectiveness in inhibiting α-amylase, CE (0.58mg/mL) gave significantly lower IC 50 values while FRF (0.68-0.71mg/mL) had significantly higher IC 50 values. The α-glucosidase inhibitory activity of CE (IC 50 value of 0.57-0.69mg/mL) and FRF (IC 50 value of 0.50-0.53mg/mL) were comparable to that of reference drug (IC 50 value of 0.54mg/mL). Results had shown the potential of S. siliquosum and S. polycystum in reducing cardiovascular diseases related risk factors following their inhibitory activities on ACE, α-amylase and α-glucosidase. In addition, it is likelihood that FRF possessed antioxidant activity at low concentration level. Copyright © 2017 Elsevier Ltd. All rights reserved.

26 CFR 1.684-2 - Transfers.

Code of Federal Regulations, 2011 CFR

2011-04-01

... 1, 2007, at a time when the fair market value of the property is 1100X, I transfers the property to... market value of 500X and an adjusted basis of 100X to FT. At the time of the transfer, FT has no U.S... time of the transfer by DT to FT. Example 2. Transfer by a foreign trust. On January 1, 2001, A...

26 CFR 1.684-2 - Transfers.

Code of Federal Regulations, 2013 CFR

2013-04-01

... 1, 2007, at a time when the fair market value of the property is 1100X, I transfers the property to... market value of 500X and an adjusted basis of 100X to FT. At the time of the transfer, FT has no U.S... time of the transfer by DT to FT. Example 2. Transfer by a foreign trust. On January 1, 2001, A...

26 CFR 1.684-2 - Transfers.

Code of Federal Regulations, 2012 CFR

2012-04-01

... 1, 2007, at a time when the fair market value of the property is 1100X, I transfers the property to... market value of 500X and an adjusted basis of 100X to FT. At the time of the transfer, FT has no U.S... time of the transfer by DT to FT. Example 2. Transfer by a foreign trust. On January 1, 2001, A...

Formation of atomically smooth epitaxial metal films on a chemically reactive interface: Mg on Si(111)

NASA Astrophysics Data System (ADS)

Özer, Mustafa M.; Weitering, Hanno H.

2013-07-01

Deposition of Mg on Si(111)7 × 7 produces an epitaxial magnesium silicide layer. Under identical annealing conditions, the thickness of this Mg2Si(111) layer increases with deposition amount, reaching a maximum of 4 monolayer (ML) and decreasing to ˜3 ML at higher Mg coverage. Excess Mg coalesces into atomically flat, crystalline Mg(0001) films. This surprising growth mode can be attributed to the accidental commensurability of the Mg(0001), Si(111), and Mg2Si(111) interlayer spacing and the concurrent minimization of in-plane Si mass transfer and domain-wall energies. The commensurability of the interlayer spacing defines a highly unique solid-phase epitaxial growth process capable of producing trilayer structures with atomically abrupt interfaces and atomically smooth surface morphologies.

Enzyme Hydrolysates from Stichopus horrens as a New Source for Angiotensin-Converting Enzyme Inhibitory Peptides

PubMed Central

Forghani, Bita; Ebrahimpour, Afshin; Bakar, Jamilah; Abdul Hamid, Azizah; Hassan, Zaiton; Saari, Nazamid

2012-01-01

Stichopus horrens flesh was explored as a potential source for generating peptides with angiotensin-converting enzyme (ACE) inhibitory capacity using 6 proteases, namely alcalase, flavourzyme, trypsin, papain, bromelain, and protamex. Degree of hydrolysis (DH) and peptide profiling (SDS-PAGE) of Stichopus horrens hydrolysates (SHHs) was also assessed. Alcalase hydrolysate showed the highest DH value (39.8%) followed by flavourzyme hydrolysate (32.7%). Overall, alcalase hydrolysate exhibited the highest ACE inhibitory activity (IC50 value of 0.41 mg/mL) followed by flavourzyme hydrolysate (IC50 value of 2.24 mg/mL), trypsin hydrolysate (IC50 value of 2.28 mg/mL), papain hydrolysate (IC50 value of 2.48 mg/mL), bromelain hydrolysate (IC50 value of 4.21 mg/mL), and protamex hydrolysate (IC50 value of 6.38 mg/mL). The SDS-PAGE results showed that alcalase hydrolysate represented a unique pattern compared to others, which yielded potent ACE inhibitory peptides with molecular weight distribution lower than 20 kDa. The evaluation of the relationship between DH and IC50 values of alcalase and flavourzyme hydrolysates revealed that the trend between those parameters was related to the type of the protease used. We concluded that the tested SHHs would be used as a potential source of functional ACE inhibitory peptides for physiological benefits. PMID:22927875

Enzyme Hydrolysates from Stichopus horrens as a New Source for Angiotensin-Converting Enzyme Inhibitory Peptides.

PubMed

Forghani, Bita; Ebrahimpour, Afshin; Bakar, Jamilah; Abdul Hamid, Azizah; Hassan, Zaiton; Saari, Nazamid

2012-01-01

Stichopus horrens flesh was explored as a potential source for generating peptides with angiotensin-converting enzyme (ACE) inhibitory capacity using 6 proteases, namely alcalase, flavourzyme, trypsin, papain, bromelain, and protamex. Degree of hydrolysis (DH) and peptide profiling (SDS-PAGE) of Stichopus horrens hydrolysates (SHHs) was also assessed. Alcalase hydrolysate showed the highest DH value (39.8%) followed by flavourzyme hydrolysate (32.7%). Overall, alcalase hydrolysate exhibited the highest ACE inhibitory activity (IC(50) value of 0.41 mg/mL) followed by flavourzyme hydrolysate (IC(50) value of 2.24 mg/mL), trypsin hydrolysate (IC(50) value of 2.28 mg/mL), papain hydrolysate (IC(50) value of 2.48 mg/mL), bromelain hydrolysate (IC(50) value of 4.21 mg/mL), and protamex hydrolysate (IC(50) value of 6.38 mg/mL). The SDS-PAGE results showed that alcalase hydrolysate represented a unique pattern compared to others, which yielded potent ACE inhibitory peptides with molecular weight distribution lower than 20 kDa. The evaluation of the relationship between DH and IC(50) values of alcalase and flavourzyme hydrolysates revealed that the trend between those parameters was related to the type of the protease used. We concluded that the tested SHHs would be used as a potential source of functional ACE inhibitory peptides for physiological benefits.

45 CFR 2530.50 - Is there a limit on the amount of transferred awards a designated individual may receive?

Code of Federal Regulations, 2010 CFR

2010-10-01

... education awards. If the sum of the value of the requested transfer plus the aggregate value of education... received the aggregate value of two full-time education awards, the individual may not receive a... to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE TRANSFER OF EDUCATION...

Frozen-thawed embryo transfer in a natural or mildly hormonally stimulated cycle in women with regular ovulatory cycles: a RCT.

PubMed

Peeraer, Karen; Couck, Isabelle; Debrock, Sophie; De Neubourg, Diane; De Loecker, Peter; Tomassetti, Carla; Laenen, Annouschka; Welkenhuysen, Myriam; Meeuwis, Luc; Pelckmans, Sofie; Meuleman, Christel; D'Hooghe, Thomas

2015-11-01

Can ovarian stimulation with low dose hMG improve the implantation rate (IR) per frozen-thawed embryo transferred (FET) when compared with natural cycle in an FET programme in women with a regular ovulatory cycle? Both IR and live birth rate (LBR) per FET were similar in the group with mild ovarian stimulation and the natural cycle group. Different cycle regimens for endometrial preparation are used prior to FET: spontaneous ovulatory cycles, cycles with artificial endometrial preparation using estrogen and progesterone hormones, and cycles stimulated with gonadotrophins or clomiphene citrate. At present, it is not clear which regimen results in the highest IR or LBR. More specifically, there are no RCTs in ovulatory women comparing reproductive outcome after FET during a natural cycle and during a hormonally stimulated cycle. A total of 410 women scheduled for FET during 579 cycles (December 2003-September 2013) were enrolled in an open-label RCT to natural cycle (NC FET group, n = 291) or to a cycle hormonally stimulated with s.c. gonadotrophins (hMG FET group, 37.5-75 IU per day, n = 288). A total of 672 embryos were transferred during 434 cycles (332 embryos and 213 cycles in the NC FET group; 340 embryos and 221 cycles in the hMG FET group). Assuming a = 0.05 and 80% power, it was calculated that 219 frozen-thawed embryos were required for transfer in each group to demonstrate a difference of 10% in IR. Women were eligible according to the following inclusion criteria: regular ovulatory cycle, female age ≥21 years and ≤45 years, informed consent. FET cycles with preimplantation genetic screening were excluded. The primary outcome was IR per embryo transferred. Secondary outcomes included IR with fetal heart beat (FHB), LBR per embryo transferred and endometrial thickness on the day of hCG administration. Statistical analysis was by intention to treat and controlled for the presence of multiple measures, as eligible women could be randomized in more than one cycle. Chi-square and independent t-test were used to compare categorical and continuous variables. The relative risk (RR) was estimated using a Poisson model with log link. Hierarchical models with random intercepts for patient and cycle were considered to account for clustering of cycles within patients and of embryos within cycles. The primary outcome, IR per embryo transferred, was not statistically different between the NC FET group (41/332 (12.35%)) and in the hMG FET group (55/340 (16.18%)) (RR 1.3 (95% confidence interval (CI) 0.9-2.0), P = 0.19). Similarly, the secondary outcome, IR with FHB per embryo transferred, was 34/332 (10.24%) in the NC FET group and 48/340 (14.12%) in the hMG FET group (RR 1.4 (95% CI 0.9-2.1), P = 0.15). The LBR per embryo transferred was 32/332 (9.64%) in the NC FET group and 45/340 (13.24%) in the hMG FET group (RR 1.4 (95% CI 0.9-2.2), P = 0.17). Endometrial thickness was also similar in both groups [8.9 (95% CI 8.7-9.1) in the NC FET group and 8.9 (95% CI 8.7-9.1) in the hMG FET group]. The duration of the follicular phase was significantly shorter (P < 0.001) in the hMG FET group [13.7 days (95% CI 13.2-14.2)] than in the NC FET group [15.4 days (95% CI 14.8-15.9)]. Randomization of cycles instead of patients; open-label design; relatively long period of recruitment. Our observation that the IR per embryo transferred is not significantly increased after FET during natural or gonadotrophin stimulated cycle, suggests that the effect of mild hormonal stimulation with gonadotrophins is smaller than what was considered clinically relevant with respect to reproductive outcome after FET. These data suggest that endometrial receptivity is not relevantly improved, but also not impaired after hormonal stimulation with gonadotrophins. Since FET during a natural cycle is cheaper and more patient-friendly, we recommend this regimen as the treatment of choice for women with regular cycles undergoing FET. clinicaltrials.gov NCT00492934. 26 June 2007. 1 December 2003. © The Author 2015. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

26 CFR 25.2701-5 - Adjustments to mitigate double taxation.

Code of Federal Regulations, 2012 CFR

2012-04-01

... time of the initial transfer (or the remaining portion thereof). (b) Amount of reduction. Except as...) duplicated in the transfer tax base at the time of the transfer of the section 2701 interest (the duplicated... tax value of the section 2701 interest at the time of the subsequent transfer exceeds the value of...

26 CFR 25.2701-5 - Adjustments to mitigate double taxation.

Code of Federal Regulations, 2013 CFR

2013-04-01

... time of the initial transfer (or the remaining portion thereof). (b) Amount of reduction. Except as...) duplicated in the transfer tax base at the time of the transfer of the section 2701 interest (the duplicated... tax value of the section 2701 interest at the time of the subsequent transfer exceeds the value of...

Revealed and stated preference valuation and transfer: A within-sample comparison of water quality improvement values

NASA Astrophysics Data System (ADS)

Ferrini, Silvia; Schaafsma, Marije; Bateman, Ian

2014-06-01

Benefit transfer (BT) methods are becoming increasingly important for environmental policy, but the empirical findings regarding transfer validity are mixed. A novel valuation survey was designed to obtain both stated preference (SP) and revealed preference (RP) data concerning river water quality values from a large sample of households. Both dichotomous choice and payment card contingent valuation (CV) and travel cost (TC) data were collected. Resulting valuations were directly compared and used for BT analyses using both unit value and function transfer approaches. WTP estimates are found to pass the convergence validity test. BT results show that the CV data produce lower transfer errors, below 20% for both unit value and function transfer, than TC data especially when using function transfer. Further, comparison of WTP estimates suggests that in all cases, differences between methods are larger than differences between study areas. Results show that when multiple studies are available, using welfare estimates from the same area but based on a different method consistently results in larger errors than transfers across space keeping the method constant.

Enhancement of Spin-transfer torque switching via resonant tunneling

DOE Office of Scientific and Technical Information (OSTI.GOV)

Chatterji, Niladri; Tulapurkar, Ashwin A.; Muralidharan, Bhaskaran

We propose the use of resonant tunneling as a route to enhance the spin-transfer torque switching characteristics of magnetic tunnel junctions. The proposed device structure is a resonant tunneling magnetic tunnel junction based on a MgO-semiconductor heterostructure sandwiched between a fixed magnet and a free magnet. Using the non-equilibrium Green's function formalism coupled self consistently with the Landau-Lifshitz-Gilbert-Slonczewski equation, we demonstrate enhanced tunnel magneto-resistance characteristics as well as lower switching voltages in comparison with traditional trilayer devices. Two device designs based on MgO based heterostructures are presented, where the physics of resonant tunneling leads to an enhanced spin transfer torquemore » thereby reducing the critical switching voltage by up to 44%. It is envisioned that the proof-of-concept presented here may lead to practical device designs via rigorous materials and interface studies.« less

Irrigation model of bleached Kraft mill wastewater through volcanic soil as a pollutants attenuation process.

PubMed

Navia, R; Inostroza, X; Diez, M C; Lorber, K E

2006-05-01

An irrigation process through volcanic soil columns was evaluated for bleached Kraft mill effluent pollutants retention. The system was designed to remove color and phenolic compounds and a simple kinetic model for determining the global mass transfer coefficient and the adsorption rate constant was used. The results clearly indicate that the global mass transfer coefficient values (K(c)a) and the adsorption rate constants are higher for the irrigation processes onto acidified soil. This means that the pretreatment of washing the volcanic soil with an acid solution has a positive effect on the adsorption rate for both pollutant groups. The enhanced adsorption capacity is partially explained by the activation of the metal oxides present in the soil matrix during the acid washing process. Increasing the flow rate from 1.5 to 2.5 ml/min yielded higher (K(c)a) values and adsorption rate constants for both pollutant groups. For instance, regarding color adsorption onto acidified soil, there is an increment of 43% in the (K(c)a) value for the experiment with a flow rate of 2.5 ml/min. Increasing the porosity of the column from 0.55 to 0.59, yielded a decrease in the (K(c)a) values for color and phenolic compounds adsorption processes. Onto natural soil for example, these decreases reached 21% and 24%, respectively. Therefore, the (K(c)a) value is dependent on both the liquid-phase velocity (external resistance) and the soil fraction in the column (internal resistance); making forced convection and diffusion to be the main transport mechanisms involved in the adsorption process. Analyzing the adsorption rate constants (K(c)a)/m, phenolic compounds and color adsorption rates onto acidified soil of 2.25 x 10(-6) and 2.62 x 10(-6) l/mg min were achieved for experiment 1. These adsorption rates are comparable with other adsorption systems and adsorbent materials.

Contaminant dispersion at the rehabilitated Mary Kathleen uranium mine, Australia

NASA Astrophysics Data System (ADS)

Lottermoser, B. G.; Ashley, P. M.; Costelloe, M. T.

2005-09-01

This study reports on the transfer of contaminants from waste rock dumps and mineralised ground into soils, sediments, waters and plants at the rehabilitated Mary Kathleen uranium mine in semi-arid northwest Queensland. Numerous waste rock dumps were partly covered with benign soil and the open pit mine was allowed to flood. The mineralised and waste calc-silicate rock in the open pit and dumps has major (>1 wt%) Ca, Fe and Mg, minor (>1,000 ppm) Ce, La, Mn, P and S, subminor (>100 ppm) Ba, Cu, Th and U, and trace (<100 ppm) As, Ni, Pb, Y and Zn values. Consequently, chemical and physical weathering processes have acted on waste rock and on rock faces within the open pit, mobilising many elements and leading to their dispersion into soils, stream sediments, pit water and several plant species. Chemical dispersion is initiated by sulfide mineral breakdown, generation of sulfuric acid and formation of several soluble, transient sulfate minerals as evaporative efflorescent precipitates. Radiation doses associated with the open pit average 5.65 mSv year-1; waste dumps commonly have lower values, especially where soil-covered. Surface pit water is slightly acid, with high sulfate values accompanied by levels of U, Cu and Ni close to or above Australian water guideline values for livestock. Dispersion of U and related elements into soils and stream sediments occurs by physical (erosional) processes and from chemical precipitation. Plants growing in the mine void, on waste dumps and contaminated soil display evidence of biological uptake of U, LREE, Cu and Th and to a lesser degree of As, Ni, Pb, Y and Zn, with values being up to 1-2 orders of magnitude above background sites for the same species. Although rehabilitation procedures have been partly successful in reducing dispersion of U and related elements into the surrounding environment, it is apparent that 20 years after rehabilitation, there is significant physical and chemical mobility, including transfer into plants.

Valuing ecosystem services using benefit transfer: separating credible and incredible approaches: chapter 3

USGS Publications Warehouse

Loomis, John H.; Richardson, Leslie; Kroeger, Timm; Casey, Frank

2014-01-01

Ecosystem goods and services are now widely recognized as the benefits that humans derive from the natural environment around them including abiotic (e.g. atmosphere) and biotic components. The work by Costanza et al. (1997) to value the world’s ecosystem services brought the concept of ecosystem service valuation to the attention of the world press and environmental economists working in the area of non-market valuation. The article’s US$33 trillion estimate of these services, despite world GDP being only US$18 trillion, was definitely headline grabbing. This ambitious effort was undertaken with reliance on transferring existing values per unit from other (often site specific) valuation studies. Benefit transfer (see Boyle and Bergstrom, 1992; Rosenberger and Loomis, 2000, 2001) involves transfers of values per unit from an area that has been valued using primary valuation methods such as contingent valuation, travel cost or hedonic property methods (Champ et al., 2003) to areas for which values are needed. Benefit transfer often provides a reasonable approximation of the benefit of unstudied ecosystem services based on transfer of benefits estimates per unit (per visitor day, per acre) from existing studies. An appropriate benefit transfer should be performed on the same spatial scale of analysis (e.g. reservoir to reservoir, city to city) as the original study. However, the reasonableness of benefit transfer may be strained when applying locally derived per acre values from studies of several thousand acres of a resource such as wetlands to hundreds of millions of acres of wetlands.

Effect of a solid solution on the steady-state creep behavior of an aluminum matrix composite

NASA Astrophysics Data System (ADS)

Pandey, A. B.; Mishra, R. S.; Mahajan, Y. R.

1996-02-01

The effect of an alloying element, 4 wt pct Mg, on the steady-state creep behavior of an Al-10 vol pct SiCp composite has been studied. The Al-4 wt pct Mg-10 vol pct SiCp composite has been tested under compression creep in the temperature range 573 to 673 K. The steady-state creep data of the composite show a transition in the creep behavior (regions I and II) depending on the applied stress at 623 and 673 K. The low stress range data (region I) exhibit a stress exponent of about 7 and an activation energy of 76.5 kJ mol-1. These values conform to the dislocation-climb-controlled creep model with pipe diffusion as a rate-controlling mechanism. The intermediate stress range data (region II) exhibit high and variable apparent stress exponents, 18 to 48, and activation energy, 266 kJ mol-1, at a constant stress, σ = 50 MPa, for creep of this composite. This behavior can be rationalized using a substructure-invariant model with a stress exponent of 8 and an activation energy close to the lattice self-diffusion of aluminum together with a threshold stress. The creep data of the Al-Mg-A12O3f composite reported by Dragone and Nix also conform to the substructure-invariant model. The threshold stress and the creep strength of the Al-Mg-SiCp, composite are compared with those of the Al-Mg-Al2O3f and 6061 Al-SiCp.w, composites and discussed in terms of the load-transfer mechanism. Magnesium has been found to be very effective in improving the creep resistance of the Al-SiCp composite.

Antipsychotic activity of standardized Bacopa extract against ketamine-induced experimental psychosis in mice: Evidence for the involvement of dopaminergic, serotonergic, and cholinergic systems.

PubMed

Chatterjee, Manavi; Verma, Rajkumar; Kumari, Reena; Singh, Seema; Verma, Anil Kumar; Dwivedi, Anil Kumar; Palit, Gautam

2015-01-01

Schizophrenia is a chronic disabling psychiatric disorder affecting 1% of the population worldwide. Due to the adverse effects of available antipsychotic medications, recent investigations have focused on the search for well-tolerated, safe molecules from natural resources to control the severity and progression of schizophrenia. To screen the standardized extract of Bacopa monniera Linn. (Scrophulariaceae) (BM) for its antipsychotic potential in the ketamine-induced psychosis model with mice. Graded dose of BM (40, 80, and 120 mg/kg, p.o.) were given to the mice 1 h prior to ketamine administration and tested for positive symptoms and cognitive deficits. A chronic ketamine treatment regimen was used to study the effect of BM on negative symptoms such as immobility enhancement. Each mouse was used once for the behavioral studies. BM reduced ketamine-induced hyperactivity with an EC50 value of 76.60 mg/kg. The 80 mg/kg dose was used for all other behavior analysis. Pretreatment with BM at 80 mg/kg showed two-fold increases in transfer latency time (TLT) in passive avoidance task. Chronic BM pretreatment (80 mg/kg p.o. daily × 10 d) ameliorated the ketamine-induced enhanced immobility effect by 21% in the forced swim test. BM treatment reversed ketamine-induced increase in monoamine oxidase activity in both cortex and striatum and normalized the acetylcholinesterase activity and the glutamate levels in the hippocampus. Overall our findings suggest that BM possesses antipsychotic properties which might be due to its modulatory action on dopamine, serotonin, and glutamate neurotransmission.

Treating a natural outbreak of columnaris in channel catfish with copper sulfate and potassium permanganate

USDA-ARS?s Scientific Manuscript database

An F. Columnare-exclusive epizootic occurred in fingerling channel catfish (Ictalurus punctatus) during normal tank culture practices at SNARC. Fish were transferred to the ultra low-flow system and 2.1 mg/L copper sulfate or 3 mg/L potassium permanganate was administered; an untreated control was ...

Implications for Child Bilingual Acquisition, Optionality and Transfer

ERIC Educational Resources Information Center

Serratrice, Ludovica

2014-01-01

Amaral & Roeper's Multiple Grammars (MG) proposal offers an appealingly simple way of thinking about the linguistic representations of bilingual speakers. This article presents a commentary on the MG language acquisition theory proposed by Luiz Amaral and Tom Roeper in this issue, focusing on the theory's implications for child…

Sr and Mg Isotopes of post-glacial limestones: implications for the chemical evolution of the Neoproterozoic Ocean after snowball earth

NASA Astrophysics Data System (ADS)

Liu, C.; Wang, Z.; Macdonald, F. A.

2013-12-01

The variation of ocean chemistry after the Marinoan (~635Ma) glaciation reflects the integrated effect of changes in continental weathering, carbonate precipitation and hydrothermal process in response to the extreme climatic event. To reconstruct the contemporary seawater chemistry, we analyzed Sr and Mg isotopes of the post-glacial carbonate overlying cap dolostones in the basal Ediacaran Ol Formation of the Tsagaan Olom Group in southwestern Mongolia. We employed an incremental leaching technique by dissolving carbonates sequentially with ammonium acetate and increasing concentrations of acetic acid to separate metals from various mineral phases in the carbonate (including surface adsorbed phases, calcite and dolomite). The leachates from each step and the dissolved bulk samples passed through chromatographic columns to extract pure Mg and Sr, which were then analyzed for their isotopic compositions by MC-ICP-MS (Neptune) at Yale University. Elemental ratios (Mg/Ca and Sr/(Mg+Ca)) in each leaching steps were measured as well. The following observations were noted from these experiments. First, the Mg/Ca ratio of the leachate decreased in the first few steps, reached a plateau in the middle steps and increased in the last few steps, implying a leaching sequence of surface-adsorbed phases, calcite and dolomite. Second, the Sr/(Mg+Ca) ratios remain almost constant except in the first two steps, suggesting similar Sr concentrations in different carbonates but elevated values in surface-adsorbed phases. Third, variations of both δ26MgDSM3 and 87Sr/86Sr values of the leachates with leaching steps exhibit similar trends to Mg/Ca, indicating enrichment of 26Mg and 87Sr in dolomite. Fourth, 87Sr/86Sr values of the leachates exhibit a wider plateau than δ26MgDSM3, denoting a binary mixing of dissolved calcite and dolomite in the last few steps. Finally, higher 87Sr/86Sr ratios and δ26MgDSM3 values were observed for bulk samples than their calcite components. The 87Sr/86Sr values of the plateau steps in each sample vary from 0.7075 to 0.7087, with the lowest values close to the proposed post-glacial seawater values. The δ26MgDSM3 of the plateau steps in samples preserving seawater 87Sr/86Sr values increase from -3.0‰ in the basal part to -2.7‰ in upper sections, which could be explained by the following possibilities: 1) seawater δ26MgDSM3 values increased by ~0.3‰ due to enhanced silicate weathering after deglaciation; 2) the increase was due to a temperature increase of ~20°C; 3) Mg isotopes of the samples in upper sections were less effected by the transformation of aragonite into calcite during diagenesis; or 4) a larger proportion of the carbonates in upper sections were originally precipitated as aragonite.

Co-doping effects on luminescence and scintillation properties of Ce doped (Lu,Gd)3(Ga,Al)5O12 scintillator

NASA Astrophysics Data System (ADS)

Yamaguchi, Hiroaki; Kamada, Kei; Kurosawa, Shunsuke; Pejchal, Jan; Shoji, Yasuhiro; Yokota, Yuui; Ohashi, Yuji; Yoshikawa, Akira

2016-11-01

Mg co-doping effects on scintillation properties of Ce:Lu1Gd2(Ga,Al)5O12 (LGGAG) were investigated. Mg 200 ppm co-doped Ce:LGGAG single crystals were prepared by micro pulling down method. Absorption and luminescence spectra were measured together with several other scintillation characteristics, namely the scintillation decay and light yield to reveal the effect of Mg co-doping. Ce4+ charge transfer absorption was observed below 300 nm in Mg,Ce:LGGAG which is in good agreement with previous reports. The scintillation decay times were accelerated by Mg co-doping.

Trap characterization by photo-transferred thermoluminescence in MgO nanoparticles

NASA Astrophysics Data System (ADS)

Isik, M.; Gasanly, N. M.

2018-05-01

Shallow trapping centers in MgO nanoparticles were characterized using photo-transferred thermoluminescence (TL) measurements. Experiments were carried out in low temperature range of 10-280 K with constant heating rate. Shallow traps were filled with charge carriers firstly by irradiating the sample at room temperature using S90/Y90 source and then illuminating at 10 K using blue LED. TL glow curve exhibited one peak around 150 K. Curve fitting analyses showed that this peak is composed of two individual peaks with maximum temperatures of 149.0 and 155.3 K. The activation energies of corresponding trapping centers were revealed as 0.70 and 0.91 eV. The dominant mechanism for TL process was found as second order kinetics which represent that fast retrapping is effective transitions taking place within the band gap. Structural characterization of MgO nanoparticles were investigated using x-ray diffraction, scanning electron microscopy and Fourier transform infrared spectroscopy measurements. Analyses of experimental observations indicated that MgO nanoparticles show good crystallinity with particle size in nanometer scale.

Buprenorphine and nor-buprenorphine levels in head hair samples from former heroin users under Suboxone® treatment.

PubMed

Belivanis, Stamatis; Tzatzarakis, Manolis N; Vakonaki, Elena; Kovatsi, Leda; Mantsi, Mary; Alegakis, Athanasios; Kavvalakis, Matthaios P; Vynias, Dionisios; Tsatsakis, Aristidis M

2014-06-01

In the current study, buprenorphine (BUP) and its major metabolite, nor-buprenorphine (NBUP), were determined in hair samples from former heroin users following Suboxone® treatment. Hair samples from 36 subjects were analyzed. The drugs of interest were isolated from hair by solid-liquid extraction with methanol and were determined by liquid chromatography-mass spectrometry, using an electrospray ionization interface. The analytical parameters of the method (such as linearity, limits of quantification, recovery, accuracy, and precision) were determined. The inter-quartile range of BUP levels was from 11.4 to 37.4 pg/mg (mean value 56.6 pg/mg) for the proximal hair segment, from 5.8 to 43.3 pg/mg for the middle hair segment (mean value 25.3 pg/mg), while a range from 4.3 to 33.9 pg/mg (mean value 105.2 pg/mg) for the distant to the root hair segment was determined. For NBUP the corresponding inter-quartile range was from 27.0 to 147.6 for the proximal segment (mean value 95.4 pg/mg), from 21.5 to 164.7 pg/mg for the middle segment (mean value 102.0 pg/mg) and from 20.4 to 103.6 pg/mg for the distant segment (mean value 156.8 pg/mg). The mean BUP/NBUP concentration ratio was 0.5. The daily dose of Suboxone® correlated significantly with BUP and NBUP levels in hair (p = 0.001 and p = 0.023) as well as with the BUP/NBUP ratio (p = 0.010). No significant correlation was found between the levels of BUP and NBUP and the duration of Suboxone® administration. The developed and validated method was successfully used for the determination of BUP and NBUP in hair samples collected from former heroin users under Suboxone® treatment. Copyright © 2014 John Wiley & Sons, Ltd.

Screening fungicides for use in fish culture: Evaluation of the agar plug transfer, cellophane transfer, and agar dilution methods

USGS Publications Warehouse

Bailey, Tom A.

1983-01-01

The reliability, reproducibility, and usefulness of three screening methods -- the cellophane transfer, the agar plug transfer, and the agar dilution -- to screen aquatic fungicides were evaluated. Achlya flagellata and Saprolegnia hypogyna were exposed to 1, 10, and 100 mg/L of malachite green to test each method. The cellophane transfer and agar plug transfer techniques had similar reliability and reproducibility in rating fungicidal activity, and were both superior to the agar dilution technique. The agar plug transfer and agar dilution techniques adequately projected in vivo activity of malachite green, but the cellophane transfer technique overestimated its activity. Overall, the agar plug transfer technique most accurately rated the activity of malachite green and was the easiest test to perform. It therefore appears to be the method of choice for testing aquatic fungicides.

Intense infrared emission of Er(3+) in Ca(8)Mg(SiO(4))(4)Cl(2) phosphor from energy transfer of Eu(2+) by broadband down-conversion.

PubMed

Zhou, Jiajia; Teng, Yu; Liu, Xiaofeng; Ye, Song; Xu, Xiaoqiu; Ma, Zhijun; Qiu, Jianrong

2010-10-11

We report on conversion of near-ultraviolet and visible radiation ranging from 250 to 500 nm into near-infrared emission by a Ca(8)Mg(SiO(4))(4)Cl(2): Eu(2+), Er(3+) phosphor. Efficient 1530-1560 nm Er(3+) emission ((4)I(13/2)-->(4)I(15/2)) was detected under the excitation of Eu(2+) (4f?5d) absorption band as a result of energy transfer from Eu(2+) to Er(3+), which is confirmed by both steady state and time-resolved emission spectra. The laser power dependent emission intensity changes were investigated to analysis the energy transfer mechanism. Energy transfer from Eu(2+) to Er(3+) followed by a multi-photon quantum cutting of Er(3+) is proposed. The result indicates that the phosphor has potential application in enhancement of conversion efficient of germanium solar cells because the energy difference of Er(3+): (4)I(13/2)-->(4)I(15/2) transition matches well with the bandgap of Ge (Eg~0.785 eV).

Thin Co/Ni-based bottom pinned spin-transfer torque magnetic random access memory stacks with high annealing tolerance

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tomczak, Y., E-mail: Yoann.Tomczak@imec.be; Department of Chemistry, KU Leuven; Swerts, J.

2016-01-25

Spin-transfer torque magnetic random access memory (STT-MRAM) is considered as a replacement for next generation embedded and stand-alone memory applications. One of the main challenges in the STT-MRAM stack development is the compatibility of the stack with CMOS process flows in which thermal budgets up to 400 °C are applied. In this letter, we report on a perpendicularly magnetized MgO-based tunnel junction (p-MTJ) on a thin Co/Ni perpendicular synthetic antiferromagnetic layer with high annealing tolerance. Tunnel magneto resistance (TMR) loss after annealing occurs when the reference layer loses its perpendicular magnetic anisotropy due to reduction of the CoFeB/MgO interfacial anisotropy. Amore » stable Co/Ni based p-MTJ stack with TMR values of 130% at resistance-area products of 9 Ω μm{sup 2} after 400 °C anneal is achieved via moment control of the Co/Ta/CoFeB reference layer. Thinning of the CoFeB polarizing layer down to 0.8 nm is the key enabler to achieve 400 °C compatibility with limited TMR loss. Thinning the Co below 0.6 nm leads to a loss of the antiferromagnetic interlayer exchange coupling strength through Ru. Insight into the thickness and moment engineering of the reference layer is displayed to obtain the best magnetic properties and high thermal stability for thin Co/Ni SAF-based STT-MRAM stacks.« less

Differential effects of MPEP and diazepam in tests of conditioned emotional response and Pavlovian-to-instrumental transfer suggests 'anxiolytic' effects are mediated by different mechanisms.

PubMed

George, S A; Hutson, P H; Stephens, D N

2009-06-01

The selective mGluR5 antagonist 2-methyl-6-(phenylethynyl)-pyridine (MPEP) is reported to be anxiolytic in several animal models of anxiety, including the conditioned emotional response (CER) paradigm. Suppression of responding during conditioned stimulus (CS) presentation in CER may reflect behavioural competition between lever pressing and adopting a shock-avoidance posture, or it may alternatively reflect altered value of the food reward following its association with a footshock, thus reducing its ability to motivate responding. If this is the case, then drugs that reduce the CER may interfere with the mechanism by which CSs are able to motivate responding, rather than by reducing anxiety. The standard test of the ability of Pavlovian cues to motivate responding is the Pavlovian-to-instrumental transfer (PIT) paradigm and it has recently been suggested that CER may be 'negative PIT'. We compared the effect of MPEP (0, 3, 10 and 30 mg/kg) and diazepam (0, 1, 3 and 10 mg/kg) in CER and PIT. Both MPEP and diazepam significantly reduced conditioned suppression in the CER paradigm. MPEP, but not diazepam, significantly reduced PIT. The findings support the hypothesis that MPEP may reduce expression of anxiety in the CER paradigm by interfering with the way in which emotionally salient cues are able to affect behaviour, but do not support such an analysis of the effect of diazepam. Diazepam and MPEP may therefore achieve their effects in CER by influencing different psychological processes.

Time-dependent 31P saturation transfer in the phosphoglucomutase reaction. Characterization of the spin system for the Cd(II) enzyme and evaluation of rate constants for the transfer process.

PubMed

Post, C B; Ray, W J; Gorenstein, D G

1989-01-24

Time-dependent 31P saturation-transfer studies were conducted with the Cd2+-activated form of muscle phosphoglucomutase to probe the origin of the 100-fold difference between its catalytic efficiency (in terms of kcat) and that of the more efficient Mg2+-activated enzyme. The present paper describes the equilibrium mixture of phosphoglucomutase and its substrate/product pair when the concentration of the Cd2+ enzyme approaches that of the substrate and how the nine-spin 31P NMR system provided by this mixture was treated. It shows that the presence of abortive complexes is not a significant factor in the reduced activity of the Cd2+ enzyme since the complex of the dephosphoenzyme and glucose 1,6-bisphosphate, which accounts for a large majority of the enzyme present at equilibrium, is catalytically competent. It also shows that rate constants for saturation transfer obtained at three different ratios of enzyme to free substrate are mutually compatible. These constants, which were measured at chemical equilibrium, can be used to provide a quantitative kinetic rationale for the reduced steady-state activity elicited by Cd2+ relative to Mg2+ [cf. Ray, W.J., Post, C.B., & Puvathingal, J.M. (1989) Biochemistry (following paper in this issue)]. They also provide minimal estimates of 350 and 150 s-1 for the rate constants describing (PO3-) transfer from the Cd2+ phosphoenzyme to the 6-position of bound glucose 1-phosphate and to the 1-position of bound glucose 6-phosphate, respectively. These minimal estimates are compared with analogous estimates for the Mg2+ and Li+ forms of the enzyme in the accompanying paper.

26 CFR 1.684-2 - Transfers.

Code of Federal Regulations, 2010 CFR

2010-04-01

... decides to transfer additional property with a fair market value of 1000X and an adjusted basis of 600X to... fair market value of 1000X and an adjusted basis of 300X to I, a foreign person. On January 1, 2007, at a time when the fair market value of the property is 1100X, I transfers the property to FT. A is...

20 CFR 416.1246 - Disposal of resources at less than fair market value.

Code of Federal Regulations, 2013 CFR

2013-04-01

... the time of transfer or contract of sale, if earlier. See § 416.1101 for definition of current market... enforceable) agreement in effect at the time of transfer. Compensation also includes all money, real or...—General. The uncompensated value is the fair market value of a resource at the time of transfer minus the...

Post-fusion treatment with MG132 increases transcription factor expression in somatic cell nuclear transfer embryos in pigs.

PubMed

You, Jinyoung; Lee, Joohyeong; Kim, Jinyoung; Park, Junhong; Lee, Eunsong

2010-02-01

The objective of this study was to examine the effect of post-fusion treatment of somatic cell nuclear transfer (SCNT) oocytes with the proteasomal inhibitor MG132 on maturation promoting factor (MPF) activity, nuclear remodeling, embryonic development, and gene expression of cloned pig embryos. Immediately after electrofusion, SCNT oocytes were treated with MG132 and/or caffeine for 2 hr, vanadate for 0.5 hr, or vanadate for 0.5 hr followed by MG132 for 1.5 hr. Of the MG132 concentrations tested (0-5 microM), the 1 microM concentration showed a higher rate of blastocyst formation (25.9%) than 0 (14.2%), 0.5 (16.9%), and 5 microM (16.9%). Post-fusion treatment with MG132, caffeine, and both MG132 and caffeine improved blastocyst formation (22.1%, 21.4%, and 24.4%, respectively), whereas vanadate treatment inhibited blastocyst formation (6.5%) compared to the control (11.1%). When examined 2 hr after fusion and 1 hr after activation, MPF activity remained at a higher (P < 0.05) level in SCNT oocytes that were treated post-fusion with caffeine and/or MG132, but it was decreased by vanadate. The rate of oocytes showing premature chromosome condensation was not altered by MG132 but was decreased by vanadate treatment. In addition, formation of single pronuclei was increased by MG132 compared to control and vanadate treatment. MG132-treated embryos showed increased expression of POU5F1, DPPA2, DPPA3, DPPA5, and NDP52l1 genes compared to control embryos. Our results demonstrate that post-fusion treatment of SCNT oocytes with MG132 prevents MPF degradation and increases expression of transcription factors in SCNT embryos, which are necessary for normal development of SCNT embryos. (c) 2009 Wiley-Liss, Inc.

Social disadvantages associated with myasthenia gravis and its treatment: a multicentre cross-sectional study

PubMed Central

Nagane, Yuriko; Murai, Hiroyuki; Imai, Tomihiro; Yamamoto, Daisuke; Tsuda, Emiko; Minami, Naoya; Suzuki, Yasushi; Kanai, Tetsuya; Uzawa, Akiyuki; Kawaguchi, Naoki; Masuda, Masayuki; Konno, Shingo; Suzuki, Hidekazu; Aoki, Masashi; Utsugisawa, Kimiaki

2017-01-01

Objectives To clarify the social disadvantages associated with myasthenia gravis (MG) and examine associations with its disease and treatment. Design Cross-sectional study. Setting and participants We evaluated 917 consecutive cases of established MG seen at 13 neurological centres in Japan over a short duration. Outcome measures All patients completed a questionnaire on social disadvantages resulting from MG and its treatment and a 15-item MG-specific quality of life scale at study entry. Clinical severity at the worst condition was graded according to the MG Foundation of America classification, and that at the current condition was determined according to the quantitative MG score and MG composite. Maximum dose and duration of dose ≥20 mg/day of oral prednisolone during the disease course were obtained from the patients' medical records. Achievement of the treatment target (minimal manifestation status with prednisolone at ≤5 mg/day) was determined at 1, 2 and 4 years after starting treatment and at study entry. Results We found that 27.2% of the patients had experienced unemployment, 4.1% had been unwillingly transferred and 35.9% had experienced a decrease in income, 47.1% of whom reported that the decrease was ≥50% of their previous total income. In addition, 49.0% of the patients reported feeling reduced social positivity. Factors promoting social disadvantages were severity of illness, dose and duration of prednisolone, long-term treatment, and a depressive state and change in appearance after treatment with oral steroids. Early achievement of the treatment target was a major inhibiting factor. Conclusions Patients with MG often experience unemployment, unwilling job transfers and a decrease in income. In addition, many patients report feeling reduced social positivity. To inhibit the social disadvantages associated with MG and its treatment, greater focus needs to be placed on helping patients with MG resume a normal lifestyle as soon as possible by achieving the treatment target. PMID:28235967

Strategies to overcome oxygen transfer limitations during hairy root cultivation of Azadiracta indica for enhanced azadirachtin production.

PubMed

Srivastava, Smita; Srivastava, Ashok Kumar

2012-07-01

The vast untapped potential of hairy root cultures as a stable source of biologically active chemicals has focused the attention of scientific community toward its commercial exploitation. However, the major bottleneck remains its successful scale-up. Due to branching, the roots form an interlocked matrix that exhibits resistance to oxygen transfer. Thus, present work was undertaken to develop cultivation strategies like optimization of inlet gas composition (in terms of % (v/v) O(2) in air), air-flow rate and addition of oxygen vectors in the medium, to curb the oxygen transfer limitations during hairy root cultivation of Azadirachta indica for in vitro azadirachtin (a biopesticide) production. It was found that increasing the oxygen fraction in the inlet air (in the range, 20-100% (v/v) O(2) in air) increased the azadirachtin productivity by approximately threefold, to a maximum of 4.42 mg/L per day (at 100% (v/v) O(2) in air) with respect to 1.68 mg/L per day in control (air with no oxygen supplementation). Similarly, increasing the air-flow rate (in the range, 0.3-2 vvm) also increased the azadirachtin productivity to a maximum of 1.84 mg/L per day at 0.8 vvm of air-flow rate. On the contrary, addition of oxygen vectors (in the range, 1-4% (v/v); hydrogen peroxide, toluene, Tween 80, kerosene, silicone oil, and n-hexadecane), decreased the azadirachtin productivity with respect to control (1.76 mg/L per day).

Electron-transfer mediator for a NAD-glucose dehydrogenase-based glucose sensor.

PubMed

Kim, Dong-Min; Kim, Min-yeong; Reddy, Sanapalli S; Cho, Jaegeol; Cho, Chul-ho; Jung, Suntae; Shim, Yoon-Bo

2013-12-03

A new electron-transfer mediator, 5-[2,5-di (thiophen-2-yl)-1H-pyrrol-1-yl]-1,10-phenanthroline iron(III) chloride (FePhenTPy) oriented to the nicotinamide adenine dinucleotide-dependent-glucose dehydrogenase (NAD-GDH) system was synthesized through a Paal-Knorr condensation reaction. The structure of the mediator was confirmed by Fourier-transform infrared spectroscopy, proton and carbon nucler magnetic resonance spectroscopy, and mass spectroscopy, and its electron-transfer characteristic for a glucose sensor was investigated using voltammetry and impedance spectroscopy. A disposable amperometric glucose sensor with NAD-GDH was constructed with FePhenTPy as an electron-transfer mediator on a screen printed carbon electrode (SPCE) and its performance was evaluated, where the addition of reduces graphene oxide (RGO) to the mediator showed the enhanced sensor performance. The experimental parameters to affect the analytical performance and the stability of the proposed glucose sensor were optimized, and the sensor exhibited a dynamic range between 30 mg/dL and 600 mg/dL with the detection limit of 12.02 ± 0.6 mg/dL. In the real sample experiments, the interference effects by acetaminophen, ascorbic acid, dopamine, uric acid, caffeine, and other monosaccharides (fructose, lactose, mannose, and xylose) were completely avoided through coating the sensor surface with the Nafion film containing lead(IV) acetate. The reliability of proposed glucose sensor was evaluated by the determination of glucose in artificial blood and human whole blood samples.

Trophic transfer and accumulation of TiO2 nanoparticles from clamworm (Perinereis aibuhitensis) to juvenile turbot (Scophthalmus maximus) along a marine benthic food chain.

PubMed

Wang, Zhenyu; Yin, Liyun; Zhao, Jian; Xing, Baoshan

2016-05-15

In the present work, we investigated the potential benthic trophic transfer of TiO2 nanoparticles (NPs) from clamworm (Perinereis aibuhitensis) to juvenile turbot (Scophthalmus maximus) and their related distribution and toxicity. TiO2 NPs (at 10, 50 and 100 mg/L) could be taken up by clamworms, and mainly accumulated in the lower-digestive tract. TiO2 NPs were able to transfer from clamworms to juvenile turbots. The accumulation of TiO2 NPs in juvenile turbots increased with increasing Ti contents in clamworms during the dietary exposure, however, no biomagnification (BMFs, 0.30-0.33) of TiO2 NPs was observed. For both dietary and waterborne exposure, accumulation of TiO2 NPs was higher in the gill, intestine and stomach of juvenile turbot, following by skin, liver, and muscle. During dietary exposure at Day 20, the growth of turbots was reduced, and abnormal symptoms of liver and spleen were detected. Moreover, both dietary (50 and 100 mg/L TiO2 NPs-treated clamworms) and waterborne (100 mg/L TiO2 NPs) exposures led to significantly lower protein and higher lipid contents, suggesting the nutrition quality reduction of turbots. The findings from this work highlighted the trophic transfer of TiO2 NPs in marine benthic food chain, leading to the potential negative impact on marine aquaculture and food quality. Copyright © 2016 Elsevier Ltd. All rights reserved.

Mn2+ concentration manipulated red emission in BaMg2Si2O7:Eu2+,Mn2+

NASA Astrophysics Data System (ADS)

Ye, Song; Zhang, Jiahua; Zhang, Xia; Lu, Shaozhe; Ren, Xinguang; Wang, Xiaojun

2007-02-01

The luminescent properties of concentration dependence are reported in BaMg2Si2O7:Eu2+,Mn2+ red phosphor. It is observed that the broad red emission of Mn2+ consists of two bands, located at 620 and 675 nm, respectively, which are attributed to two different Mn2+ centers [Mn2+(I) and Mn2+(II)] substituting for two nonidentical Mg2+ sites [Mg2+(I) and Mg2+(II)] in the host. It is also found that the relative emission intensity of the Mn2+(II) to the Mn2+(I) increases with increasing Mn2+ concentration, leading to a red-shift of the overall emission. A detail analysis on the energy transfer from Eu2+ to the two Mn2+ centers is presented, which indicates that the number ratio of Mn2+(II) to Mn2+(I) increases with increasing Mn2+ concentration. This result is interpreted by the preferential formation of Mn2+(I) substituting for Mg2+(I) site. Based on energy transfer, the emission intensity ratios of Mn2+(I) to Eu2+ and Mn2+(II) to Eu2+, which is Mn2+ concentration dependent, are calculated using related fluorescence lifetimes. The calculated results are in good agreement with that obtained experimentally in the emission spectra.

Dissociative adsorption of water on Au/MgO/Ag(001) from first principles calculations

NASA Astrophysics Data System (ADS)

Nevalaita, J.; Häkkinen, H.; Honkala, K.

2015-10-01

The molecular and dissociative adsorption of water on a Ag-supported 1 ML, 2 ML and 3 ML-a six atomic layer-thick MgO films with a single Au adatom is investigated using density functional theory calculations. The obtained results are compared to a bulk MgO(001) surface with an Au atom. On thin films the negatively charged Au strengthens the binding of the polar water molecule due to the attractive Au-H interaction. The adsorption energy trends of OH and H with respect to the film thickness depend on an adsorption site. In the case OH or H binds atop Au on MgO/Ag(001), the adsorption becomes more exothermic with the increasing film thickness, while the reverse trend is seen when the adsorption takes place on bare MgO/Ag(001). This behavior can be explained by different bonding mechanisms identified with the Bader analysis. Interestingly, we find that the rumpling of the MgO film and the MgO-Ag interface distance correlate with the charge transfer over the thin film and the interface charge, respectively. Moreover, we employ a modified Born-Haber-cycle to analyze the effect of film thickness to the adsorption energy of isolated Au and OH species on MgO/Ag(001). The analysis shows that the attractive Coulomb interaction between the negatively charged adsorbate and the positive MgO-Ag-interface does not completely account for the weaker binding with increasing film thickness. The redox energy associated with the charge transfer from the interface to the adsorbate is more exothermic with the increasing film thickness and partly compensates the decrease in the attractive Coulomb interaction.

Magnesium isotope systematics in Martian meteorites

NASA Astrophysics Data System (ADS)

Magna, Tomáš; Hu, Yan; Teng, Fang-Zhen; Mezger, Klaus

2017-09-01

Magnesium isotope compositions are reported for a suite of Martian meteorites that span the range of petrological and geochemical types recognized to date for Mars, including crustal breccia Northwest Africa (NWA) 7034. The δ26Mg values (per mil units relative to DSM-3 reference material) range from -0.32 to -0.11‰; basaltic shergottites and nakhlites lie to the heavier end of the Mg isotope range whereas olivine-phyric, olivine-orthopyroxene-phyric and lherzolitic shergottites, and chassignites have slightly lighter Mg isotope compositions, attesting to modest correlation of Mg isotopes and petrology of the samples. Slightly heavier Mg isotope compositions found for surface-related materials (NWA 7034, black glass fraction of the Tissint shergottite fall; δ26Mg > -0.17‰) indicate measurable Mg isotope difference between the Martian mantle and crust but the true extent of Mg isotope fractionation for Martian surface materials remains unconstrained. The range of δ26Mg values from -0.19 to -0.11‰ in nakhlites is most likely due to accumulation of clinopyroxene during petrogenesis rather than garnet fractionation in the source or assimilation of surface material modified at low temperatures. The rather restricted range in Mg isotope compositions between spatially and temporally distinct mantle-derived samples supports the idea of inefficient/absent major tectonic cycles on Mars, which would include plate tectonics and large-scale recycling of isotopically fractionated surface materials back into the Martian mantle. The cumulative δ26Mg value of Martian samples, which are not influenced by late-stage alteration processes and/or crust-mantle interactions, is - 0.271 ± 0.040 ‰ (2SD) and is considered to reflect δ26Mg value of the Bulk Silicate Mars. This value is robust taking into account the range of lithologies involved in this estimate. It also attests to the lack of the Mg isotope variability reported for the inner Solar System bodies at current analytical precision, also noted for several other major elements.

Stellar reaction rate for {sup 22}Mg+p->{sup 23}Al from the asymptotic normalization coefficient in the mirror nuclear system {sup 22}Ne+n->{sup 23}Ne

DOE Office of Scientific and Technical Information (OSTI.GOV)

Al-Abdullah, T.; Physics Department, Hashemite University, Zarqa 13115; Carstoiu, F.

2010-03-15

The production of {sup 22}Na in ONe novae can be influenced by the {sup 22}Mg(p,gamma){sup 23}Al reaction. To investigate this reaction rate at stellar energies, we have determined the asymptotic normalization coefficient (ANC) for {sup 22}Mg+p->{sup 23}Al through measurements of the ANCs in the mirror nuclear system {sup 22}Ne+n->{sup 23}Ne. The peripheral neutron-transfer reactions {sup 13}C({sup 12}C,{sup 13}C){sup 12}C and {sup 13}C({sup 22}Ne,{sup 23}Ne){sup 12}C were studied. The identical entrance and exit channels of the first reaction make it possible to extract independently the ground-state ANC in {sup 13}C. Our experiment gives C{sub p{sub 1/2}}{sup 2}({sup 13}C)=2.24+-0.11 fm{sup -1}, whichmore » agrees with the value obtained from several previous measurements. The weighted average for all the obtained C{sub p{sub 1/2}}{sup 2} is 2.31+-0.08 fm{sup -1}. This value is adopted to be used in obtaining the ANCs in {sup 23}Ne. The differential cross sections for the reaction {sup 13}C({sup 22}Ne,{sup 23}Ne){sup 12}C leading to the J{sup {pi}}=5/2{sup +} and 1/2{sup +} states in {sup 23}Ne have been measured at 12 MeV/u. Optical model parameters for use in the DWBA calculations were obtained from measurements of the elastic scatterings {sup 22}Ne+{sup 13}C and {sup 22}Ne+{sup 12}C. The extracted ANC for the ground state in {sup 23}Ne, C{sub d{sub 5/2}}{sup 2}=0.86+-0.08+-0.12 fm{sup -1}, is converted to its corresponding value in {sup 23}Al using mirror symmetry to give C{sub d{sub 5/2}}{sup 2}({sup 23}Al)=(4.63+-0.77)x10{sup 3} fm{sup -1}. The astrophysical S factor S(0) for the {sup 22}Mg(p,gamma) reaction was determined to be 0.96+-0.11 keV b. The consequences for nuclear astrophysics are discussed.« less

[Monograph for 3-(4-methylbenzylidene)camphor (4-MBC)--HBM values for the sum of metabolites 3-(4-carboxybenzylidene)camphor (3-4CBC) and 3-(4-carboxybenzylidene)-6-hydroxycamphor (3-4 CBHC) in the urine of adults and children. Statement of the HBM Commission of the German Federal Environment Agency].

PubMed

2016-01-01

The substance 3-(4-methylbenzylidene)camphor (4-MBC, CAS-No. 36861-47-9 as well as 38102-62-4) is used as UV-filter in cosmetics, mainly in sunscreen lotions. National as well as European evaluations are available for the substance, especially from the Scientific Committee on Consumer Products (SCCP). The SCCP did not derive a TDI-value, but used for a MoS assessment a NOAEL of 25 mg/(kg bw · d) based on effects on the thyroid gland of rats in a subchronic study with oral administration. Newer studies, however, indicate lower NOAEL values, leading to tolerable daily intakes of 0,01 mg/kg bw. The HBM Commission established for the metabolite 3-(4-carboxybenzylidene)camphor (3-4CBC) HBM-I values of 0,09 mg/l urine for adults and 0,06 mg/l urine for children. HBM-I values for the metabolite 3-(4-carboxybenzylidene)-6-hydroxycamphor (3-4CBHC) were set at 0,38 mg/l urine for adults and 0,25 mg/l urine for children. The rounded HBM-I value for the sum of metabolites 3-4CBC und 3-4CBHC is accordingly 0,5 mg/l urine for adults and 0,3 mg/l urine for children.

Luminescence properties and energy transfer of site-sensitive Ca(6-x-y)Mg(x-z)(PO(4))(4):Eu(y)(2+),Mn(z)(2+) phosphors and their application to near-UV LED-based white LEDs.

PubMed

Kwon, Ki Hyuk; Im, Won Bin; Jang, Ho Seong; Yoo, Hyoung Sun; Jeon, Duk Young

2009-12-21

On the basis of the structural information that the host material has excellent charge stabilization, blue-emitting Ca(6-x-y)Mg(x)(PO(4))(4):Eu(y)(2+) (CMP:Eu(2+)) phosphors were synthesized and systematically optimized, and their photoluminescence (PL) properties were evaluated. Depending upon the amount of Mg added, the emission efficiency of the phosphors could be enhanced. The substitution of Eu(2+) affected their maximum wavelength (lambda(max)) and thermal stability because the substitution site of Eu(2+) could be varied. To obtain single-phase two-color-emitting phosphors, we incorporated Mn(2+) into CMP:Eu(2+) phosphors. Weak red emission resulting from the forbidden transition of Mn(2+) could be enhanced by the energy transfer from Eu(2+) to Mn(2+) that occurs because of the spectral overlap between the photoluminescence excitation (PLE) spectrum of Mn(2+) and the PL spectrum of Eu(2+). The energy transfer process was confirmed by the luminescence spectra, energy transfer efficiency, and decay curve of the phosphors. Finally, the optimized Ca(6-x-y)Mg(x-z)(PO(4))(4):Eu(y)(2+),Mn(z)(2+) (CMP:Eu(2+),Mn(2+)) phosphors were applied with green emitting Ca(2)MgSi(2)O(7):Eu(2+) (CMS:Eu(2+)) phosphors to ultraviolet (UV) light emitting diode (LED)-pumped white LEDs. The CMS:Eu(2+)-mixed CMP:Eu(2+), Mn(2+)-based white LEDs showed an excellent color rendering index (CRI) of 98 because of the broader emission band and more stable color coordinates than those of commercial Y(3)Al(5)O(12):Ce(3+) (YAG:Ce(3+))-based white LEDs under a forward bias current of 20 mA. The fabricated white LEDs showed very bright natural white light that had the color coordinate of (0.3288, 0.3401), and thus CMP:Eu(2+),Mn(2+) could be regarded as a good candidate for UV LED-based white LEDs.

Investigation of the effects of 'piperazine-containing party pills' and dexamphetamine on interhemispheric communication using electroencephalography.

PubMed

Lee, HeeSeung; Wang, Grace Y; Curley, Louise E; Kydd, Rob R; Kirk, Ian J; Russell, Bruce R

2016-08-01

'Piperazine-containing party pills' were marketed and sold as legal alternatives to methamphetamine and 3,4-methylenedioxymethamphetamine (MDMA) until 2008 in New Zealand. The major constituents of these 'pills' were benzylphenylpiperazine (BZP) and trifluoromethylphenylpiperazine (TFMPP). Despite their popularity, there is a paucity of knowledge about their central effects in humans. This study investigated their effects on human neural processing using electroencephalographic techniques. A randomised, double-blind, placebo-controlled study investigated the effects of an acute dose of these compounds on the interhemispheric transfer of information (IHTT) using the Poffenberger task. Reaction time data were also collected. Healthy, right-handed males were given an oral dose of either BZP (n = 13) (200 mg), TFMPP (n = 15) (60 mg), a combination of BZP + TFMPP (n = 15) (100 mg/30 mg), dexamphetamine (n = 16) (20 mg), or placebo (n = 23) and tested both before and 120 min after drug administration. A mixed factorial repeated measures analysis of variance of absolute N160 latency and contrast analysis revealed that only TFMPP (F (1,77) = 17.30, p ≤ 0.001) significantly reduced the absolute N160 latency. Analysis of the IHTT revealed that only TFMPP (F (1,77) = 5.266, p ≤ 0.02) significantly reduced the IHTT, while BZP, BZP + TFMPP and dexamphetamine had no effect. Contrast analysis revealed that both TFMPP (F (1,77) = 17.30, p ≤ 0.001) and placebo (F (1,77) = 15.08, p ≤ 0.001) preserved the laterality of information transfer from one hemisphere to the other. Reaction time (p > 0.05) was not significantly affected by any of the drug treatments. The usual directional asymmetry (i.e. faster R-to-L transfer relative to L-to-R) observed in healthy control group was absent following the administration of either BZP, BZP + TFMPP or dexamphetamine. Surprisingly, lateralised hemispheric function was not affected by TFMPP. Our findings highlight how the administration of BZP, TFMPP and BZP + TFMPP leads to changes in the pattern of information transfer.

The Threshold of Toxicological Concern for prenatal developmental toxicity in rats and rabbits

PubMed Central

van Ravenzwaay, B.; Jiang, X.; Luechtefeld, T.; Hartung, T.

2018-01-01

The Threshold Toxicological Concern (TTC) is based on the concept that in absence of experimental data reasonable assurance of safety can be given if exposure is sufficiently low. Using the REACH database the low 5th percentile of the NO(A)EL distribution, for prenatal developmental toxicity (OECD guideline 414) was determined. For rats, (434 NO(A)ELs values) for maternal toxicity, this value was 10 mg/kg-bw/day. For developmental toxicity (469 NO(A)ELs): 13 mg/kg-bw/day. For rabbits, (100 NO(A)ELs), the value for maternal toxicity was 4 mg/kg-bw/day, for developmental toxicity, (112 NO(A)EL values): 10 mg/kg-bw/day. The maternal organism may thus be slightly more sensitive than the fetus. Combining REACH- (industrial chemicals) and published BASF-data (mostly agrochemicals), 537 unique compounds with NO(A)EL values for developmental toxicity in rats and 150 in rabbits were evaluated. The low 5th percentile NO(A)EL for developmental toxicity in rats was 10 mg/kg-bw/day and 9.5 mg/kg-bw/day for rabbits. Using an assessment factor of 100, a TTC value for developmental toxicity of 100 µg/kg-bw/day for rats and 95 µg/kg-bw/day for rabbits is calculated. These values could serve as guidance whether or not to perform an animal experiment, if exposure is sufficiently low. In emergency situations this value may be useful for a first tier risk assessment. PMID:28645885

Variability in magnesium, carbon and oxygen isotope compositions, and trace element contents of brachiopod shells: implications for paleoceanographic studies

NASA Astrophysics Data System (ADS)

Rollion-Bard, Claire; Saulnier, Ségolène; Vigier, Nathalie; Schumacher, Aimryc; Chaussidon, Marc; Lécuyer, Christophe

2016-04-01

Magnesium content in the ocean is ≈ 1290 ppm and is one of the most abundant elements. It is involved in the carbon cycle via the dissolution and precipitation of carbonates, especially Mg-rich carbonates as dolomites. The Mg/Ca ratio of the ocean is believed to have changed through time. The causes of these variations, i.e. hydrothermal activity change or enhanced precipitation of dolomite, could be constrained using the magnesium isotope composition (δ26Mg) of carbonates. Brachiopods, as marine environmental proxies, have the advantage to occur worldwide in a depth range from intertidal to abyssal, and have been found in the geological record since the Cambrian. Moreover, as their shell is in low-Mg calcite, they are quite resistant to diagenetic processes. Here we report δ26Mg, δ18O, δ13C values along with trace element contents of one modern brachiopod specimen (Terebratalia transversa) and one fossil specimen (Terebratula scillae, 2.3 Ma). We combined δ26Mg values with oxygen and carbon isotope compositions and trace element contents to look for possible shell geochemical heterogeneities in order to investigate the processes that control the Mg isotope composition of brachiopod shells. We also evaluate the potential of brachiopods as a proxy of past seawater δ26Mg values. The two investigated brachiopod shells present the same range of δ26Mg variation (up to 2 ‰)). This variation cannot be ascribed to changes in environmental parameters, i.e. temperature or pH. As previously observed, the primary layer of calcite shows the largest degree of oxygen and carbon isotope disequilibrium relative to seawater. In contrast, the δ26Mg value of this layer is comparable to that of the secondary calcite layer value. In both T. scillae and T. transversa, negative trends are observable between magnesium isotopic compositions and oxygen and carbon isotopic compositions. These trends, combined to linear relationships between δ26Mg values and REE contents, are best explained by kinetic effects linked to changes in growth rate during the brachiopod life. The innermost calcite layer of T. transversa is in isotopic equilibrium for both oxygen and magnesium and could therefore be the best target for reconstructing past δ26Mg values of seawater.

From Community Gyms to Classrooms: A Framework for Values-Transfer in Schools

ERIC Educational Resources Information Center

Martinek, Tom; Lee, Okseon

2012-01-01

Although it is assumed that the values learned in physical activity-based youth programs can be applied in other areas of life, the transfer of values has not been widely explored. The purpose of this article is to address the transfer issue as it relates to physical activity programs and school cultures. The article begins with an overview of the…

Resonant transfer excitation in collisions of F6+ and Mg9+ with H2

NASA Astrophysics Data System (ADS)

Bernstein, E. M.; Kamal, A.; Zaharakis, K. E.; Clark, M. W.; Tanis, J. A.; Ferguson, S. M.; Badnell, N. R.

1991-10-01

Experimental and theoretical investigations of resonant transfer excitation (RTE) for F6++H2 and Mg9++H2 collisions have been made. For both collision systems good agreement is obtained between the measured cross sections for K-shell x-ray emission coincident with electron-capture and theoretical RTE calculations. For F6+ the present calculations are about 10% lower than previous results of Bhalla and Karim [Phys. Rev. A 39, 6060 (1989); 41, 4097(E) (1990]; the measured cross sections are a factor of 2.3 larger than earlier measurements of Schulz et al. [Phys. Rev. A 38, 5454 (1988)]. The previous disagreement between experiment and theory for F6+ is removed.

Influence of MgO barrier quality on spin-transfer torque in magnetic tunnel junctions

NASA Astrophysics Data System (ADS)

Tiwari, Dhananjay; Sharma, Raghav; Heinonen, O. G.; Åkerman, Johan; Muduli, P. K.

2018-01-01

We studied the bias dependence of spin transfer torque in the MgO-based magnetic tunnel junction using a field-modulated spin torque ferromagnetic resonance measurement technique for three devices with tunneling magnetoresistances (MRs) of 60%, 67%, and 73%, respectively. The devices with a lower MR ratio showed the presence of multiple modes, while the device with higher MR (73%) showed a single resonance mode. We found a lower out-of-plane torkance in our devices compared to the in-plane torkance. The out-of-plane torque is linear with applied bias, while the bias dependence of in-plane torque shows a strong dependence on the MR ratio and hence the barrier quality.

Urine creatinine in treatment-naïve HIV subjects in eastern Nigeria

PubMed Central

Anyabolu, Ernest Ndukaife

2016-01-01

Introduction Human immunodeficiency virus (HIV) infection is a global healthcare problem. Some diseases and physiological states may be altered in HIV-infected individuals. Our objective was to evaluate urine creatinine and factors that influence urine creatinine in treatment-naïve HIV subjects in Nigeria. Methods This was a cross-sectional study involving treatment-naïve HIV subjects in a tertiary hospital in Nigeria. Creatinine in spot and 24-hour urine samples and other relevant investigations were performed. Low urine creatinine or dilute urine was defined as 24-hour urine creatinine (24HUCr) <300mg, normal urine creatinine as 24HUCr 300-3000mg and high urine creatinine or concentrated urine as 24HUCr>3000mg.Theassociation of low urine creatinine and high urine creatinine with potential risk factors was determined. Results The mean spot urine creatinine (SUCr) of the treatment-naïve HIV subjects was 137.21± 98.47(mg/dl), minimum value 13.3mg/dl, maximum value 533.3mg/dl and range of values 520.0mg/dl. The mean 24HUCr was 1507±781mg, minimum value 206mg, maximum value 4849mg and range of values 4643mg. Twenty four-hour urine creatinine<300mg was observed in 2(0.5%) subjects, normal 24HUCr 300-3000mgin 349(93.1%) subjects and 24HUCr>3000mg in 24(6.4%) subjects. There was significant association between 24HUCr and serum low density lipoprotein cholesterol (LDL),serum high density lipoprotein cholesterol (HDL). There was high correlation between 24HUCr>3000mg and 24-hour urine osmolality (24HUOsm) (r=0.95), body mass index (BMI) (r=0.74), CD4 cells count (r=-0.71), serum HDL (r=-0.73). Conclusion The prevalence of dilute urine and concentrated urine was low. Twenty-four hour urine osmolality. BMI, CD4 cells count and HDL were strong correlates of high urine creatinine. Lipid abnormalities were common in treatment-naïve HIV subjects with high urine creatinine. There is need for clinicians to routinely conduct urine creatinine and further search for abnormalities of serum lipids, weight changes, depressed immunity and anemia in HIV subjects with dilute or concentrated urine in the early stages of the infection. PMID:28292101

Urine creatinine in treatment-naïve HIV subjects in eastern Nigeria.

PubMed

Anyabolu, Ernest Ndukaife

2016-01-01

Human immunodeficiency virus (HIV) infection is a global healthcare problem. Some diseases and physiological states may be altered in HIV-infected individuals. Our objective was to evaluate urine creatinine and factors that influence urine creatinine in treatment-naïve HIV subjects in Nigeria. This was a cross-sectional study involving treatment-naïve HIV subjects in a tertiary hospital in Nigeria. Creatinine in spot and 24-hour urine samples and other relevant investigations were performed. Low urine creatinine or dilute urine was defined as 24-hour urine creatinine (24HUCr) <300mg, normal urine creatinine as 24HUCr 300-3000mg and high urine creatinine or concentrated urine as 24HUCr>3000mg.Theassociation of low urine creatinine and high urine creatinine with potential risk factors was determined. The mean spot urine creatinine (SUCr) of the treatment-naïve HIV subjects was 137.21± 98.47(mg/dl), minimum value 13.3mg/dl, maximum value 533.3mg/dl and range of values 520.0mg/dl. The mean 24HUCr was 1507±781mg, minimum value 206mg, maximum value 4849mg and range of values 4643mg. Twenty four-hour urine creatinine<300mg was observed in 2(0.5%) subjects, normal 24HUCr 300-3000mgin 349(93.1%) subjects and 24HUCr>3000mg in 24(6.4%) subjects. There was significant association between 24HUCr and serum low density lipoprotein cholesterol (LDL),serum high density lipoprotein cholesterol (HDL). There was high correlation between 24HUCr>3000mg and 24-hour urine osmolality (24HUOsm) (r=0.95), body mass index (BMI) (r=0.74), CD4 cells count (r=-0.71), serum HDL (r=-0.73). The prevalence of dilute urine and concentrated urine was low. Twenty-four hour urine osmolality. BMI, CD4 cells count and HDL were strong correlates of high urine creatinine. Lipid abnormalities were common in treatment-naïve HIV subjects with high urine creatinine. There is need for clinicians to routinely conduct urine creatinine and further search for abnormalities of serum lipids, weight changes, depressed immunity and anemia in HIV subjects with dilute or concentrated urine in the early stages of the infection.

Water quality characterization and mathematical modeling of dissolved oxygen in the East and West Ponds, Jamaica Bay Wildlife Refuge.

PubMed

Maillacheruvu, Krishnanand; Roy, D; Tanacredi, J

2003-09-01

The current study was undertaken to characterize the East and West Ponds and develop a mathematical model of the effects of nutrient and BOD loading on dissolved oxygen (DO) concentrations in these ponds. The model predicted that both ponds will recover adequately given the average expected range of nutrient and BOD loading due to waste from surface runoff and migratory birds. The predicted dissolved oxygen levels in both ponds were greater than 5.0 mg/L, and were supported by DO levels in the field which were typically above 5.0 mg/L during the period of this study. The model predicted a steady-state NBOD concentration of 12.0-14.0 mg/L in the East Pond, compared to an average measured value of 3.73 mg/L in 1994 and an average measured value of 12.51 mg/L in a 1996-97 study. The model predicted that the NBOD concentration in the West Pond would be under 3.0 mg/L compared to the average measured values of 7.50 mg/L in 1997, and 8.51 mg/L in 1994. The model predicted that phosphorus (as PO4(3-)) concentration in the East Pond will approach 4.2 mg/L in 4 months, compared to measured average value of 2.01 mg/L in a 1994 study. The model predicted that phosphorus concentration in the West Pond will approach 1.00 mg/L, compared to a measured average phosphorus (as PO4(3-)) concentration of 1.57 mg/L in a 1994 study.

Electron Raman scattering in a strained ZnO/MgZnO double quantum well

NASA Astrophysics Data System (ADS)

Mojab-abpardeh, M.; Karimi, M. J.

2018-02-01

In this work, the electron Raman scattering in a strained ZnO / MgZnO double quantum wells is studied. The energy eigenvalues and the wave functions are obtained using the transfer matrix method. The effects of Mg composition, well width and barrier width on the internal electric field in well and barrier layers are investigated. Then, the influences of these parameters on the differential cross-section of electron Raman scattering are studied. Results indicate that the position, magnitude and the number of the peaks depend on the Mg composition, well width and barrier width.

Self-assembled via axial coordination magnesium porphyrin-imidazole appended fullerene dyad: spectroscopic, electrochemical, computational, and photochemical studies.

PubMed

D'Souza, Francis; El-Khouly, Mohamed E; Gadde, Suresh; McCarty, Amy L; Karr, Paul A; Zandler, Melvin E; Araki, Yasuyaki; Ito, Osamu

2005-05-26

Spectroscopic, redox, and electron transfer reactions of a self-assembled donor-acceptor dyad formed by axial coordination of magnesium meso-tetraphenylporphyrin (MgTPP) and fulleropyrrolidine appended with an imidazole coordinating ligand (C(60)Im) were investigated. Spectroscopic studies revealed the formation of a 1:1 C(60)Im:MgTPP supramolecular complex, and the anticipated 1:2 complex could not be observed because of the needed large amounts of the axial coordinating ligand. The formation constant, K(1), for the 1:1 complex was found to be (1.5 +/- 0.3) x 10(4) M(-1), suggesting fairly stable complex formation. The geometric and electronic structures of the dyads were probed by ab initio B3LYP/3-21G() methods. The majority of the highest occupied frontier molecular orbital (HOMO) was found to be located on the MgTPP entity, while the lowest unoccupied molecular orbital (LUMO) was on the fullerene entity, suggesting that the charge-separated state of the supramolecular complex is C(60)Im(*-):MgTPP(*+). Redox titrations involving MgTPP and C(60)Im allowed accurate determination of the oxidation and reduction potentials of the donor and acceptor entities in the supramolecular complex. These studies revealed more difficult oxidation, by about 100 mV, for MgTPP in the pentacoordinated C(60)Im:MgTPP compared to pristine MgTPP in o-dichlorobenzene. A total of six one-electron redox processes corresponding to the oxidation and reduction of the zinc porphyrin ring and the reduction of fullerene entities was observed within the accessible potential window of the solvent. The excited state events were monitored by both steady state and time-resolved emission as well as transient absorption techniques. In o-dichlorobenzene, upon coordination of C(60)Im to MgTPP, the main quenching pathway involved electron transfer from the singlet excited MgTPP to the C(60)Im moiety. The rate of forward electron transfer, k(CS), calculated from the picosecond time-resolved emission studies was found to be 1.1 x 10(10) s(-1) with a quantum yield, Phi(CS), of 0.99, indicating fast and efficient charge separation. The rate of charge recombination, k(CR), evaluated from nanosecond transient absorption studies, was found to be 8.3 x 10(7) s(-1). A comparison between k(CS) and k(CR) suggested an excellent opportunity to utilize the charge-separated state for further electron-mediating processes.

Transferring cucumber mosaic virus-white leaf strain coat protein gene into Cucumis melo L. and evaluating transgenic plants for protection against infections

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gonsalves, C.; Xue, B.; Yepes, M.

1994-03-01

A single regeneration procedure using cotyledon examples effectively regenerated five commercially grown muskmelon cultivars. This regeneration scheme was used to facilitate gene transfers using either Agrobacterium tumefaciens or microprojectile bombardment methods. In both cases, the transferred genes were from the T-DNA region of the binary vector plasmid pGA482GG/cp cucumber mosaic virus-white leaf strain (CMV-WL), which contains genes that encode neomycin phosphotransferase II (NPT II), [beta]-glucuronidase (GUS), and the CMV-WL coat protein (CP). Explants treated with pGA482GG/cpCMV-WL regenerated shoots on Murashige and Skoog medium containing 4.4 [mu]m 6-benzylaminopurine (BA), kanamycin (Km) at 150 mg[center dot]liter[sup [minus]1] and carbenicillin (Cb) at 500more » mg[center dot]liter[sup [minus]1]. The authors' comparison of A. tumefaciens- and microprojectile-mediated gene transfer procedures shows that both methods effectively produce nearly the same percentage of transgenic plants. R[sub 0] plants were first tested for GUS or NPT II expression, then the polymerase chain reaction (PCR) and other tests were used to verify the transfer of the NPT II, GUS, and CMV-WL CP genes.« less

BACKWARD ANGLE STRUCTURE IN THE 20Ne+28Si QUASIELASTIC SCATTERING

NASA Astrophysics Data System (ADS)

Sgouros, O.; Soukeras, V.; Pakou, A.; Patronis, N.; Zerva, K.; Keeley, N.; Strojek, I.; Trzcińska, A.; Piasecki, E.; Rusek, K.; Stiliaris, E.; Mazzocco, M.

2013-10-01

New data for the quasielastic scattering of 20Ne from a 28Si target at incident energies of 42.5 MeV and 52.3 MeV and for the 28Si(20Ne, 24Mg)24Mg, 28Si(20Ne, 16O)32S and 28Si(20Ne, 12C)36Ar transfer reactions at 52.3 MeV are reported. Oscillations are observed in the backward angle quasielastic scattering data at 52.3 MeV and the 28Si(20Ne, 12C)36Ar transfer cross-sections are of the same magnitude as those for single-α stripping. Coupled reaction channels (CRC) calculations are unable to describe either the quasielastic or the 28Si(20Ne, 12C)36Ar transfer data assuming a sequential α transfer process with α-particle form factors from the literature. The addition of direct 8Be cluster transfer can provide a reasonable description of both data sets, but only with much larger spectroscopic factors than suggested by simple structure calculations or the large 8Be emission thresholds of 20Ne, 28Si and 36Ar, suggesting that the observed structure is of resonance-like origin. An optical model analysis of the quasielastic scattering data is also reported.

Effects of intermittent chlorination on rainbow trout and yellow perch

DOE Office of Scientific and Technical Information (OSTI.GOV)

Brooks, A.S.; Seegert, G.L.

1977-05-01

Rainbow trout, Salmo gairdneri, and yellow perch, Perca flavescens, were exposed to residual chlorine for single 30-minute and triple 5-minute doses. Tests were conducted at 10, 15, and 20 C with both species plus 25 and 30 C for the perch. Single exposure 30-minute LC50 values for the perch ranged from 0.70 mg/liter at 30 C to 8.0 mg/liter at 10 C. Triple 5-minute exposure LC50 values for the perch were 22.6 and 9.0 mg/liter at 10 and 20 C, respectively. Rainbow trout 30-minute LC50 values were 0.99 and 0.94 mg/liter at 10 and 15 C, respectively. Two groups ofmore » trout tested at 20 C yielded 30-minute LC50 values of 0.60 and 0.43 mg/liter. Triple exposure 5-minute LC50 values for the trout were 2.87 mg/liter at 10 C and 1.65 mg/liter at 20 C. Mortality occurred immediately after exposure to chlorine in the 30-minute perch tests at 10 and 15 C, but was delayed 2 to 12 hours at the higher temperatures. This pattern was reversed in the 5-minute triple exposure tests. Rainbow trout exhibited rapid mortality in all tests except the 10 C triple exposure series where mortality was delayed 12 to 24 hours. For both species, concentrations resulting in no mortality were approximately one-half the LC50 value.« less

Stability phase diagram of a perpendicular magnetic tunnel junction in noncollinear geometry

NASA Astrophysics Data System (ADS)

Strelkov, N.; Timopheev, A.; Sousa, R. C.; Chshiev, M.; Buda-Prejbeanu, L. D.; Dieny, B.

2017-05-01

Experimental measurements performed on MgO-based perpendicular magnetic tunnel junctions show a strong dependence of the stability voltage-field diagrams as a function of the direction of the magnetic field with respect to the plane of the sample. When the magnetic field is applied in-plane, systematic nonlinear phase boundaries are observed for various lateral sizes. The simulation results based on the phenomenological Landau-Lifshitz-Gilbert equation including the in-plane and out-of-plane spin transfer torques are consistent with the measurements if a second-order anisotropy contribution is considered. Furthermore, performing the stability analysis in linear approximation allowed us to analytically extract the critical switching voltage at zero temperature in the presence of an in-plane field. This study indicates that in the noncollinear geometry investigations are suitable to detect the presence of the second-order term in the anisotropy. Such higher order anisotropy term can yield an easy-cone anisotropy which reduces the thermal stability factor but allows for more reproducible spin transfer torque switching due to a reduced stochasticity of the switching. As a result, the energy per write event decreases much faster than the thermal stability factor as the second-order anisotropy becomes more negative. Easy-cone anisotropy can be useful for fast-switching spin transfer torque magnetic random access memories provided the thermal stability can be maintained above the required value for a given memory specification.

[Determination by thermometric titrimetry of the thermodynamic parameters of water/n-octanol transfer of several non-steroidal anti-inflammatory drugs].

PubMed

Burgot, G; Burgot, J L

1995-01-01

The calorimetric determination by thermometric titrimetry of the water/n-octanol transfer enthalpies of some non steroidic anti-inflammatory compounds is described. By combining the values obtained with that of the free enthalpies of transfer issuing from the values of corresponding log P, it is possible to determinate the transfer entropies of the solutes. The whole results of the show that almost the transfers are both enthalpy and entropy driven. They demonstrate the occurrence of three different mechanisms of transfer.

BIOAVAILABILITY AND TROPHIC TRANSFER OF HUMIC-BOUND COPPER FROM BACTERIA TO ZOOPLANKTON

EPA Science Inventory

The effect of humic acid (HA) on uptake and transfer of Cu by selected marine organisms from the microbial loop was determined. Bacteria grown to stationary phase in cultures with and without 15 ug Cu l -1 and with and without 10 mg Suwannee River Humic Acid (SRHA) l -1 were fed ...

Breakeven costs for embryo transfer in a commercial dairy herd.

PubMed

Ferris, T A; Troyer, B W

1987-11-01

Differences in Estimated Breeding Values expressed in dollars were compared by simulation of two, 100-cow, closed herds. One herd practiced normal intensity of female selection. The other herd generated various herd replacements by embryo transfer by varying 1) selection rate of embryo transfer dams and 2) numbers of daughters per dam from which embryos were transferred, while varying the merit of mates of embryo transfer dams. Estimated Breeding Value dollars were compounded each generation and regressed to remove age adjustments and added feed and health costs. Beginning values in both herds included a standard deviation of 55 Cow Index dollars, herd average of -23 Cow Index dollars, and a 120 Predicted Difference dollars for mates of dams not embryo transferred. Average merit of all sires used increased $12 per year. Herd calving rate (.70), proportion females (.5), calf loss (.15), and heifer survival rate (.83) were used. Breakeven cost per embryo transfer cow entering the milking herd was computed by Net Present Value analysis using a 10% discount rate over 10 and 20 yr. Breakeven cost or the maximum expense that would allow a 10% return on the expenditure ranged from $135 to $510 per surviving cow, $24 to $125 per transfer, $47 to $178 per pregnancy, and $81 to $357 per female calf born. As the number of replacements resulting from embryo transfer increased, breakeven cost per embryo transfer cow decreased due to diminishing return.

Process development of oxalic acid production in submerged culture of Aspergillus niger F22 and its biocontrol efficacy against the root-knot nematode Meloidogyne incognita.

PubMed

Lee, Sang Il; Lee, Keon Jin; Chun, Ho Hyun; Ha, Sanghyun; Gwak, Hyun Jung; Kim, Ho Myeong; Lee, Jong-Hee; Choi, Hak-Jong; Kim, Hyeong Hwan; Shin, Teak Soo; Park, Hae Woong; Kim, Jin-Cheol

2018-03-01

Oxalic acid has potent nematicidal activity against the root-knot nematode Meloidogyne incognita. In this study, fermentation parameters for oxalic acid production in submerged culture of Aspergillus niger F22 at 23, 25, and 30 °C were optimized in 5-L jar fermenters. The viscosity of the culture broth increased with increasing temperature. There was a negative correlation between oxalic acid production and the apparent viscosity; high volumetric productivity of oxalic acid was obtained at low apparent viscosity (less than 1000 cP), with a productivity of more than 100 mg/L h. When the apparent viscosity was over 2500 cP, the volumetric productivity decreased below 50 mg/L h. In addition, the volumetric mass transfer coefficient, K L a, positively correlated with volumetric productivity. When the K L a value increased from 0.0 to 0.017 /s, the volumetric productivity proportionally increased up to 176 mg/L h. When the temperature decreased, K L a increased due to the decrease in viscosity, leading to increased volumetric productivity. The highest productivity of 7453.3 mg/L was obtained at the lowest temperature, i.e., 23 °C. The nematicidal activity of culture filtrate was proportional to the content of oxalic acid. Based on a constant impeller tip speed, oxalic acid production was successfully scaled up to a 500-L pilot vessel, producing a final concentration comparable to that in the 5-L jar.

Numerical investigations on the characteristics of thermomagnetic instability in MgB2 bulks

NASA Astrophysics Data System (ADS)

Xia, Jing; Li, Maosheng; Zhou, Youhe

2017-07-01

This paper presents the characteristics of thermomagnetic instability in MgB2 bulks by numerically solving the macroscopic dynamics of thermomagnetic interaction governed by the coupled magnetic and heat diffusion equations in association with a modified E-J power-law relationship. The finite element method is used to discretize the system of partial differential equations. The calculated magnetization loops with flux jumps are consistent with the experimental results for MgB2 slabs bathed in a wide range of ambient temperatures. We reveal the evolution process of the thermomagnetic instability and present the distributions of the magnetic field, temperature, and current density before and after flux jumps. A 2D axisymmetric model is used to study the thermomagnetic instability in cylindrical MgB2 bulks. It is found that the number of flux jumps monotonously reduces as the ambient temperature rises and no flux jump appears when the ambient temperature exceeds a certain value. Moreover, the flux-jump phenomenon exists in a wide range of the ramp rate of the applied external field, i.e. 10-2-102 T s-1. Furthermore, the dependences of the first flux-jump field on the ambient temperature, ramp rate, and bulk thickness are investigated. The critical bulk thicknesses for stability are obtained for different ambient temperatures and sample radii. In addition, the influence of the capability of the interfacial heat transfer on the temporal response of the bulk temperature is discussed. We also find that the prediction of thermomagnetic instability is sensitive to the employment of the flux creep exponent in the simulations.

Diffusion coefficients of Mg isotopes in enstatite and forsterite melts calculated by first-principles molecular dynamic simulations

NASA Astrophysics Data System (ADS)

Huang, F.; Qi, Y.; Liu, X.; He, L.

2016-12-01

Stable isotopes can be fractionated by kinetic chemical diffusion because diffusion coefficients (D) of isotopes are mass-dependent. Diffusive isotopic fractionation recorded in rocks and minerals provide unique temporal constrains on geological processes. The mass dependence of D can be described in the form of Di/Dj= (mj/mi)β, where m denotes masses of isotope i and j, and β is an emperical parameter used to quantify the diffusive transport of isotopes [1]. β values can be estimated by experimental calibration and observation of natural samples, which are still rarely reported because it is challenging to precisely quantify the boundary conditions of diffusion processes [2,3,4]. Recent advances in computation technique provide a new way to theoretically calculate β values. For instance, classical molecular dynamics with empirical potential have been used to simulate interactions between atoms and estimate β of Mg isotopes in MgSiO3 melt [3]. Here, to further consider the effect of bonding and electron properties on β values, we apply first-principles Born-Oppenheimer Molecular Dynamics and pseudo-isotope methods (assuming mj/mi = 1/24, 1/4, 2, and 5) to estimate β for MgSiO3 and Mg2SiO4 melts. Our calculation shows that β of Mg isotopes with pseudo-mass ratios are consistent, indicating the reliability of the pseudo-isotope method. For MgSiO3 melt, β is 0.18 at 4000K and 0 GPa, higher than the value calculatedusing molecular dynamics simulations (0.135) [3]. For Mg2SiO4 melt at 0 GPa, β values are: 0.23 ± 0.04 at 2300K, 0.24 ± 0.07 at 3000K, and 0.24 ± 0.01 at 4000K. Notably, β of MgSiO3 and Mg2SiO4 melts are significantly higher than the value determined by diffusion experiments (0.05) [2]. These results indicate that β values are not sensitive to temperature, but dependent on melt composition.

Characterization of the Catalytic and Nucleotide Binding Properties of the α-Kinase Domain of Dictyostelium Myosin-II Heavy Chain Kinase A*

PubMed Central

Yang, Yidai; Ye, Qilu; Jia, Zongchao; Côté, Graham P.

2015-01-01

The α-kinases are a widely expressed family of serine/threonine protein kinases that exhibit no sequence identity with conventional eukaryotic protein kinases. In this report, we provide new information on the catalytic properties of the α-kinase domain of Dictyostelium myosin-II heavy chain kinase-A (termed A-CAT). Crystallization of A-CAT in the presence of MgATP yielded structures with AMP or adenosine in the catalytic cleft together with a phosphorylated Asp-766 residue. The results show that the β- and α-phosphoryl groups are transferred either directly or indirectly to the catalytically essential Asp-766. Biochemical assays confirmed that A-CAT hydrolyzed ATP, ADP, and AMP with kcat values of 1.9, 0.6, and 0.32 min−1, respectively, and showed that A-CAT can use ADP to phosphorylate peptides and proteins. Binding assays using fluorescent 2′/3′-O-(N-methylanthraniloyl) analogs of ATP and ADP yielded Kd values for ATP, ADP, AMP, and adenosine of 20 ± 3, 60 ± 20, 160 ± 60, and 45 ± 15 μm, respectively. Site-directed mutagenesis showed that Glu-713, Leu-716, and Lys-645, all of which interact with the adenine base, were critical for nucleotide binding. Mutation of the highly conserved Gln-758, which chelates a nucleotide-associated Mg2+ ion, eliminated catalytic activity, whereas loss of the highly conserved Lys-722 and Arg-592 decreased kcat values for kinase and ATPase activities by 3–6-fold. Mutation of Asp-663 impaired kinase activity to a much greater extent than ATPase, indicating a specific role in peptide substrate binding, whereas mutation of Gln-768 doubled ATPase activity, suggesting that it may act to exclude water from the active site. PMID:26260792

Effects of Multimodal Analgesia on the Success of Mouse Embryo Transfer Surgery

PubMed Central

Parker, John M.; Austin, Jamie; Wilkerson, James; Carbone, Larry

2011-01-01

Multimodal analgesia is promoted as the best practice pain management for invasive animal research procedures. Universal acceptance and incorporation of multimodal analgesia requires assessing potential effects on study outcome. The focus of this study was to assess effects on embryo survival after multimodal analgesia comprising an opioid and nonsteroidal antiinflammatory drug (NSAID) compared with opioid-only analgesia during embryo transfer procedures in transgenic mouse production. Mice were assigned to receive either carprofen (5 mg/kg) with buprenorphine (0.1 mg/kg; CB) or vehicle with buprenorphine (0.1 mg/kg; VB) in a prospective, double-blinded placebo controlled clinical trial. Data were analyzed in surgical sets of 1 to 3 female mice receiving embryos chimeric for a shared targeted embryonic stem-cell clone and host blastocyst cells. A total of 99 surgical sets were analyzed, comprising 199 Crl:CD1 female mice and their 996 offspring. Neither yield (pups weaned per embryo implanted in the surgical set) nor birth rate (average number of pups weaned per dam in the set) differed significantly between the CB and VB conditions. Multimodal opioid–NSAID analgesia appears to have no significant positive or negative effect on the success of producing novel lines of transgenic mice by blastocyst transfer. PMID:21838973

Accuracy and Precision of USNO GPS Carrier-Phase Time Transfer

DTIC Science & Technology

2010-01-01

values. Comparison measures used include estimates obtained from two-way satellite time/frequency transfer ( TWSTFT ), and GPS-based estimates obtained...the IGS are used as a benchmark in the computation. Frequency values have a few times 10 -15 fractional frequency uncertainty. TWSTFT values confirm...obtained from two-way satellite time/frequency transfer ( TWSTFT ), BIPM Circular T, and the International GNSS Service (IGS). At present, it is known that

Metal accumulation strategies in plants spontaneously inhabiting Zn-Pb waste deposits.

PubMed

Wójcik, Małgorzata; Sugier, Piotr; Siebielec, Grzegorz

2014-07-15

Metal (Zn, Pb, Cd, Cu, Ni, Cr) accumulation in shoots of 38 plant species spontaneously colonizing three Zn-Pb waste deposits in southern Poland was studied in order to find out if the age of the waste (30-130 years) or its type (slag or flotation residues) influence metal content in plants and to identify species potentially suitable for biomonitoring and phytoremediation. The total metal concentrations in the waste upper layers ranged from 7300 to 171,790 mg kg(-1) for Zn, from 1390 to 22,265 mg kg(-1) for Pb, and from 66 to 1,464 mg kg(-1) for Cd, whereas CaCl2-extracted fractions accounted for 0.034-0.11 %, 0.005-0.03 %, and 0.28-0.62 % of total Zn, Pb and Cd concentrations, respectively. The concentrations of Cu, Ni, and Cr in substrates and in plants were low and ranged within the background values. Metal accumulation in plant shoots was poorly correlated with both total and CaCl2-extracted forms of metals in the substrate and was highly variable among species and also specimens of the same species. The highest mean concentrations of Zn, Pb and Cd were found in Anthyllis vulneraria L. (901.5 mg kg(-1)), Echium vulgare L. (116.92 mg kg(-1)), and Hieracium piloselloides Vill. (26.86 mg kg(-1)), respectively. Besides Reseda lutea L., no species appeared to be a good indicator of polymetallic environment pollution based on chemical analysis of shoots; however, metal accumulation in the whole plant communities of a particular contaminated area might be an accurate tool for assessment of metal transfer to vegetation irrespective of the type or age of the waste. All the species studied developed a metal exclusion strategy, thus exhibiting potential for phytostabilization of metalliferous wastelands. Copyright © 2014 Elsevier B.V. All rights reserved.

Jacaranda cuspidifolia Mart. (Bignoniaceae) as an antibacterial agent.

PubMed

Arruda, Ana Lúcia A; Vieira, Carla J B; Sousa, Daniella G; Oliveira, Regilene F; Castilho, Rachel O

2011-12-01

This study evaluated, in vitro, the antimicrobial activity of the hexane extract (JCHE), methanol extract (JCME), and chloroform fraction (JCCF) of bark from Jacaranda cuspidifolia Mart. (Family Bignoniaceae), a Brazilian medicinal plant, traditionally used as anti-syphilis and anti-gonorrhea treatment. The antimicrobial activity was evaluated using the disc diffusion method followed by the determination of minimum inhibitory concentration (MIC) values. JCHE was not active against the bacteria evaluated. JCME presented antibacterial activity against Streptococcus pyogenes, Staphylococcus aureus, and Neisseria gonorrhoeae with MIC values of 16.3 mg/mL, 9.1 mg/mL, and 25.2 mg/mL, respectively. JCCF was active against Staphylococcus epidermidis, S. aureus, Proteus mirabilis, Serratia marcescens, S. pyogenes, Enterobacter aerogenes, and N. gonorrhoeae with MIC values of 18.3 mg/mL, 9.3 mg/mL, 6.3 mg/mL, 6.1 mg/mL, 9.2 mg/mL, 6.2 mg/mL, and 25.2 mg/mL, respectively. Phytochemical analysis of JCME and JCCF gave positive results for saponins, coumarins, flavonoids, tannins, quinones, alkaloids, triterpenes, and steroids. Verbascoside was isolated and identified as a major peak in JCME and JCCF high-performance liquid chromatography fingerprints and might contribute to the observed antimicrobial activity.

Mixed Convective Condensation in Enclosures with Noncondensable Gases

NASA Astrophysics Data System (ADS)

Fox, Richard John

1994-01-01

A transient, two-dimensional, numerical model was developed in order to study the laminar flow, heat, and mass transfer in a vertical reflux condenser loaded with vapor and noncondensable gas. The simplified model treats the two-component (gas/vapor), two-phase (vapor/liquid) mixture as a continuum by making use of conservation equations for mass continuity, momentum, species, and energy. The liquid mist phase is formed in such a way as to obey one of three conditions: thermodynamic equilibrium, complete nonequilibrium (no mist formation), or partial equilibrium (partial supersaturation). In developing the model, special attention was paid to the formulation of the boundary conditions, global continuity, and numerical efficiency. Two different mixture combinations were used in order to create stable and unstable systems. Steam-helium mixtures (Mv, = 18, Mg = 4) were found to exhibit stable flows with the lighter helium trapped in the upper portion of the condenser, shutting off condensation in that region. Steam-air mixtures (M_ {v}, = 18, Mg = 28) were found to exhibit varying degrees of instability, depending on the noncondensable gas and heat load, owing to the accumulation of the heavy gas near the condensing surface. Under low gas loading cases (Pg = 0.031 kg/m^3) the natural convective fluctuations were found to be weak and the flow was more easily dominated by the forced convective inlet flow and wall suction. At such low gas loadings, stable, asymmetric flow patterns persisted up to high powers. Large gas loadings (Pg = 0.196 kg/m^3) showed much stronger natural convective effects. Regions of counterflowing vapor and gas were found to promote stronger mixing as the power was increased. Regions of noncondensing gas were found to blanket the condenser walls as the suction velocity increased, resulting in a strong resistance to heat and mass transfer and consequent increase in system pressure. Moderate gas loadings (Pg = 0.065 kg/m ^3) were found to exhibit intermediate behavior between the low and high gas loading cases. For the moderate gas loading cases, a bifurcation was found to occur when Re was increased beyond a critical value, forcing the system into one of two stable, distinct flow patterns. Each branch of the bifurcation was found to correspond to the flows that occur in either the low or high gas loading cases, and radically different heat transfer performance was encountered for the same system parameters. The model was also used to simulate experiments conducted in a vertical reflux thermosyphon using steam -air mixtures. The qualitative aspects of the flow were in reasonable agreement between the model and experiment and trends in the local heat transfer were similar. By converting latent heat energy into sensible heat energy, mist formation was found to increase the system temperature and, as a consequence, the overall heat transfer coefficient was lowered. However, the total heat transfer rate was not sensitive to mist formation since the reduction in the latent heat transfer was accompanied by a corresponding increase in the sensible heat transfer, altering the mode but not the magnitude of the total heat transfer.

Factorial effects of salinity, dietary carbohydrate and moult cycle on digestive carbohydrases and hexokinases in Litopenaeus vannamei (Boone, 1931).

PubMed

Gaxiola, Gabriela; Cuzon, Gerard; García, Tomás; Taboada, Gabriel; Brito, Roberto; Chimal, María Eugenia; Paredes, Adriana; Soto, Luis; Rosas, Carlos; van Wormhoudt, Alain

2005-01-01

Litopenaeus vannamei were reared in close cycle over seven generations and tested for their capacity to digest starch and to metabolise glucose at different stages of the moulting cycle. After acclimation with 42.3% of carbohydrates (HCBH) or 2.3% carbohydrates (LCBH) diets and at high salinity (40 g kg(-1)) or low salinity (15 g kg(-1)), shrimp were sampled and hepatopancreas (HP) were stored. Total soluble protein in HP was affected by the interaction between salinity and moult stages (p<0.05). Specific activity of alpha-amylase ranged from 44 to 241 U mg protein(-1) and a significant interaction between salinity and moult stages was observed (p<0.05), resulting in highest values at stage C for low salinity (mean value 196.4 U mg protein(-1)), and at D0 in high salinity (mean value 175.7 U mg protein(-1)). Specific activity of alpha-glucosidase ranged between 0.09 and 0.63 U mg protein(-1), an interaction between dietary CBH and salinity was observed for the alpha-glucosidase (p<0.05) and highest mean value was found in low salinity-LCBH diet treatment (0.329 U mg protein(-1)). Hexokinase specific activity (range 9-113 mU mg protein(-1)) showed no significant differences when measured at 5 mM glucose (p>0.05). Total hexokinase specific activity (range 17-215 mU mg protein(-1)) showed a significant interaction between dietary CBH and salinity (p<0.05) with highest value (mean value 78.5 mU mg protein(-1)) found in HCBH-high salinity treatment, whereas in the other treatments the activity was not significantly different (mean value 35.93 mU mg protein(-1)). A synergistic effect of dietary CBH, salinity and moult stages over hexokinase IV-like specific activity was also observed (p<0.05). As result of this interaction, the highest value (135.5+/-81 mU mg protein(-1)) was observed in HCBH, high salinity at D0 moult stage. Digestive enzymes activity is enhanced in the presence of high starch diet (HCBH) and hexokinase can be induced at certain moulting stages under the influence of blood glucose level. Perspectives are opened to add more carbohydrates in a growing diet, exemplifying the potential approach for less-polluting feed.

The role of benefit transfer in ecosystem service valuation

USGS Publications Warehouse

Richardson, Leslie A.; Loomis, John; Kroeger, Timm; Casey, Frank

2015-01-01

The demand for timely monetary estimates of the economic value of nonmarket ecosystem goods and services has steadily increased over the last few decades. This article describes the use of benefit transfer to generate monetary value estimates of ecosystem services specifically. The article provides guidance for conducting such benefit transfers and summarizes advancements in benefit transfer methods, databases and analysis tools designed to facilitate its application.

Dual-mode cultivation of Chlorella protothecoides applying inter-reactors gas transfer improves microalgae biodiesel production.

PubMed

Santos, C A; Nobre, B; Lopes da Silva, T; Pinheiro, H M; Reis, A

2014-08-20

Chlorella protothecoides, a lipid-producing microalga, was grown heterotrophically and autotrophically in separate reactors, the off-gases exiting the former being used to aerate the latter. Autotrophic biomass productivity with the two-reactor association, 0.0249gL(-1)h(-1), was 2.2-fold the value obtained in a control autotrophic culture, aerated with ambient air. Fatty acid productivity was 1.7-fold the control value. C. protothecoides heterotrophic biomass productivity was 0.229gL(-1)h(-1). This biomass' fatty acid content was 34.5% (w/w) with a profile suitable for biodiesel production, according to European Standards. The carbon dioxide fixed by the autotrophic biomass was 45mgCO2L(-1)h(-1) in the symbiotic arrangement, 2.1 times the control reactor value. The avoided CO2 atmospheric emission represented 30% of the CO2 produced in the heterotrophic stage, while the released O2 represented 49% of the oxygen demand in that stage. Thus, an increased efficiency in the glucose carbon source use and a higher environmental sustainability were achieved in microalgal biodiesel production using the proposed assembly. Copyright © 2014 Elsevier B.V. All rights reserved.

Development of a glucose oxidase-based biocatalyst adopting both physical entrapment and crosslinking, and its use in biofuel cells

NASA Astrophysics Data System (ADS)

Chung, Yongjin; Ahn, Yeonjoo; Christwardana, Marcelinus; Kim, Hansung; Kwon, Yongchai

2016-04-01

New enzymatic catalysts prepared using physical entrapment and chemical bonding were used as anodic catalysts to enhance the performance of enzymatic biofuel cells (EBCs). For estimating the physical entrapment effect, the best glucose oxidase (GOx) concentration immobilized on polyethyleneimine (PEI) and carbon nanotube (CNT) (GOx/PEI/CNT) was determined, while for inspecting the chemical bonding effect, terephthalaldehyde (TPA) and glutaraldehyde (GA) crosslinkers were employed. According to the enzyme activity and XPS measurements, when the GOx concentration is 4 mg mL-1, they are most effectively immobilized (via the physical entrapment effect) and TPA-crosslinked GOx/PEI/CNT(TPA/[GOx/PEI/CNT]) forms π conjugated bonds via chemical bonding, inducing the promotion of electron transfer by delocalization of electrons. Due to the optimized GOx concentration and π conjugated bonds, TPA/[GOx/PEI/CNT], including 4 mg mL-1 GOx displays a high electron transfer rate, followed by excellent catalytic activity and EBC performance.New enzymatic catalysts prepared using physical entrapment and chemical bonding were used as anodic catalysts to enhance the performance of enzymatic biofuel cells (EBCs). For estimating the physical entrapment effect, the best glucose oxidase (GOx) concentration immobilized on polyethyleneimine (PEI) and carbon nanotube (CNT) (GOx/PEI/CNT) was determined, while for inspecting the chemical bonding effect, terephthalaldehyde (TPA) and glutaraldehyde (GA) crosslinkers were employed. According to the enzyme activity and XPS measurements, when the GOx concentration is 4 mg mL-1, they are most effectively immobilized (via the physical entrapment effect) and TPA-crosslinked GOx/PEI/CNT(TPA/[GOx/PEI/CNT]) forms π conjugated bonds via chemical bonding, inducing the promotion of electron transfer by delocalization of electrons. Due to the optimized GOx concentration and π conjugated bonds, TPA/[GOx/PEI/CNT], including 4 mg mL-1 GOx displays a high electron transfer rate, followed by excellent catalytic activity and EBC performance. Electronic supplementary information (ESI) available. See DOI: 10.1039/c6nr00902f

Magnesium Isotope Composition of the Altered Upper Oceanic Crust at ODP Holes 504B and 896A, Costa Rica Rift

NASA Astrophysics Data System (ADS)

Beaumais, A.; Teagle, D. A. H.; James, R. H.; Pearce, C. R.; Milton, J. A.; Alt, J.; Coggon, R. M.

2017-12-01

Alteration of the oceanic crust is thought to be the principal sink of Mg in seawater, but the effect of this process on the Mg isotope (δ26Mg) composition of the oceans remains unclear. Here we present the first measurements of Mg isotopes in altered oceanic crust from ODP Holes 504B and 896A, located in 5.9 Ma crust, 200 km south of the intermediate spreading rate Costa Rica Rift. Hole 504B penetrates: (i) A volcanic section, consisting of partially altered basalt that was open to seawater circulation under oxic-suboxic conditions at temperatures of <150°C. (ii) A transition zone, characterized by mixing between upwelling hydrothermal fluid and seawater between 100 and 350°C. (iii) A sheeted dike complex consisting of diabase partially altered to greenschist facies minerals. Hole 896A penetrates volcanic rocks altered at low temperature (<100 °C) under oxic-suboxic conditions. The overall range in δ26Mg values is -0.53 to -0.01‰; significantly greater than the range observed in unaltered mid-ocean ridge basalts (MORB: -0.25 ± 0.06‰ [1]). δ26Mg values decrease with depth in the volcanic sections of both Holes 504B and 896A. The highest δ26Mg values are found in saponite-bearing basalts at the top of the volcanic sections of both holes, and are attributed to the preferential incorporation of heavy Mg isotopes into secondary clays (Mg-saponite). Lower δ26Mg values recorded in the deeper part of the volcanic section may be a result of fluid-rock interaction with isotopically lighter evolved seawater. The transition zone is characterised by MORB-like to relatively high δ26Mg values in the chlorite-smectite bearing basalts. The sheeted dike complex yields a narrow range of MORB-like δ26Mg values suggesting that limited fractionation occurs during high-temperature alteration and that the fluids have very low Mg concentrations. Low temperature fluid-rock interactions modify the Mg isotopic composition of the upper part of the oceanic crust. Therefore, this process could potentially play a role in balancing the δ26Mg of (i) the seawater via lateral fluid flow through oceanic crust off-axis ridge flanks, and (ii) the mantle via recycling of oceanic lithosphere at subduction zones. [1] Teng et al., (2010) GCA 74, 4150-4166.

Accurate SERS detection of malachite green in aquatic products on basis of graphene wrapped flexible sensor.

PubMed

Ouyang, Lei; Yao, Ling; Zhou, Taohong; Zhu, Lihua

2018-10-16

Malachite Green (MG) is a banned pesticide for aquaculture products. As a required inspection item, its fast and accurate determination before the products' accessing market is very important. Surface enhanced Raman scattering (SERS) is a promising tool for MG sensing, but it requires the overcoming of several problems such as fairly poor sensitivity and reproducibility, especially laser induced chemical conversion and photo-bleaching during SERS observation. By using a graphene wrapped Ag array based flexible membrane sensor, a modified SERS strategy was proposed for the sensitive and accurate detection of MG. The graphene layer functioned as an inert protector for impeding chemical transferring of the bioproduct Leucomalachite Green (LMG) to MG during the SERS detection, and as a heat transmitter for preventing laser induced photo-bleaching, which enables the separate detection of MG and LMG in fish extracts. The combination of the Ag array and the graphene cover also produced plentiful densely and uniformly distributed hot spots, leading to analytical enhancement factor up to 3.9 × 10 8 and excellent reproducibility (relative standard deviation low to 5.8% for 70 runs). The proposed method was easily used for MG detection with limit of detection (LOD) as low as 2.7 × 10 -11  mol L -1 . The flexibility of the sensor enable it have a merit for in-field fast detection of MG residues on the scale of a living fish through a surface extraction and paste transferring manner. The developed strategy was successfully applied in the analysis of real samples, showing good prospects for both the fast inspection and quantitative detection of MG. Copyright © 2018 Elsevier B.V. All rights reserved.

Insight into magnesium coordination environments in benzoate and salicylate complexes through 25Mg solid-state NMR spectroscopy.

PubMed

Burgess, Kevin M N; Xu, Yang; Leclerc, Matthew C; Bryce, David L

2013-08-01

We report on the (25)Mg solid-state nuclear magnetic resonance (NMR) characterization of a series of magnesium complexes featuring Mg(2+) ions in organic coordination environments. Six compounds have been synthesized with benzoate and salicylate ligands, which are typically used as linkers in metal organic frameworks (MOFs). The use of ultrahigh-field solid-state NMR has revealed a relatively large range of values for the (25)Mg quadrupolar coupling constant, CQ((25)Mg), in these compounds. In contrast to some previously studied inorganic Mg(2+) complexes, the values of CQ((25)Mg) in organic Mg(2+) complexes are well rationalized by the degree of octahedral strain of the "MgO6" coordination polyhedra. (13)C and (25)Mg isotropic chemical shifts were also found to be sensitive to the binding mode of the carboxylate ligands. The experimental findings are corroborated by gauge-including projector-augmented-wave (GIPAW) density functional theory (DFT) computations, and these have allowed for an interpretation of the experimentally observed trend in the CQ((25)Mg) values and for the visualization of the EFG tensor principal components with respect to the molecular structure. These new insights may prove to be valuable for the understanding and interpretation of (25)Mg NMR data for Mg(2+) ions in organic binding environments such as those found in MOFs and protein-divalent metal binding sites.

Investigating the behaviour of Mg isotopes during the formation of clay minerals

NASA Astrophysics Data System (ADS)

Wimpenny, Joshua; Colla, Christopher A.; Yin, Qing-Zhu; Rustad, James R.; Casey, William H.

2014-03-01

We present elemental and isotopic data detailing how the Mg isotope system behaves in natural and experimentally synthesized clay minerals. We show that the bulk Mg isotopic composition (δ26Mg) of a set of natural illite, montmorillonite and kaolinite spans a 2‰ range, and that their isotopic composition depends strongly on a balance between the relative proportions of structural and exchangeable Mg. After acid leaching, these natural clays become relatively enriched in isotopically heavy Mg by between 0.2‰ and 1.6‰. Results of exchange experiments indicate that the Mg that has adsorbed to interlayer spaces and surface charged sites is relatively enriched in isotopically light Mg compared to the residual clay. The isotopic composition of this exchangeable Mg (-1.49‰ to -2.03‰) is characteristic of the isotopic composition of Mg found in many natural waters. Further experiments with an isotopically characterized MgCl2 solution shows that the clay minerals adsorb this exchangeable Mg with little or no isotopic fractionation, although we cannot discount the possibility that the uptake of exchangeable Mg does so with a slight preference for 24Mg. To characterize the behaviour of Mg isotopes during clay mineral formation we synthesized brucite (Mg(OH)2), which we consider to be a good analogue for the incorporation of Mg into the octahedral sheet of Mg-rich clay minerals or into the brucitic layer of clays such as chlorite. In our experiment the brucite mineral becomes enriched in the heavy isotopes of Mg while the corresponding solution is always relatively enriched in isotopically light Mg. The system reaches a steady state after 10 days with a final fractionation factor (αsolid-solution) of 1.0005 at near-neutral pH. This result is consistent with the general consensus that secondary clay minerals preferentially take up isotopically heavy Mg during their formation. However our results also show that exchangeable Mg is an important component within bulk clay minerals and can have an important influence over the bulk clay δ26Mg value. Modeling shows that in certain soils or sediments where the percentage of exchangeable Mg is >30% and the isotopic composition of the exchangeable Mg is around -2‰, the generation of bulk δ26Mg values of <-0.5‰ is likely. On a broader scale, Mg-rich minerals such as smectite and illite are likely to impart a stronger control over the Mg budget in clay rich sediments, and their high structural Mg component is likely to result in bulk sediment δ26Mg values that are closer in composition to the UCC. Despite this, results of modeling, together with experimental observation suggests that the uptake of exchangeable Mg into these clay rich sediments could cause a decrease in the bulk δ26Mg value by up to ˜0.3-0.4‰. This should be accounted for when assessing the δ26Mg value of sediments on a crustal scale.

Nanostructured biosensor for detecting glucose in tear by applying fluorescence resonance energy transfer quenching mechanism.

PubMed

Chen, Longyi; Tse, Wai Hei; Chen, Yi; McDonald, Matthew W; Melling, James; Zhang, Jin

2017-05-15

In this paper, a nanostructured biosensor is developed to detect glucose in tear by using fluorescence resonance energy transfer (FRET) quenching mechanism. The designed FRET pair, including the donor, CdSe/ZnS quantum dots (QDs), and the acceptor, dextran-binding malachite green (MG-dextran), was conjugated to concanavalin A (Con A), an enzyme with specific affinity to glucose. In the presence of glucose, the quenched emission of QDs through the FRET mechanism is restored by displacing the dextran from Con A. To have a dual-modulation sensor for convenient and accurate detection, the nanostructured FRET sensors were assembled onto a patterned ZnO nanorod array deposited on the synthetic silicone hydrogel. Consequently, the concentration of glucose detected by the patterned sensor can be converted to fluorescence spectra with high signal-to-noise ratio and calibrated image pixel value. The photoluminescence intensity of the patterned FRET sensor increases linearly with increasing concentration of glucose from 0.03mmol/L to 3mmol/L, which covers the range of tear glucose levels for both diabetics and healthy subjects. Meanwhile, the calibrated values of pixel intensities of the fluorescence images captured by a handhold fluorescence microscope increases with increasing glucose. Four male Sprague-Dawley rats with different blood glucose concentrations were utilized to demonstrate the quick response of the patterned FRET sensor to 2µL of tear samples. Copyright © 2016 Elsevier B.V. All rights reserved.

The coupling between stability and ion pair formation in magnesium electrolytes from first-principles quantum mechanics and classical molecular dynamics

DOE PAGES

Rajput, Nav Nidhi; Qu, Xiaohuui; Sa, Niya; ...

2015-02-10

Here in this work we uncover a novel effect between concentration dependent ion pair formation and anion stability at reducing potentials, e.g., at the metal anode. Through comprehensive calculations using both first-principles as well as well-benchmarked classical molecular dynamics over a matrix of electrolytes, covering solvents and salt anions with a broad range in chemistry, we elucidate systematic correlations between molecular level interactions and composite electrolyte properties, such as electrochemical stability, solvation structure, and dynamics. We find that Mg electrolytes are highly prone to ion pair formation, even at modest concentrations, for a wide range of solvents with different dielectricmore » constants, which have implications for dynamics as well as charge transfer. Specifically, we observe that, at Mg metal potentials, the ion pair undergoes partial reduction at the Mg cation center (Mg 2+ -> Mg +), which competes with the charge transfer mechanism and can activate the anion to render it susceptible to decomposition. Specifically, TFSI exhibits a significant bond weakening while paired with the transient, partially reduced Mg +. In contrast, BH 4 $-$ and BF 4 $-$ are shown to be chemically stable in a reduced ion pair configuration. Furthermore, we observe that higher order glymes as well as DMSO improve the solubility of Mg salts, but only the longer glyme chains reduce the dynamics of the ions in solution. This information provides critical design metrics for future electrolytes as it elucidates a close connection between bulk solvation and cathodic stability as well as the dynamics of the salt.« less

Optical signature of Mg-doped GaN: Transfer processes

NASA Astrophysics Data System (ADS)

Callsen, G.; Wagner, M. R.; Kure, T.; Reparaz, J. S.; Bügler, M.; Brunnmeier, J.; Nenstiel, C.; Hoffmann, A.; Hoffmann, M.; Tweedie, J.; Bryan, Z.; Aygun, S.; Kirste, R.; Collazo, R.; Sitar, Z.

2012-08-01

Mg doping of high quality, metal organic chemical vapor deposition grown GaN films results in distinct traces in their photoluminescence and photoluminescence excitation spectra. We analyze GaN:Mg grown on sapphire substrates and identify two Mg related acceptor states, one additional acceptor state and three donor states that are involved in the donor-acceptor pair band transitions situated at 3.26-3.29 eV in GaN:Mg. The presented determination of the donor-acceptor pair band excitation channels by photoluminescence excitation spectroscopy in conjunction with temperature-dependent photoluminescence measurements results in a direct determination of the donor and acceptor binding, localization, and activation energies, which is put into a broader context based on Haynes's rule. Furthermore, we analyze the biexponential decay dynamics of the photoluminescence signal of the acceptor and donor bound excitons. As all observed lifetimes scale with the localization energy of the donor and acceptor related bound excitons, defect and complex bound excitons can be excluded as their origin. Detailed analysis of the exciton transfer processes in the close energetic vicinity of the GaN band edge reveals excitation via free and bound excitonic channels but also via an excited state as resolved for the deepest localized Mg related acceptor bound exciton. For the two Mg acceptor states, we determine binding energies of 164 ± 5 and 195 ± 5 meV, which is in good agreement with recent density functional theory results. This observation confirms and quantifies the general dual nature of acceptor states in GaN based on the presented analysis of the photoluminescence and photoluminescence excitation spectra.

FAST TRACK COMMUNICATION Heat transfer between graphene and amorphous SiO2

NASA Astrophysics Data System (ADS)

Persson, B. N. J.; Ueba, H.

2010-11-01

We study the heat transfer between graphene and amorphous SiO2. We include both the heat transfer from the area of real contact, and between the surfaces in the non-contact region. We consider the radiative heat transfer associated with the evanescent electromagnetic waves which exist outside of all bodies, and the heat transfer by the gas in the non-contact region. We find that the dominant contribution to the heat transfer results from the area of real contact, and the calculated value of the heat transfer coefficient is in good agreement with the value deduced from experimental data.

Caffeine consumption.

PubMed

Barone, J J; Roberts, H R

1996-01-01

Scientific literature cites a wide range of values for caffeine content in food products. The authors suggest the following standard values for the United States: coffee (5 oz) 85 mg for ground roasted coffee, 60 mg for instant and 3 mg for decaffeinated; tea (5 oz): 30 mg for leaf/bag and 20 mg for instant; colas: 18 mg/6 oz serving; cocoa/hot chocolate: 4 mg/5 oz; chocolate milk: 4 mg/6 oz; chocolate candy: 1.5-6.0 mg/oz. Some products from the United Kingdom and Denmark have higher caffeine content. Caffeine consumption survey data are limited. Based on product usage and available consumption data, the authors suggest a mean daily caffeine intake for US consumers of 4 mg/kg. Among children younger than 18 years of age who are consumers of caffeine-containing foods, the mean daily caffeine intake is about 1 mg/kg. Both adults and children in Denmark and UK have higher levels of caffeine intake.

Irrigational impact of untreated and treated brewery-distillery effluent on seed germination of marigold (Tagetes erecta L.).

PubMed

Sharma, Anuradha; Malaviya, Piyush

2016-01-01

Current study presents the effect of irrigation with different concentrations (20, 40, 60, 80 and 100%) of untreated and treated brewery-distillery effluent on germination behaviour of marigold (Tagetes erecta L. var. Pusa Basanti). The 100% untreated effluent showed acidic pH (4.80) and higher values of BOD (1500.00 mg l(-1)), COD (4000.00 mg l(-1)), chloride (1742.20 mg l(-1)), TSS (900.00 mg l(-1)) as compared to that of treated effluent. Tagetes seeds were exposed to different concentrations of effluent and the results revealed maximum values of germination parameters viz., percent germination, peak value, germination value, germination index, speed of germination and vigour index at 20% untreated and 60% treated effluent concentrations, whereas the values for negative germination parameters viz., delay index, germination period and percent inhibition were minimum at 20% untreated and 60% treated effluent concentrations.

Penetration depth of MgB2 measured using Josephson junctions and SQUIDs

NASA Astrophysics Data System (ADS)

Cunnane, Daniel; Zhuang, Chenggang; Chen, Ke; Xi, X. X.; Yong, Jie; Lemberger, T. R.

2013-02-01

The penetration depth of MgB2 was measured using two methods of different mechanisms. The first method used MgB2 Josephson junctions and the magnetic field dependence of the junction critical current. The second method deduced the penetration depth from the inductance of a MgB2 microstrip used to modulate the voltage of a MgB2 DC SQUID. The two methods showed a consistent value of the low-temperature penetration depth for MgB2 to be about 40 nm. Both the small penetration depth value and its temperature dependence are in agreement with a microscopic theory for MgB2 in the clean limit.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhu, Jia, E-mail: jia-zhu@jxnu.edu.cn, E-mail: zhangyf@fzu.edu.cn; Zhang, Hui; Tong, Yawen

The structures and electronic properties of bimetallic oxide CrW{sub 2}O{sub 9} clusters supported on the perfect and defective MgO(001) surfaces with three different color centers, F{sub S}{sup 0}, F{sub S}{sup +}, and F{sub S}{sup 2+} centers, respectively, have been investigated by density functional theory calculations. Our results show that the configurations, adsorption energies, charge transfers, and bonding modes of dispersed CrW{sub 2}O{sub 9} clusters are sensitive to the charge states of the F{sub S} centers. Compared with the gas-phase configuration, the CrW{sub 2}O{sub 9} clusters supported on the defective surfaces are distorted dramatically, which exhibit different chain structures. On themore » perfect MgO surface, the depositions of clusters do not involve obvious charge transfer, while the situation is quite different on the defective MgO(001) surfaces in which significant electron transfer occurs from the surface to the cluster. Interestingly, this effect becomes more remarkable for electron-rich oxygen vacancies (F{sub S}{sup 0} center) than that for electron-poor oxygen vacancies (F{sub S}{sup +} and F{sub S}{sup 2+} centers). Furthermore, our work reveals a progressive Brønsted acid sites where spin density preferentially localized around the Cr atoms not the W atoms for all kinds of F{sub S}-centers, indicating the better catalytic activities can be expected for CrW{sub 2}O{sub 9} cluster on defective MgO(001) surfaces with respect to the W{sub 3}O{sub 9} cluster.« less

Adenovirus vector-mediated ex vivo gene transfer of brain-derived neurotrophic factor to bone marrow stromal cells promotes axonal regeneration after transplantation in completely transected adult rat spinal cord

PubMed Central

Kamada, Takahito; Hashimoto, Masayuki; Murakami, Masazumi; Shirasawa, Hiroshi; Sakao, Seiichiro; Ino, Hidetoshi; Yoshinaga, Katsunori; Koshizuka, Shuhei; Moriya, Hideshige; Yamazaki, Masashi

2007-01-01

The aim of this study was to evaluate the efficacy in adult rat completely transected spinal cord of adenovirus vector-mediated brain-derived neurotrophic factor (BDNF) ex vivo gene transfer to bone marrow stromal cells (BMSC). BMSC were infected with adenovirus vectors carrying β-galactosidase (AxCALacZ) or BDNF (AxCABDNF) genes. The T8 segment of spinal cord was removed and replaced by graft containing Matrigel alone (MG group) or Matrigel and BMSC infected by AxCALacZ (BMSC-LacZ group) or AxCABDNF (BMSC-BDNF group). Axons in the graft were evaluated by immunohistochemistry and functional recovery was assessed with BBB locomotor scale. In the BMSC-BDNF group, the number of fibers positive for growth associated protein-43, tyrosine hydroxylase, and calcitonin gene-related peptide was significantly larger than numbers found for the MG and BMSC-LacZ groups. Rats from BMSC-BDNF and BMSC-LacZ groups showed significant recovery of hind limb function compared with MG rats; however, there was no significant difference between groups in degree of functional recovery. These findings demonstrate that adenovirus vector-mediated ex vivo gene transfer of BDNF enhances the capacity of BMSC to promote axonal regeneration in this completely transected spinal cord model; however, BDNF failed to enhance hind limb functional recovery. Further investigation is needed to establish an optimal combination of cell therapy and neurotrophin gene transfer for cases of spinal cord injury. PMID:17885772

Multimodal transfer of MDR by exosomes in human osteosarcoma.

PubMed

Torreggiani, Elena; Roncuzzi, Laura; Perut, Francesca; Zini, Nicoletta; Baldini, Nicola

2016-07-01

Exosomes are extracellular vesicles released by both normal and tumour cells which are involved in a new intercellular communication pathway by delivering cargo (e.g., proteins, microRNAs, mRNAs) to recipient cells. Tumour-derived exosomes have been shown to play critical roles in different stages of tumour growth and progression. In this study, we investigated the potential role of exosomes to transfer the multidrug resistance (MDR) phenotype in human osteosarcoma cells. Exosomes were isolated by differential centrifugation of culture media from multidrug resistant human osteosarcoma MG-63DXR30 (Exo/DXR) and MG-63 parental cells (Exo/S). Exosome purity was examined by transmission electron microscopy and confirmed by immunoblot analysis for the expression of specific exosomal markers. Our data showed that exosomes derived from doxorubicin-resistant osteosarcoma cells could be taken up into secondary cells and induce a doxorubicin-resistant phenotype. The incubation of osteosarcoma cells with Exo/DXR decreased the sensitivity of parental cells to doxorubicin, while exposure with Exo/S was ineffective. In addition, we demonstrated that Exo/DXR expressed higher levels of MDR-1 mRNA and P-glycoprotein compared to Exo/S (p=0.03). Interestingly, both MDR-1 mRNA and P-gp increased in MG-63 cells after incubation with Exo/DXR, suggesting this as the main mechanism of exosome-mediated transfer of drug resistance. Our findings suggest that multidrug resistant osteosarcoma cells are able to spread their ability to resist the effects of doxorubicin treatment on sensitive cells by transferring exosomes carrying MDR-1 mRNA and its product P-glycoprotein.

Covariation of human microsomal protein per gram of liver with age: absence of influence of operator and sample storage may justify interlaboratory data pooling.

PubMed

Barter, Z E; Chowdry, J E; Harlow, J R; Snawder, J E; Lipscomb, J C; Rostami-Hodjegan, A

2008-12-01

Scaling of metabolic clearance values from liver microsomal data or recombinantly expressed cytochrome P450 enzymes to predict human hepatic clearance requires knowledge of the amount of microsomal protein per gram of liver (MPPGL). Identification of physiological covariates of MPPGL requires analysis of values from large diverse populations, which necessitates pooling of data from numerous sources. To ensure compatibility between results obtained within and between studies, the impact of interoperator differences and sample storage on values of MPPGL was investigated. With use of triplicate samples from one liver (HL86), no statistically significant difference was detected between values of MPPGL prepared from samples stored at -80 degrees C (23.5 +/- 1.2 mg g(-1)) and those determined using fresh tissue (21.9 +/- 0.3 mg g(-1)). Although there was a significant difference in the yield of microsomal protein obtained from another liver sample (HL43) by three different operators (17 +/- 1, 19 +/- 2, and 24 +/- 1 mg g(-1); p = 0.004, analysis of variance), no difference was observed in the estimated MPPGL after application of appropriate correction factors for each operator (28 +/- 1, 30 +/- 5, and 31 +/- 4 mg g(-1)). The result provided justification for pooling reported values of MPPGL for use in covariate analysis. Investigation of the relationship between age and MPPGL provided preliminary evidence that MPPGL values increase from birth to a maximum of 40 mg g(-1) [95% confidence interval for the geometric mean (95% CI mean(geo)): 37-43 mg g(-1) at approximately 28 years followed by a gradual decrease in older age (mean of 29 mg g(-1) at 65 years; 95% CI mean(geo): 27-32 mg g(-1)). Accordingly, appropriate age-adjusted scaling factors should be used in extrapolating in vitro clearance values to clinical studies.

Micropropagation of Gerbera (Gerbera jamesonii Bolus).

PubMed

Minerva, Ghani; Kumar, Surinder

2013-01-01

Gerbera (Gerbera jamesonii Bolus) is one of the most popular ornamental flowers worldwide and used both as cut flower and potted plant. Some of them show excellent agronomic characters such as color, floral diameter, stem length, and vigor, which make this plant of commercial importance. Conventionally, multiplication is done through seeds or rhizome cuttings. Rapid multiplication of elite cultivars of Gerbera, with improved agronomic traits, has been achieved by using both direct and indirect tissue culture methods. Direct shoot regeneration was accomplished from stem apices on MS medium supplemented with 1 mg/L 6-benzyladenine (BA) and 1 mg/L kinetin. Indirect shoot induction succeeded from callus differentiation has been achieved on MS medium containing 2 mg/L 2,4-dichlorophenoxyacetic acid, 0.5 mg/L indole-3-acetic acid, and 2 mg/L BA. The in vitro shoots, 4-5 cm long, were rooted by quick dipping the shoot bases for 3-5 s in 2,000 mg/L indole-3-butyric acid solution followed by transfer to the pots containing farmyard manure, soil, and sand (1:1:1 by volume). Initially, in vitro plantlets were covered with glass jars to maintain a high relative humidity (85-90%). As soon as new shoot growth begins, relative humidity is decreased by exposing them to the open environmental conditions prior transferring to the glasshouse. Indirect shoot regeneration increased the frequency of somaclonal variations. The selected somaclones were used in developing new and novel cultivars.

Evaluation of Bacopa monniera for its synergistic activity with rivastigmine in reversing aluminum-induced memory loss and learning deficit in rats.

PubMed

Thippeswamy, Agadi Hiremath; Rafiq, Mohamed; Viswantha, Gollapalle Lakshminarayana Shastry; Kavya, Kethaganahalli J; Anturlikar, Suryakanth D; Patki, Pralhad S

2013-08-01

The objective of this study was to evaluate the synergistic activity of Bacopa monniera with Rivastigmine against aluminum-chloride (AlCl3)-induced cognitive impairment in rats. Adult male Wistar rats were divided into ten groups (n = 10) and subjected to their assigned treatments for 42 days. On the 20(th) day of the respective drug treatments, all the animals were trained in the Morris water maze (retention latency) and the elevated plus maze (transfer latency). After the initial training, the retention latency (RL) and the transfer latency (TL) were evaluated on the 21(st) and the 42(nd) days of the study. Chronic administration of AlCl3 caused significant memory impairment associated with increased RL in the Morris water maze task and increased TL in the elevated plus maze test. Interestingly, animals treated with oral administration of B. monniera (100 and 200 mg/kg), Rivastigmine (5 mg/kg) or a combination of B. monniera (100 mg/kg) with Rivastigmine (5 mg/kg) showed significant protection against AlCl3-induced memory impairment compared to animal treated with AlCl3per se. Additionally, the neuroprotective effect of B. monniera (100 and 200 mg/kg) was significantly improved when supplemented with Rivastigmine (5 mg/kg). These findings suggest that treatment with a combination of B. monniera with Rivastigmine may be highly beneficial compared to their per-se treatment. Copyright © 2013. Published by Elsevier B.V.

Fungal trehalose phosphorylase: kinetic mechanism, pH-dependence of the reaction and some structural properties of the enzyme from Schizophyllum commune.

PubMed Central

Eis, C; Watkins, M; Prohaska, T; Nidetzky, B

2001-01-01

Initial-velocity measurements for the phospholysis and synthesis of alpha,alpha-trehalose catalysed by trehalose phosphorylase from Schizophyllum commune and product and dead-end inhibitor studies show that this enzyme has an ordered Bi Bi kinetic mechanism, in which phosphate binds before alpha,alpha-trehalose, and alpha-D-glucose is released before alpha-D-glucose 1-phosphate. The free-energy profile for the enzymic reaction at physiological reactant concentrations displays its largest barriers for steps involved in reverse glucosyl transfer to D-glucose, and reveals the direction of phospholysis to be favoured thermodynamically. The pH dependence of kinetic parameters for all substrates and the dissociation constant of D-glucal, a competitive dead-end inhibitor against D-glucose (K(i)=0.3 mM at pH 6.6 and 30 degrees C), were determined. Maximum velocities and catalytic efficiencies for the forward and reverse reactions decrease at high and low pH, giving apparent pK values of 7.2--7.8 and 5.5--6.0 for two groups whose correct protonation state is required for catalysis. The pH dependences of k(cat)/K are interpreted in terms of monoanionic phosphate and alpha-D-glucose 1-phosphate being the substrates, and of the pK value seen at high pH corresponding to the phosphate group in solution or bound to the enzyme. The K(i) value for the inhibitor decreases outside the optimum pH range for catalysis, indicating that binding of D-glucal is tighter with incorrectly ionized forms of the complex between the enzyme and alpha-D-glucose 1-phosphate. Each molecule of trehalose phosphorylase contains one Mg(2+) that is non-dissociable in the presence of metal chelators. Measurements of the (26)Mg(2+)/(24)Mg(2+) ratio in the solvent and on the enzyme by using inductively coupled plasma MS show that exchange of metal ion between protein and solution does not occur at measurable rates. Tryptic peptide mass mapping reveals close structural similarity between trehalose phosphorylases from basidiomycete fungi. PMID:11389683

Plutonium recovery from spent reactor fuel by uranium displacement

DOEpatents

Ackerman, John P.

1992-01-01

A process for separating uranium values and transuranic values from fission products containing rare earth values when the values are contained together in a molten chloride salt electrolyte. A molten chloride salt electrolyte with a first ratio of plutonium chloride to uranium chloride is contacted with both a solid cathode and an anode having values of uranium and fission products including plutonium. A voltage is applied across the anode and cathode electrolytically to transfer uranium and plutonium from the anode to the electrolyte while uranium values in the electrolyte electrolytically deposit as uranium metal on the solid cathode in an amount equal to the uranium and plutonium transferred from the anode causing the electrolyte to have a second ratio of plutonium chloride to uranium chloride. Then the solid cathode with the uranium metal deposited thereon is removed and molten cadmium having uranium dissolved therein is brought into contact with the electrolyte resulting in chemical transfer of plutonium values from the electrolyte to the molten cadmium and transfer of uranium values from the molten cadmium to the electrolyte until the first ratio of plutonium chloride to uranium chloride is reestablished.

Role of basic and acidic centers of MgO and modified MgO in catalytic transfer hydrogenation of ketones studied by infrared spectroscopy

NASA Astrophysics Data System (ADS)

Szöllösi, György; Bartók, Mihály

1999-05-01

In this study our aim was to identify the active sites and the surface species responsible for deactivation of MgO during catalytic transfer hydrogenations (CTH) of ketones using alcohols as hydrogen donors. Our previous studies showed that deactivation of MgO could be prevented by previous treatment with chloromethanes. Therefore the surface species formed during the reaction were studied before and after treatment with chloroform or chloroform- d by in situ infrared spectroscopy (IR). As a result, it was concluded that the reaction requires the presence of surface basic and acidic centers. The presence of Lewis acid centers was not necessary, the reaction could proceed on weakly acidic surface Brönsted sites, as the alterations in intensity and position of the ν(OH) bands indicated. Modification with chloroform resulted also in the generation of surface OH groups with a proper acidity for the reaction. The shift in carbonyl vibrations led us to the conclusion that Lewis acid and base centers were responsible for the catalyst poisoning, so covering these acid sites by Cl - led to a stable catalyst.

Role of carbohydrate metabolism in grass tetany

DOE Office of Scientific and Technical Information (OSTI.GOV)

Miller, J.K.; Madsen, F.C.; Lentz, D.E.

1977-01-01

Clinical hypomagnesemia is confined primarily to beef cattle in the United States but also occurs in dairy cattle in other countries, probably due to different management practices. During periods when grass tetany is likely, early vegetative temperate zone grasses are usually low in total readily available carbohydrates and magnesium but high in potassium and nitrogen. The tetany syndrome may include hypoglycemia and ketosis, suggesting an imbalance in intermediary energy metabolism. Many enzyme systems critical to cellular metabolism, including those which hydrolyze and transfer phosphate groups, are activated by Mg. Thus, by inference, Mg is required for normal glucose utilization, fat,more » protein, nucleic acid and coenzyme synthesis, muscle contraction, methyl group transfer, and sulfate, acetate, and formate activation. Numerous clinical and experimental studies suggest an intimate relationship between metabolism of Mg and that of carbohydrate, glucagon, and insulin. The objective is to review this literature and suggest ways in which these relationships might contribute to a chain of events leading to grass tetany.« less

26 CFR 1.684-1 - Recognition of gain on transfers to certain foreign trusts and estates.

Code of Federal Regulations, 2010 CFR

2010-04-01

... recognize gain at the time of the transfer equal to the excess of the fair market value of the property... portion of FT. Under paragraph (a)(1) of this section, A recognizes gain at the time of the transfer equal... of 1000X, and property R, with a fair market value of 2000X, to FT. At the time of the transfer, A's...

Cost benefit assessment of NASA remote sensing technology transferred to the State of Georgia

NASA Technical Reports Server (NTRS)

Kelly, D. L.; Zimmer, R. P.; Wilkins, R. D.

1978-01-01

The benefits involved in the transfer of NASA remote sensing technology to eight Georgia state agencies are identified in quantifiable and qualitative terms, and a value for these benefits is computed by means of an effectiveness analysis. The benefits of the transfer are evaluated by contrasting a baseline scenario without Landsat and an alternative scenario with Landsat. The net present value of the Landsat technology being transferred is estimated at 9.5 million dollars. The estimated value of the transfer is most sensitive to discount rate, the cost of photo acquisition, and the cost of data digitalization. It is estimated that, if the budget is constrained, Landsat could provide data products roughly seven times more frequently than would otherwise be possible.

Transfer of Low Dose Aspirin Into Human Milk.

PubMed

Datta, Palika; Rewers-Felkins, Kathleen; Kallem, Raja Reddy; Baker, Teresa; Hale, Thomas W

2017-05-01

Aspirin has antipyretic and anti-inflammatory properties and is frequently used by pregnant and lactating women. However, its transfer in human milk when administered at low dose has not been reported. Research aim: This study aimed to evaluate the transfer of acetylsalicylic acid and its metabolite, salicylic acid, into human milk following the use of low dose aspirin. In this study, milk samples were collected at 0, 1, 2, 4, 8, 12, and 24 hours from seven breastfeeding women after a steady-state daily dose of 81 mg of aspirin. Milk levels of acetylsalicylic acid and salicylic acid were determined by liquid chromatography-tandem mass spectrometry. Acetylsalicylic acid levels were below the limit of quantification (0.61 ng/ml) in all the milk samples, whereas salicylic acid was detected at very low concentrations. The average concentration of salicylic acid observed was 24 ng/ml and the estimated relative infant dose was 0.4%. Acetylsalicylic acid transfer into milk is so low that it is undetectable even by highly sophisticated methodology. Salicylic acid does appear in the human milk in comparatively low amounts, which are probably subclinical in infants. Thus, the daily use of an 81-mg dose of aspirin should be considered safe during lactation.

Ketorolac after free tissue transfer: a comparative effectiveness study.

PubMed

Schleiffarth, J Robert; Bayon, Rodrigo; Chang, Kristi E; Van Daele, Douglas J; Pagedar, Nitin A

2014-06-01

We sought to compare postoperative pain and complications in patients undergoing free tissue transfer for reconstruction of head and neck defects with and without ketorolac. In this retrospective cohort study, we identified patients who underwent head and neck free tissue transfer procedures at the University of Iowa between July 2010 and December 2012. A subset of patients received ketorolac as an anti-platelet agent. Main outcome measures include postoperative analgesic use, pain scores, and bleeding complications. We identified 138 free tissue transfers, with 42 procedures in the ketorolac cohort. In the first 7 postoperative days, patients in the ketorolac and non-ketorolac cohorts received equivalent narcotic doses (morphine equivalents, 48.9 mg/day vs 46.6 mg/day, P = .72). The ketorolac group reported higher mean pain scores (3.1 vs 2.4, P = .004). Ketorolac use was not associated with need for transfusion (P = .86) or number of days with neck drains (P = .79). Ketorolac did not demonstrate a significant analgesic effect in this group of patients in terms of pain scores and opioid requirements. However, there also was no evidence to suggest a higher likelihood of bleeding complications. Ketorolac may be safely used as an anti-platelet agent, with narcotic requirements unchanged.

Determination of external and internal mass transfer limitation in nitrifying microbial aggregates.

PubMed

Wilén, Britt-Marie; Gapes, Daniel; Keller, Jürg

2004-05-20

In this article we present a study of the effects of external and internal mass transfer limitation of oxygen in a nitrifying system. The oxygen uptake rates (OUR) were measured on both a macro-scale with a respirometric reactor using off-gas analysis (Titrimetric and Off-Gas Analysis (TOGA) sensor) and on a micro-scale with microsensors. These two methods provide independent, accurate measurements of the reaction rates and concentration profiles around and in the granules. The TOGA sensor and microsensor measurements showed a significant external mass transfer effect at low dissolved oxygen (DO) concentrations in the bulk liquid while it was insignificant at higher DO concentrations. The oxygen distribution with anaerobic or anoxic conditions in the center clearly shows major mass transfer limitation in the aggregate interior. The large drop in DO concentration of 22-80% between the bulk liquid and aggregate surface demonstrates that the external mass transfer resistance is also highly important. The maximum OUR even for floccular biomass was only attained at much higher DO concentrations (approximately 8 mg/L) than typically used in such systems. For granules, the DO required for maximal activity was estimated to be >20 mg/L, clearly indicating the effects of the major external and internal mass transfer limitations on the overall biomass activity. Smaller aggregates had a larger volumetric OUR indicating that the granules may have a lower activity in the interior part of the aggregate. Copyright 2004 Wiley Periodicals, Inc.

Context transfer in reinforcement learning using action-value functions.

PubMed

Mousavi, Amin; Nadjar Araabi, Babak; Nili Ahmadabadi, Majid

2014-01-01

This paper discusses the notion of context transfer in reinforcement learning tasks. Context transfer, as defined in this paper, implies knowledge transfer between source and target tasks that share the same environment dynamics and reward function but have different states or action spaces. In other words, the agents learn the same task while using different sensors and actuators. This requires the existence of an underlying common Markov decision process (MDP) to which all the agents' MDPs can be mapped. This is formulated in terms of the notion of MDP homomorphism. The learning framework is Q-learning. To transfer the knowledge between these tasks, the feature space is used as a translator and is expressed as a partial mapping between the state-action spaces of different tasks. The Q-values learned during the learning process of the source tasks are mapped to the sets of Q-values for the target task. These transferred Q-values are merged together and used to initialize the learning process of the target task. An interval-based approach is used to represent and merge the knowledge of the source tasks. Empirical results show that the transferred initialization can be beneficial to the learning process of the target task.

Context Transfer in Reinforcement Learning Using Action-Value Functions

PubMed Central

Mousavi, Amin; Nadjar Araabi, Babak; Nili Ahmadabadi, Majid

2014-01-01

This paper discusses the notion of context transfer in reinforcement learning tasks. Context transfer, as defined in this paper, implies knowledge transfer between source and target tasks that share the same environment dynamics and reward function but have different states or action spaces. In other words, the agents learn the same task while using different sensors and actuators. This requires the existence of an underlying common Markov decision process (MDP) to which all the agents' MDPs can be mapped. This is formulated in terms of the notion of MDP homomorphism. The learning framework is Q-learning. To transfer the knowledge between these tasks, the feature space is used as a translator and is expressed as a partial mapping between the state-action spaces of different tasks. The Q-values learned during the learning process of the source tasks are mapped to the sets of Q-values for the target task. These transferred Q-values are merged together and used to initialize the learning process of the target task. An interval-based approach is used to represent and merge the knowledge of the source tasks. Empirical results show that the transferred initialization can be beneficial to the learning process of the target task. PMID:25610457

Generalization of Auditory Sensory and Cognitive Learning in Typically Developing Children.

PubMed

Murphy, Cristina F B; Moore, David R; Schochat, Eliane

2015-01-01

Despite the well-established involvement of both sensory ("bottom-up") and cognitive ("top-down") processes in literacy, the extent to which auditory or cognitive (memory or attention) learning transfers to phonological and reading skills remains unclear. Most research has demonstrated learning of the trained task or even learning transfer to a closely related task. However, few studies have reported "far-transfer" to a different domain, such as the improvement of phonological and reading skills following auditory or cognitive training. This study assessed the effectiveness of auditory, memory or attention training on far-transfer measures involving phonological and reading skills in typically developing children. Mid-transfer was also assessed through untrained auditory, attention and memory tasks. Sixty 5- to 8-year-old children with normal hearing were quasi-randomly assigned to one of five training groups: attention group (AG), memory group (MG), auditory sensory group (SG), placebo group (PG; drawing, painting), and a control, untrained group (CG). Compliance, mid-transfer and far-transfer measures were evaluated before and after training. All trained groups received 12 x 45-min training sessions over 12 weeks. The CG did not receive any intervention. All trained groups, especially older children, exhibited significant learning of the trained task. On pre- to post-training measures (test-retest), most groups exhibited improvements on most tasks. There was significant mid-transfer for a visual digit span task, with highest span in the MG, relative to other groups. These results show that both sensory and cognitive (memory or attention) training can lead to learning in the trained task and to mid-transfer learning on a task (visual digit span) within the same domain as the trained tasks. However, learning did not transfer to measures of language (reading and phonological awareness), as the PG and CG improved as much as the other trained groups. Further research is required to investigate the effects of various stimuli and lengths of training on the generalization of sensory and cognitive learning to literacy skills.

Influence of MgO Barrier Quality on Spin-Transfer Torque in Magnetic Tunnel Junctions

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tiwari, Dhananjay; Sharma, Raghav; Heinonen, O. G.

Here, we studied the bias dependence of spin transfer torque in the MgO-based magnetic tunnel junction using a field-modulated spin torque ferromagnetic resonance measurement technique for three devices with tunneling magnetoresistances (MRs) of 60%, 67%, and 73%, respectively. The devices with a lower MR ratio showed the presence of multiple modes, while the device with higher MR (73%) showed a single resonance mode. We found a lower out-of-plane torkance in our devices compared to the in-plane torkance. The out-of-plane torque is linear with applied bias, while the bias dependence of in-plane torque shows a strong dependence on the MR ratiomore » and hence the barrier quality.« less

Influence of MgO Barrier Quality on Spin-Transfer Torque in Magnetic Tunnel Junctions

DOE PAGES

Tiwari, Dhananjay; Sharma, Raghav; Heinonen, O. G.; ...

2018-01-08

Here, we studied the bias dependence of spin transfer torque in the MgO-based magnetic tunnel junction using a field-modulated spin torque ferromagnetic resonance measurement technique for three devices with tunneling magnetoresistances (MRs) of 60%, 67%, and 73%, respectively. The devices with a lower MR ratio showed the presence of multiple modes, while the device with higher MR (73%) showed a single resonance mode. We found a lower out-of-plane torkance in our devices compared to the in-plane torkance. The out-of-plane torque is linear with applied bias, while the bias dependence of in-plane torque shows a strong dependence on the MR ratiomore » and hence the barrier quality.« less

Ionization and excitation in cool giant stars. I - Hydrogen and helium

NASA Technical Reports Server (NTRS)

Luttermoser, Donald G.; Johnson, Hollis R.

1992-01-01

The influence that non-LTE radiative transfer has on the electron density, ionization equilibrium, and excitation equilibrium in model atmospheres representative of both oxygen-rich and carbon-rich red giant stars is demonstrated. The radiative transfer and statistical equilibrium equations are solved self-consistently for H, H(-), H2, He I, C I, C II, Na I, Mg I, Mg II, Ca I, and Ca II in a plane-parallel static medium. Calculations are made for both radiative-equilibrium model photospheres alone and model photospheres with attached chromospheric models as determined semiempirically with IUE spectra of g Her (M6 III) and TX Psc (C6, 2). The excitation and ionization results for hydrogen and helium are reported.

Platismatia glaucia and Pseudevernia furfuracea lichens as sources of antioxidant, antimicrobial and antibiofilm agents.

PubMed

Mitrovic, Tatjana; Stamenkovic, Slaviša; Cvetkovic, Vladimir; Radulovic, Niko; Mladenovic, Marko; Stankovic, Milan; Topuzovic, Marina; Radojevic, Ivana; Stefanovic, Olgica; Vasic, Sava; Comic, Ljiljana

2014-01-01

The antioxidative, antimicrobial and antibiofilm potentials of acetone, ethyl acetate and methanol extracts of lichen species Platismatia glauca and Pseudevernia furfuracea were evaluated. The phytochemical analysis by GC, GC/MS and NMR revealed caperatic acid, atraric acid, atranorin and chloroatranorin as the predominant compounds in Platismatia glauca. Atraric acid, olivetoric acid, atranorin and chloroatranorin were the major constituents in Pseudevernia furfuracea. The strong antioxidant capacities of the Platismatia glauca and Pseudevernia furfuracea extracts were assessed by their total phenolic and flavonoid contents and DPPH scavenging activities. The methanol extracts of both species exhibited the strongest antioxidant activities with the highest IC50 value for Pseudevernia furfuracea (95.33 µg/mL). The lichen extracts demonstrated important antibacterial activities against 11 bacterial strains with detectable MIC values from 0.08 mg/mL to 2.5 mg/mL for Platismatia glauca and from 0.005 mg/mL to 2.5 mg/mL for Pseudevernia furfuracea. While the antibacterial activities of Pseudevernia furfuracea were solvent-independent, the acetone and ethyl acetate extracts of Platismatia glauca showed higher antibacterial activities compared to its methanol extract. The methanol extracts of both species demonstrated significant antifungal activities against 9 fungal strains with detectable MIC values from 0.04 mg/mL to 2.5 mg/mL. The best antifungal activities were determined against Candida species in Pseudevernia furfuracea extracts with remarkable MIC values which were lower than the MIC values of the positive contol fluconazole. The acetone and ethyl acetate extracts of Platismatia glauca showed better antibiofilm activities on Staphylococcus aureus and Proteus mirabilis with BIC value at 0.63 mg/mL then its methanol extract. On the other hand, the methanol extract of Pseudevernia furfuracea was more potent with BIC value at 1.25 mg/mL on Staphylococcus aureus and 0.63 mg/mL on Proteus mirabilis compared to other types of extracts. Our study indicates a possible use of lichens Platismatia glauca and Pseudevernia furfuracea as natural antioxidants and preservatives in food, pharmaceutical and cosmetic industry.

Platismatia glaucia and Pseudevernia furfuracea lichens as sources of antioxidant, antimicrobial and antibiofilm agents

PubMed Central

Mitrovic, Tatjana; Stamenkovic, Slaviša; Cvetkovic, Vladimir; Radulovic, Niko; Mladenovic, Marko; Stankovic, Milan; Topuzovic, Marina; Radojevic, Ivana; Stefanovic, Olgica; Vasic, Sava; Comic, Ljiljana

2014-01-01

The antioxidative, antimicrobial and antibiofilm potentials of acetone, ethyl acetate and methanol extracts of lichen species Platismatia glauca and Pseudevernia furfuracea were evaluated. The phytochemical analysis by GC, GC/MS and NMR revealed caperatic acid, atraric acid, atranorin and chloroatranorin as the predominant compounds in Platismatia glauca. Atraric acid, olivetoric acid, atranorin and chloroatranorin were the major constituents in Pseudevernia furfuracea. The strong antioxidant capacities of the Platismatia glauca and Pseudevernia furfuracea extracts were assessed by their total phenolic and flavonoid contents and DPPH scavenging activities. The methanol extracts of both species exhibited the strongest antioxidant activities with the highest IC50 value for Pseudevernia furfuracea (95.33 µg/mL). The lichen extracts demonstrated important antibacterial activities against 11 bacterial strains with detectable MIC values from 0.08 mg/mL to 2.5 mg/mL for Platismatia glauca and from 0.005 mg/mL to 2.5 mg/mL for Pseudevernia furfuracea. While the antibacterial activities of Pseudevernia furfuracea were solvent–independent, the acetone and ethyl acetate extracts of Platismatia glauca showed higher antibacterial activities compared to its methanol extract. The methanol extracts of both species demonstrated significant antifungal activities against 9 fungal strains with detectable MIC values from 0.04 mg/mL to 2.5 mg/mL. The best antifungal activities were determined against Candida species in Pseudevernia furfuracea extracts with remarkable MIC values which were lower than the MIC values of the positive contol fluconazole. The acetone and ethyl acetate extracts of Platismatia glauca showed better antibiofilm activities on Staphylococcus aureus and Proteus mirabilis with BIC value at 0.63 mg/mL then its methanol extract. On the other hand, the methanol extract of Pseudevernia furfuracea was more potent with BIC value at 1.25 mg/mL on Staphylococcus aureus and 0.63 mg/mL on Proteus mirabilis compared to other types of extracts. Our study indicates a possible use of lichens Platismatia glauca and Pseudevernia furfuracea as natural antioxidants and preservatives in food, pharmaceutical and cosmetic industry. PMID:26417313

Ferromagnetic alloy material CoFeC with high thermal tolerance in MgO/CoFeC/Pt structure and comparable intrinsic damping factor with CoFeB

NASA Astrophysics Data System (ADS)

Chen, Shaohai; Zhou, Jing; Lin, Weinan; Yu, Jihang; Guo, Rui; Poh, Francis; Shum, Danny; Chen, Jingsheng

2018-02-01

The thermal tolerance and perpendicular magnetic anisotropy (PMA) of ferromagnetic alloy Co40Fe40C20 in the structure MgO/CoFeC/Pt (or Ta) were investigated and compared with the commonly used CoFeB alloy. It is found that the PMA of CoFeC with {{K}i,CoFeC}=2.21 erg c{{m}-2} , which is 59% higher than that of CoFeB, can be obtained after proper post-annealing treatment. Furthermore, CoFeC alloy provides better thermal tolerance to temperature of 400 °C than CoFeB. The studies on ferromagnetic resonance show that the intrinsic damping constant α in of Co40Fe40C20 alloy is 0.0047, which is similar to the reported value of 0.004 for Co40Fe40B20 alloy. The comprehensive comparisons indicate that CoFeC alloy is a promising candidate for the application of the integration of spin torque transfer magnetic random access memory with complementary metal-oxide semiconductor processes.

Electroreduction of Cr(VI) to Cr(III) on reticulated vitreous carbon electrodes in a parallel-plate reactor with recirculation.

PubMed

Rodriguez-Valadez, Francisco; Ortiz-Exiga, Carlos; Ibanez, Jorge G; Alatorre-Ordaz, Alejandro; Gutierrez-Granados, Silvia

2005-03-15

The reduction of Cr(VI) to Cr(III) is achieved in a flow-by, parallel-plate reactor equipped with reticulated vitreous carbon (RVC) electrodes;this reduction can be accomplished by the application of relatively small potentials. Treatment of synthetic samples and field samples (from an electrodeposition plant) results in final Cr(VI) concentrations of 0.1 mg/L (i.e., the detection limit of the UV-vis characterization technique used here) in 25 and 43 min, respectively. Such concentrations comply with typical environmental legislation for wastewaters that regulate industrial effluents (at presenttime = 0.5 mg/L for discharges). The results show the influence of the applied potential, pH, electrode porosity, volumetric flow, and solution concentration on the Cr(VI) reduction percentage and on the required electrolysis time. Values for the mass transfer coefficient and current efficiencies are also obtained. Although current efficiencies are not high, the fast kinetics observed make this proposed treatment an appealing alternative. The lower current efficiency obtained in the case of a field sample is attributed to electrochemical activation of impurities. The required times for the reduction of Cr(VI) are significantly lower than those reported elsewhere.

Field-current phase diagrams of in-plane spin transfer torque memory cells with low effective magnetization storage layers

DOE Office of Scientific and Technical Information (OSTI.GOV)

San Emeterio Alvarez, L.; Lacoste, B.; Rodmacq, B.

2014-05-07

Field-current phase diagrams were measured on in-plane anisotropy Co{sub 60}Fe{sub 20}B{sub 20} magnetic tunnel junctions to obtain the spin transfer torque (STT) field-current switching window. These measurements were used to characterise junctions with varying free layer thicknesses from 2.5 down to 1.1 nm having a reduced effective demagnetizing field due to the perpendicular magnetic anisotropy at CoFeB/MgO interface. Diagrams were obtained with 100 ns current pulses, of either same or alternating polarity. When consecutive pulses have the same polarity, it is possible to realize the STT switching even for conditions having a low switching probability. This was evidenced in diagrams with consecutivemore » pulses of alternating polarity, with 100% switching obtained at 4.7 MA/cm{sup 2}, compared to the lower 3.4 MA/cm{sup 2} value for same polarity pulses. Although the low level of the current density window is higher in alternating polarity diagrams, the field window in both diagrams is the same and therefore independent of the pulse polarity sequence.« less

miktoarm polymer: controlled synthesis, characterization, and application as anticancer drug carrier

NASA Astrophysics Data System (ADS)

Lin, Wenjing; Nie, Shuyu; Xiong, Di; Guo, Xindong; Wang, Jufang; Zhang, Lijuan

2014-05-01

Amphiphilic A2(BC)2 miktoarm star polymers [poly(ɛ-caprolactone)]2-[poly(2-(diethylamino)ethyl methacrylate)- b- poly(poly(ethylene glycol) methyl ether methacrylate)]2 [(PCL)2(PDEA- b-PPEGMA)2] were developed by a combination of ring opening polymerization (ROP) and continuous activators regenerated by electron transfer atom transfer radical polymerization (ARGET ATRP). The critical micelle concentration (CMC) values were extremely low (0.0024 to 0.0043 mg/mL), depending on the architecture of the polymers. The self-assembled empty and doxorubicin (DOX)-loaded micelles were spherical in morphologies, and the average sizes were about 63 and 110 nm. The release of DOX at pH 5.0 was much faster than that at pH 6.5 and pH 7.4. Moreover, DOX-loaded micelles could effectively inhibit the growth of cancer cells HepG2 with IC50 of 2.0 μg/mL. Intracellular uptake demonstrated that DOX was delivered into the cells effectively after the cells were incubated with DOX-loaded micelles. Therefore, the pH-sensitive (PCL)2(PDEA- b-PPEGMA)2 micelles could be a prospective candidate as anticancer drug carrier for hydrophobic drugs with sustained release behavior.

[Cystatin C and other cardiovascular markers in hypertension].

PubMed

Rodilla, Enrique; Costa, José A; Pérez Lahiguera, Francisco; González, Carmen; Miralles, Amparo; Pascual, José M

2008-01-19

The aim of the study was to assess the relationship of cystatine C to other cardiovascular risk factors in hypertension. Cross-sectional study in hypertensive outpatients with normal creatinine values (< 1.6 mg/dl for males and < 1.4 mg/dl for women). Cystatin C was analyzed by immunonephelometry. 283 patients (47% male) were evaluated. Cystatin C values were 0.65 (0.27) mg/l (median, intercuartile range, percentile 70 = 0.76 mg/l), and were correlated to the estimated glomerular filtration rate (GFR) (ml/min/1.73 m(2)), C reactive protein, and urinary albumin excretion (UAE). In multiple regression analysis the GFR was the most significant factor and explained 38% of cystatine C variability. GFR, (odds ratio [OR] = 5.84; 95% confidence interval [CI], 2.27-15.03; p < 0.001), age (OR = 1.05; 95% CI, 1.02-1.08; p < 0.001), and CRP (OR = 2.03; 95% CI, 1.07-3.84; p = 0.03), but not UAE > or = 30 mg/24 h, were independent factors related to the presence of high levels (> 0.76 mg/l) of cystatine C in a logistic regression analysis. 58% of patients with UAE > or = 30 mg/24h had cystatin C values < 0,76 mg/l. In hypertensive patients, the GFR is the most important factor related to cystatine C values. Increased levels of cystatine C do not correspond to UAE augmentation.

Love and Hate in University Technology Transfer: Examining Faculty and Staff Conflicts and Ethical Issues

ERIC Educational Resources Information Center

Hamilton, Clovia; Schumann, David

2016-01-01

With respect to university technology transfer, the purpose of this paper is to examine the literature focused on the relationship between university research faculty and technology transfer office staff. We attempt to provide greater understanding of how research faculty's personal values and research universities' organization values may differ…

26 CFR 20.2013-3 - “Second limitation”.

Code of Federal Regulations, 2014 CFR

2014-04-01

... computed by subtracting from the present decedent's gross estate the value of the property transferred (see... transferred property (see § 20.2013-4)) bears to H (the value of the present decedent's gross estate reduced... limitation”. (a) The amount of the Federal estate tax attributable to the transferred property in the present...

75 FR 8889 - Hydrogen Sulfide; Community Right-to-Know Toxic Chemical Release Reporting

Federal Register 2010, 2011, 2012, 2013, 2014

2010-02-26

... ecotoxicity studies have been conducted on hydrogen sulfide, mainly on freshwater invertebrates and fish... values for freshwater invertebrates ranged from 0.021 mg/L (amphipod) to 1.07 mg/L (isopod), and 48- to 96- hour LC 50 values for estuarine/marine invertebrates ranged from 0.063 mg/L (saltwater shrimp) to...

Hemolysis and cytotoxicity mechanisms of biodegradable magnesium and its alloys.

PubMed

Zhen, Zhen; Liu, Xiaoli; Huang, Tao; Xi, TingFei; Zheng, Yufeng

2015-01-01

Good hemocompatibility and cell compatibility are essential requirements for coronary stents, especially for biodegradable magnesium alloy stents, which could change the in situ environment after implanted. In this work, the effects of magnesium ion concentration and pH value on the hemolysis and cytotoxicity have been evaluated. Solution with different Mg(2+) concentration gradients and pH values of normal saline and cell culture media DMEM adjusted by MgCl2 and NaOH respectively were tested for the hemolysis and cell viability. Results show that even when the concentration of Mg(2+) reaches 1000 μg/mL, it has little destructive effect on erythrocyte, and the high pH value over 11 caused by the degradation is the real reason for the high hemolysis ratio. Low concentrations of Mg(2+) (<100 μg/mL) cause no cytotoxicity to L929 cells, of which the cell viability is above 80%, while high concentrations of Mg(2+) (>300 μg/mL) could induce obvious death of the L929 cells. The pH of the extract plays a synergetic effect on cytotoxicity, due to the buffer action of the cell culture medium. To validate this conclusion, commercial pure Mg using normal saline and PBS as extract was tested with the measurement of pH and Mg(2+) concentration. Pure Mg leads to a higher hemolysis ratio in normal saline (47.76%) than in buffered solution (4.38%) with different pH values and low concentration of Mg(2+). The Mg extract culture media caused no cytotoxicity, with pH=8.44 and 47.80 μg/mL Mg(2+). It is suggested that buffered solution and dynamic condition should be adopted in the hemolysis evaluation. Copyright © 2014. Published by Elsevier B.V.

Social disadvantages associated with myasthenia gravis and its treatment: a multicentre cross-sectional study.

PubMed

Nagane, Yuriko; Murai, Hiroyuki; Imai, Tomihiro; Yamamoto, Daisuke; Tsuda, Emiko; Minami, Naoya; Suzuki, Yasushi; Kanai, Tetsuya; Uzawa, Akiyuki; Kawaguchi, Naoki; Masuda, Masayuki; Konno, Shingo; Suzuki, Hidekazu; Aoki, Masashi; Utsugisawa, Kimiaki

2017-02-23

To clarify the social disadvantages associated with myasthenia gravis (MG) and examine associations with its disease and treatment. Cross-sectional study. We evaluated 917 consecutive cases of established MG seen at 13 neurological centres in Japan over a short duration. All patients completed a questionnaire on social disadvantages resulting from MG and its treatment and a 15-item MG-specific quality of life scale at study entry. Clinical severity at the worst condition was graded according to the MG Foundation of America classification, and that at the current condition was determined according to the quantitative MG score and MG composite. Maximum dose and duration of dose ≥20 mg/day of oral prednisolone during the disease course were obtained from the patients' medical records. Achievement of the treatment target (minimal manifestation status with prednisolone at ≤5 mg/day) was determined at 1, 2 and 4 years after starting treatment and at study entry. We found that 27.2% of the patients had experienced unemployment, 4.1% had been unwillingly transferred and 35.9% had experienced a decrease in income, 47.1% of whom reported that the decrease was ≥50% of their previous total income. In addition, 49.0% of the patients reported feeling reduced social positivity. Factors promoting social disadvantages were severity of illness, dose and duration of prednisolone, long-term treatment, and a depressive state and change in appearance after treatment with oral steroids. Early achievement of the treatment target was a major inhibiting factor. Patients with MG often experience unemployment, unwilling job transfers and a decrease in income. In addition, many patients report feeling reduced social positivity. To inhibit the social disadvantages associated with MG and its treatment, greater focus needs to be placed on helping patients with MG resume a normal lifestyle as soon as possible by achieving the treatment target. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

Unraveling the Environmental Record of the Early Solar System: High Precision Laser Ablation Al-Mg Isotopes of Igneous CAIs

NASA Astrophysics Data System (ADS)

Young, E. D.; Simon, J. I.; Russell, S. S.; Tonui, E.; Krot, A.

2004-12-01

Variations in intrinsic Mg isotope compositions provide a potentially rich record of the physiochemical evolution of CAIs. Moreover, Mg excesses from the short-lived 26Al chronometer can be used to constrain when these processes occurred; e.g., during the nebular phase and/or during the development of planetisimals (< 4 Myr). We obtained in situ UV (213 nm) laser ablation MC-ICPMS measurements of Al and Mg isotope ratios within core-to-rim traverses of igneous CAIs to place temporal constraints on when features of CAIs formed. Results provide tests of models for the chemical and isotopic evolution of CAIs involving volatilization and recondensation of elements in the solar nebula. We studied five CV3 CAIs, including Allende 3576-1 "b", Allende M5, Leoville 144A, Leoville MRS3, and Efremovka E44. Our sample-standard comparison approach affords a precision <0.2 \\permil per amu (2s) for intrinsic Mg isotope measurements and <0.3 \\permil (2s) for measured 26Mg excesses. Intra-object variation in \\delta25Mg exists with values ranging from as low as -2 \\permil and as high as +8 \\permil (compared to DSM3). The distinct Mg isotope patterns in the CAIs are difficult to explain by a single process or within a single nebular environment and likely require changing conditions or transfer of CAIs from one nebular environment to another. The ˜pristine Mg isotope profile of Leoville 144A is compared to results produced by implicit finite difference modeling. Model curves reflect isotopic fractionation at the moving surface of a shrinking molten sphere coupled with diffusion-limited transport within the sphere. We find that using mass-dependant diffusivities increases \\delta25Mg with evaporation, but does not produce the tight curvature in the edgeward increases in \\delta25Mg characteristic of Leoville 144A. Three CAIs that exhibit edgeward \\delta25Mg decreases are well described by diffusion in a Mg-rich chondritic environment suggestive of nebular temperatures and timescales on order of 100 yrs at 1300 K (temperatures <900 K require heating times >2 Myr, and are improbable for parent body thermal histories). We concluded that: (1) CAIs exhibit enriched \\delta25Mg interiors that require evaporation of molten spheres in low total pressures, and/or low Mg partial pressure environments and systematic edgeward mineral independent intrinsic Mg isotope variations (-2 to +8 \\permil per amu) that require multiple evolutionary steps, (2) Isotopic profile measurements are accompanied by excess 26Mg and thus support a nebular origin for their development, (3) After initial isotopic enrichment CAIs undergo at least two divergent thermal histories as demonstrated by the two distinctive groups of Mg isotope profiles and their Al-Mg chronologies, and (4) Wark-Lovering rims are condensates from a nebular gas of chondritic or subchondritic Mg isotope composition that grew while 26Al was still extant.

Transport and spin transfer torques in Fe/MgO/Fe tunnel barriers.

NASA Astrophysics Data System (ADS)

Heiliger, Christian

2008-03-01

The prediction of very high tunneling magnetoresistance (TMR) ratios in crystalline Fe/MgO/Fe [1,2] tunnel junctions has been verified by a number of experiments [3,4]. The high TMR can be understood in terms of the electronic structure of the system. In MgO the δ1 states at the Brillouin zone center decay the most slowly and dominate the tunnelling current. For coherent interfaces, which are achievable due to the small lattice mismatch between Fe and MgO, these δ1 states at the Brillouin zone center are half-metallic in the Fe layers. The dominance of the δ1 states and their half-metallicity cause the high tunnelling magnetoresistance measured in Fe/MgO/Fe tunnel junctions [5]. For the spin transfer torque, we calculate the linear response for small currents and voltages. Our calculations show that the half metallicity of the Fe δ1 states leads to a strong localization of the spin transfer torque to the interface. As a result, the linear current dependence of the torque in the plane of the two magnetizations is independent of the free layer thickness for more than three monolayers of Fe. For perfect samples we also find a linear current dependence of the out-of-plane component. However, this linear piece oscillates rapidly with thickness and averages to zero in the presence of structural imperfections like thickness fluctuation, in agreement with experiment [6]. In this talk I discuss the bias dependence of the TMR and spin transfer torque effects mentioned above and the influence on them of the following factors: the interface structure Fe/MgO, the barrier thickness, and the structure of the leads [7]. This work has been supported in part by the NIST-CNST/UMD-NanoCenter Cooperative Agreement. [1] W. Butler, X.-G. Zhang, T. Schulthess, J. MacLaren, Phys. Rev. B 63 (2001) 054416. [2] J. Mathon, A. Umerski, Phys. Rev. B 63 (2001) 220403. [3] S. Yuasa, T. Nagahama, A. Fukushima, Y. Suzuki, K. Ando, Nature Materials 3 (2004) 868. [4] S.S.P. Parkin, C. Kaiser, A. Panchula, P.M. Rice, B. Hughes, M. Samant, S.-H. Yang Nature Materials 3 (2004) 862. [5] C. Heiliger, P. Zahn, I. Mertig, Materials Today 9 (2006) 46. [6] J. C. Sankey, P. M. Braganca, A. G. F. Garcia, I. N. Krivorotov, R. A. Buhrman, and D. C. Ralph, Phys. Rev. Lett. 96 (2006) 227601. [7] C. Heiliger, M.Gradhand, P. Zahn, I. Mertig, Phys. Rev. Lett. 99 (2007) 066804.

Validating a method for transferring social values of ecosystem services between public lands in the Rocky Mountain region

USGS Publications Warehouse

Sherrouse, Benson C.; Semmens, Darius J.

2014-01-01

With growing pressures on ecosystem services, social values attributed to them are increasingly important to land management decisions. Social values, defined here as perceived values the public ascribes to ecosystem services, particularly cultural services, are generally not accounted for through economic markets or considered alongside economic and ecological values in ecosystem service assessments. Social-values data can be elicited through public value and preference surveys; however, limitations prevent them from being regularly collected. These limitations led to our three study objectives: (1) demonstrate an approach for applying benefit transfer, a nonmarket-valuation method, to spatially explicit social values; (2) validate the approach; and (3) identify potential improvements. We applied Social Values for Ecosystem Services (SolVES) to survey data for three national forests in Colorado and Wyoming. Social-value maps and models were generated, describing relationships between the maps and various combinations of environmental variables. Models from each forest were used to estimate social-value maps for the other forests via benefit transfer. Model performance was evaluated relative to the locally derived models. Performance varied with the number and type of environmental variables used, as well as differences in the forests' physical and social contexts. Enhanced metadata and better social-context matching could improve model transferability.

Carbon budget of sea-ice algae in spring: Evidence of a significant transfer to zooplankton grazers

NASA Astrophysics Data System (ADS)

Michel, C.; Legendre, L.; Ingram, R. G.; Gosselin, M.; Levasseur, M.

1996-08-01

The fate of ice-bottom algae, before and after release from the first-year sea ice into the water column, was assessed during the period of ice-algal growth and decline in Resolute Passage (Canadian Arctic). During spring 1992 (from April to June), algae in the bottom ice layer and those suspended and sinking in the upper water column (top 15 m) were sampled approximately every 4 days. Ice-bottom chlorophyll a reached a maximum concentration of 160 mg m-2 in mid-May, after which it decreased to lower values. In the water column, chlorophyll a concentrations were low until the period of ice-algal decline (˜0.1 mg m-3), with most biomass in the <5-μm fraction. In both the suspended and sinking material, large increases of algal biomass occurred at the beginning of June, following the release of ice-algae into the water column. The input of ice-algal derived carbon to the upper water column and the proportions exported through sinking or remaining in suspension were assessed using a carbon budget for the two periods of ice-algal growth and decline. For each period the output terms closely balanced the input. The carbon budget showed that most of the biomass introduced into the upper water column remained suspended (>65% of total export) and that ice-algae were ingested by under-ice grazers after release from the ice. These results stress the importance of ice algae for pelagic consumers during the early stages of ice melt and show that the transfer of ice algae to higher trophic levels extends beyond the period of maximum algal production in the ice bottom.

Moisture transfer from stopper to product and resulting stability implications.

PubMed

Pikal, M J; Shah, S

1992-01-01

Since the stability of a freeze-dried product is often sensitive to the level of moisture, control of residual moisture by attention to the secondary drying phase of the freeze-drying process is of considerable importance. However, several reports in the literature as well as our own experience suggest that low residual moisture immediately after manufacture does not ensure low moisture throughout the shelf life of the product. Equilibration of the product with moisture in the stopper can lead to significant increases in product water content. This research is a study of the kinetic and equilibrium aspects of moisture transfer from stopper to product at 5 degrees C, 25 degrees C, and 40 degrees C for two amorphous materials: vancomycin (highly hygroscopic) and lactose (moderately hygroscopic). Stoppers are 13 mm butyl rubber (#1816, West Co.) slotted freeze-drying stoppers which were studied: (a) "U"-with no treatment; (b) "SV1"-steam-sterilized followed by 1 hr vacuum drying; and (c) "SV8"-steam sterilized followed by 8 hrs vacuum drying. No evidence was found for moisture transmission through the stopper. Rather, the product moisture content increases with time and reaches an apparent equilibrium value characteristic of the product, amount of product, and stopper treatment method ("SV1" much greater than "U" greater than "SV1"). As a first approximation, the rate of approach to "equilibrium" depends only on temperature (t1/2 approximately 10 months at 5 degrees C to approximately 4 days at 40 degrees C) with the "equilibrium" water content being independent of temperature. The "equilibrium" moisture content increases as the dose decreases and is larger for vancomycin than for lactose. The "equilibrium" moisture contents range from 5.0% (25 mg vancomycin, "SV1" stoppers) to 0.68% (100 mg lactose, "SV8" stoppers).

Evaluation of generalized heat-transfer coefficients in pilot AFBC units

DOE Office of Scientific and Technical Information (OSTI.GOV)

Grewal, N.S.

Experimental data for heat transfer rates as obtained in a 0.209m/sup 2/ AFBC unit at the GFETC is examined in the light of the existing four correlations for heat transfer coefficient between an immersed staggered array of horizontal tubes and a gas-solid fluidized bed. The predicted values of heat transfer coefficient from the correlations proposed by Grewal and Bansal are found to be in good agreement with the experimental values of heat transfer coefficient when the contribution due to radiation is also included.

Evaluation of generalized heat transfer coefficients in pilot AFBC units

DOE Office of Scientific and Technical Information (OSTI.GOV)

Grewal, N.S.

Experimental data for heat transfer rates as obtained in a 0.209m/sup 2/ AFBC unit at the GFETC is examined in the light of the existing four correlations for heat transfer coefficient between an immersed staggered array of horizontal tubes and a gas-solid fluidized bed. The predicted values of heat transfer coefficient from the correlations proposed by Grewal and Bansal are found to be in good agreement with the experimental values of heat transfer coefficient when the contribution due to radiation is also included.

A Parameter Study for Modeling Mg ii h and k Emission during Solar Flares

DOE Office of Scientific and Technical Information (OSTI.GOV)

Rubio da Costa, Fatima; Kleint, Lucia, E-mail: frubio@stanford.edu

2017-06-20

Solar flares show highly unusual spectra in which the thermodynamic conditions of the solar atmosphere are encoded. Current models are unable to fully reproduce the spectroscopic flare observations, especially the single-peaked spectral profiles of the Mg ii h and k lines. We aim to understand the formation of the chromospheric and optically thick Mg ii h and k lines in flares through radiative transfer calculations. We take a flare atmosphere obtained from a simulation with the radiative hydrodynamic code RADYN as input for a radiative transfer modeling with the RH code. By iteratively changing this model atmosphere and varying thermodynamicmore » parameters such as temperature, electron density, and velocity, we study their effects on the emergent intensity spectra. We reproduce the typical single-peaked Mg ii h and k flare spectral shape and approximate the intensity ratios to the subordinate Mg ii lines by increasing either densities, temperatures, or velocities at the line core formation height range. Additionally, by combining unresolved upflows and downflows up to ∼250 km s{sup −1} within one resolution element, we reproduce the widely broadened line wings. While we cannot unambiguously determine which mechanism dominates in flares, future modeling efforts should investigate unresolved components, additional heat dissipation, larger velocities, and higher densities and combine the analysis of multiple spectral lines.« less

Effects of F-treatment on degradation of Mg 2Ni electrode fabricated by mechanical alloying

NASA Astrophysics Data System (ADS)

Kim, Jun Sung; Lee, Chang Rae; Choi, Jae Woong; Kang, Sung Goon

The effects of surface fluorination on the electrochemical charge-discharge properties of a Mg 2Ni electrode, prepared by mechanical alloying in Ni-MH batteries are investigated. After 20 h milling, Mg and Ni powder form nanocrystalline Mg 2Ni. The discharge capacity of this alloy increases greatly on the initial cycle but, due to the formation of a Mg(OH) 2 passive layer, displays rapid degradation in alkaline solution within 10 cycles. In a 6 M KOH+ x M KF electrolyte ( x=0.5, 1, and 2), a continuous and stable fluorinated layer is formed and the durability of the Mg 2Ni electrode increases marketly and a high rate discharge capability is obtained (90-100 mAh/g). Addition of 2 M KF leads to the highest durability of all the electrodes tested. The improvement is due to a thin MgF 2—flourinated layer, which reduces the charge-transfer resistance and protects the Mg 2Ni electrode from forming a Mg(OH) 2 layer.

The relationships between content of heavy metals in soil and in strawberries.

PubMed

Bystricka, Judita; Musilova, Janette; Trebichalsky, Pavol; Tomas, Jan; Stanovic, Radovan; Bajcan, Daniel; Kavalcova, Petra

2016-01-01

The work was aimed at assessment of quality of strawberry based on the contents of heavy metals as well as the possible correlations between selected heavy metals in soil and strawberries. The results revealed that from all observed metals in soil determined in aqua regia only in the case of cadmium the maximum permissible limit in comparison with the limit resulting from the Law No. 220/2004 as well as threshold values proposed by European Commission (EC) (2006) has been exceeded. In our paper the values of cadmium in the soil representing 1.86 to 2.41 times higher values than limit valid in the Slovak Republic (0.7 mg/kg) and 2.6 to 3.38 times higher in comparison to EC (0.5 mg/kg). In our study in 1 M NH4NO3 the values of lead ranged from 0.125 to 0.205 mg/kg representing values exceeded the limit valid in Slovak Republic (0.1 mg/kg) about 0.037-0.105 mg/kg. Despite exceeded values of heavy metals in soil, no values above the limit directly in strawberries when compared to Food Codex of Slovak Republic as well as to Commission Regulation 1881/2006 were recorded. Among the varieties statistically significant differences (P < 0.05) in intake of heavy metals were found.

Epidemiological cut-off values for Flavobacterium psychrophilum MIC data generated by a standard test protocol.

PubMed

Smith, P; Endris, R; Kronvall, G; Thomas, V; Verner-Jeffreys, D; Wilhelm, C; Dalsgaard, I

2016-02-01

Epidemiological cut-off values were developed for application to antibiotic susceptibility data for Flavobacterium psychrophilum generated by standard CLSI test protocols. The MIC values for ten antibiotic agents against Flavobacterium psychrophilum were determined in two laboratories. For five antibiotics, the data sets were of sufficient quality and quantity to allow the setting of valid epidemiological cut-off values. For these agents, the cut-off values, calculated by the application of the statistically based normalized resistance interpretation method, were ≤16 mg L(-1) for erythromycin, ≤2 mg L(-1) for florfenicol, ≤0.025 mg L(-1) for oxolinic acid (OXO), ≤0.125 mg L(-1) for oxytetracycline and ≤20 (1/19) mg L(-1) for trimethoprim/sulphamethoxazole. For ampicillin and amoxicillin, the majority of putative wild-type observations were 'off scale', and therefore, statistically valid cut-off values could not be calculated. For ormetoprim/sulphadimethoxine, the data were excessively diverse and a valid cut-off could not be determined. For flumequine, the putative wild-type data were extremely skewed, and for enrofloxacin, there was inadequate separation in the MIC values for putative wild-type and non-wild-type strains. It is argued that the adoption of OXO as a class representative for the quinolone group would be a valid method of determining susceptibilities to these agents. © 2014 John Wiley & Sons Ltd.

Exciplex formation and energy transfer in a self-assembled metal-organic hybrid system.

PubMed

Haldar, Ritesh; Rao, K Venkata; George, Subi J; Maji, Tapas Kumar

2012-05-07

Exciting assemblies: A metal-organic self-assembly of pyrenebutyric acid (PBA), 1,10-phenanthroline (o-phen), and Mg(II) shows solid-state fluorescence originating from a 1:1 PBA-o-phen exciplex. This exciplex fluorescence is sensitized by another residual PBA chromophore through an excited-state energy-transfer process. The solvent polarity modulates the self-assembly and the corresponding exciplex as well as the energy transfer, resulting in tunable emission of the hybrid (see figure). Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Measurement of Lactate Content and Amide Proton Transfer Values in the Basal Ganglia of a Neonatal Piglet Hypoxic-Ischemic Brain Injury Model Using MRI.

PubMed

Zheng, Y; Wang, X-M

2017-04-01

As amide proton transfer imaging is sensitive to protein content and intracellular pH, it has been widely used in the nervous system, including brain tumors and stroke. This work aimed to measure the lactate content and amide proton transfer values in the basal ganglia of a neonatal piglet hypoxic-ischemic brain injury model by using MR spectroscopy and amide proton transfer imaging. From 58 healthy neonatal piglets (3-5 days after birth; weight, 1-1.5 kg) selected initially, 9 piglets remained in the control group and 43 piglets, in the hypoxic-ischemic brain injury group. Single-section amide proton transfer imaging was performed at the coronal level of the basal ganglia. Amide proton transfer values of the bilateral basal ganglia were measured in all piglets. The ROI of MR spectroscopy imaging was the right basal ganglia, and the postprocessing was completed with LCModel software. After hypoxic-ischemic insult, the amide proton transfer values immediately decreased, and at 0-2 hours, they remained at their lowest level. Thereafter, they gradually increased and finally exceeded those of the control group at 48-72 hours. After hypoxic-ischemic insult, the lactate content increased immediately, was maximal at 2-6 hours, and then gradually decreased to the level of the control group. The amide proton transfer values were negatively correlated with lactate content ( r = -0.79, P < .05). This observation suggests that after hypoxic-ischemic insult, the recovery of pH was faster than that of lactate homeostasis. © 2017 by American Journal of Neuroradiology.

Diamond growth from oxidized carbon sources beneath the Northern Slave Craton, Canada: A δ 13C-N study of eclogite-hosted diamonds from the Jericho kimberlite

NASA Astrophysics Data System (ADS)

Smart, Katie A.; Chacko, Thomas; Stachel, Thomas; Muehlenbachs, Karlis; Stern, Richard A.; Heaman, Larry M.

2011-10-01

Diamonds from high- and low-MgO groups of eclogite xenoliths from the Jericho kimberlite, Slave Craton, Canada were analyzed for carbon isotope compositions and nitrogen contents. Diamonds extracted from the two groups show remarkably different nitrogen abundances and δ 13C values. While diamonds from high-MgO eclogites have low nitrogen contents (5-82 ppm) and extremely low δ 13C values clustering at ˜-40‰, diamonds from the low-MgO eclogites have high nitrogen contents (>1200 ppm) and δ 13C values from -3.5‰ to -5.3‰. Coupled cathodoluminescence (CL) imaging and SIMS analysis of the Jericho diamonds provides insight into diamond growth processes. Diamonds from the high-MgO eclogites display little CL structure and generally have constant δ 13C values and nitrogen contents. Some of these diamonds have secondary rims with increasing δ 13C values from -40‰ to ˜-34‰, which suggests secondary diamond growth occurred from an oxidized growth medium. The extreme negative δ 13C values of the high-MgO eclogite diamonds cannot be produced by Rayleigh isotopic fractionation of average mantle-derived carbon (-5‰) or carbon derived from typical organic matter (˜-25‰). However, excursions in δ 13C values to -60‰ are known in the organic sedimentary record at ca. 2.7 and 2.0 Ga, such that diamonds from the high-MgO eclogites could have formed from similar organic matter brought into the Slave lithospheric mantle by subduction. SIMS analyses of a diamond from a low-MgO eclogite show an outer core with systematic rimwards increases in δ 13C values coupled with decreases in nitrogen contents, and a rim with pronounced alternating growth zones. The coupled δ 13C-nitrogen data suggest that the diamond precipitated during fractional crystallization from an oxidized fluid/melt from which nitrogen was progressively depleted during growth. Model calculations of the co-variation of δ 13C-N yielded a partition coefficient ( KN) value of 5, indicating that nitrogen is strongly compatible in diamond relative to the growth medium. δ 13C values of diamond cores (-4‰) dictate the growth medium had higher δ 13C values than primary mantle-derived carbon. Therefore, possible carbon sources for the low-MgO eclogite diamonds include oxidized mantle-derived (e.g. protokimberlite or carbonatite) fluids/melts that underwent some fractionation during migration or, devolatilized subducted carbonates.

A Long-Term Comparison of GPS Carrierphase Frequency Transfer and Two-Way Satellite Time/Frequency Transfer

DTIC Science & Technology

2007-01-01

and frequency transfer ( TWSTFT ) were performed along three transatlantic links over the 6-month period 29 January – 31 July 2006. The GPSCPFT and... TWSTFT results were subtracted in order to estimate the combined uncertainty of the methods. The frequency values obtained from GPSCPFT and TWSTFT ...values were equal to or less than the frequency-stability values σy(GPSCPFT) – y( TWSTFT ) (τ) (or TheoBR (τ)) computed for the corresponding averaging

Pavlovian-Instrumental Transfer of the Discriminative Stimulus Effects of Nicotine and Ethanol in Rats

ERIC Educational Resources Information Center

Troisi, Joseph R., II

2006-01-01

To date, only 1 study has evaluated the impact of a Pavlovian drug conditional stimulus (CS) on operant responding. A within-subject operant 1-lever go/no-go (across sessions) design was used to evaluate the impact of Pavlovian contingencies on the discriminative stimulus effects of nicotine (0.4 mg/kg) and ethanol (800 mg/kg) in male Sprague…

Marine Fouling and Thermal Dissipation of Undersea Wireless Power Transfer

DTIC Science & Technology

2014-09-01

Warfare Systems Center Pacific (SSC Pacific), San Diego, CA. The Naval Innovative Science and Engineering (NISE) Program at SSC Pacific funded this team...FLIR Systems , Inc. MG Chemicals® is registered trademarks of MG Chemicals Ltd. Released by J. Spenser, Head Radiation Technologies Branch...Under authority of M. H. Berry. Head Maritime Systems Division iii EXECUTIVE SUMMARY This report describes the thermal effects and marine

Hemodynamic effects of L-threo-3,4-dihydroxyphenylserine (Droxidopa) in hypotensive individuals with spinal cord injury.

PubMed

Wecht, Jill M; Rosado-Rivera, Dwindally; Weir, Joseph P; Ivan, Adrian; Yen, Christina; Bauman, William A

2013-10-01

To determine the effect of an escalating dose of droxidopa (100, 200, and 400 mg) compared with placebo on seated blood pressure (BP) in hypotensive individuals with spinal cord injury (SCI). Secondarily, we aimed to determine the effect of droxidopa on (1) supine BP and heart rate, (2) the change in BP and heart rate when these individuals were transferred from the supine to the seated position, and (3) adverse event (AE) reporting. Open-label dose titration trial. A Veterans Administration Medical Center. Participants with SCI (C3-T12) (N=10) were studied during 4 laboratory visits. Subjects visited the laboratory for about 5 hours on each visit, which incorporated a 30-minute seated baseline, a 30- to 60-minute supine, and a 4-hour seated postdrug observation. Placebo on visit 1, droxidopa 100 mg on visit 2, droxidopa 200 mg on visit 3, and droxidopa 400 mg on visit 4. BP and heart rate changes from baseline to the postdrug period, orthostatic heart rate and BP responses, and subjective AE reporting. Seated BP was significantly elevated with 400 mg droxidopa compared with placebo and 100 mg droxidopa for 3 hours and was elevated for 2 hours compared with 200 mg droxidopa. Increase in supine BP was not worsened following droxidopa, and the expected fall in BP when transferred to the seated position was prevented with droxidopa 200 and 400 mg. There were no significant differences in the heart rate response or AE reporting among the study visits. Our preliminary findings suggest that droxidopa, at the doses tested, does not cause excessive increases in supine BP and the 400-mg dose appears to be effective at increasing seated BP for up to 3 hours in persons with SCI. Copyright © 2013 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

Growth and band gap of the filled tetrahedral semiconductor LiMgN

NASA Astrophysics Data System (ADS)

Kuriyama, K.; Nagasawa, K.; Kushida, K.

2002-04-01

The cubic AlN-like compound, LiMgN, can be considered as a zinc blende-like (MgN) - lattice partially filled with He-like Li + interstitials. LiMgN was synthesized by direct reaction between N 2 and LiMg alloy at around 800°C for 8 h. Polycrystalline crystals are grown as cornflake-like shapes with a light yellow color and show the LiMgN-phase (the lattice constant a=4.955±0.005 Å) except for non-reactant LiMg and oxide (LiNO 3). The ordered structure between Li and Mg is not confirmed exactly by X-ray diffraction studies. The band gap of as-grown crystals evaluated using photoacoustic spectroscopy is 3.2 eV, which value is supported by an optical transmission spectrum. The band gap value of LiMgN is close to that of GaN (zinc blende, Eg=3.45 eV).

Assessing the Blood Supply Status of the Focal Ground-Glass Opacity in Lungs Using Spectral Computed Tomography.

PubMed

Liu, Guanfu; Li, Mengying; Li, Guosheng; Li, Zhiyong; Liu, Ailian; Pu, Renwang; Cao, Huizhi; Liu, Yijun

2018-01-01

To exploit material decomposition analysis in dual-energy spectral computed tomography (CT) to assess the blood supply status of the ground-glass opacity (GGO) in lungs. This retrospective study included 48 patients with lung adenocarcinoma, who underwent a contrast-enhanced dual-energy spectral CT scan before treatment (53 GGOs in total). The iodine concentration (IC) and water content (WC) of the GGO, the contralateral and ipsilateral normal lung tissues were measured in the arterial phase (AP) and their differences were analyzed. IC, normalized IC (NIC), and WC values were compared between the pure ground-glass opacity (pGGO) and the mixed ground-glass opacity (mGGO), and between the group of preinvasive lesions and the minimally invasive adenocarcinoma (MIA) and invasive adenocarcinoma (IA) groups. The values of pGGO (IC = 20.9 ± 6.2 mg/mL and WC = 345.1 ± 87.1 mg/mL) and mGGO (IC = 23.8 ± 8.3 mg/mL and WC = 606.8 ± 124.5 mg/mL) in the AP were significantly higher than those of the contralateral normal lung tissues (IC = 15.0 ± 4.9 mg/mL and WC = 156.4 ± 36.8 mg/mL; IC = 16.2 ± 5.7 mg/mL and WC = 169.4 ± 41.0 mg/mL) and ipsilateral normal lung tissues (IC = 15.1 ± 6.2 mg/mL and WC = 156.3 ± 38.8 mg/mL; IC = 15.9 ± 6.0 mg/mL and WC = 174.7 ± 39.2 mg/mL; all p < 0.001). After normalizing the data according to the values of the artery, pGGO (NIC = 0.1 and WC = 345.1 ± 87.1 mg/mL) and mGGO (NIC = 0.2 and WC = 606.8 ± 124.5 mg/mL) were statistically different ( p = 0.049 and p < 0.001, respectively), but not for the IC value ( p = 0.161). The WC values of the group with preinvasive lesions and MIA (345.4 ± 96.1 mg/mL) and IA (550.1 ± 158.2 mg/mL) were statistically different ( p < 0.001). Using dual-energy spectral CT and material decomposition analysis, the IC in GGO can be quantitatively measured which can be an indicator of the blood supply status in the GGO.

Characterization of Mg-containing hydroxyapatites synthesized by combustion method

NASA Astrophysics Data System (ADS)

Kaygili, Omer; Keser, Serhat; Bulut, Niyazi; Ates, Tankut

2018-05-01

In the present paper, Mg-substituted hydroxyapatites with the morphology, composed of the stacked plate- and rod-like structures, were prepared at the temperature of 600 °C by combustion method using glycerine as a fuel. A significant decrease in the crystallite size values calculated for both Scherrer and Williamson-Hall methods is found. The crystallinity, lattice parameter of a, stress and anisotropic energy density values decreased by adding of Mg, whereas the lattice strain increased. The amount of HAp phase decreases with increasing amount of Mg and the β-tricalcium phosphate content increases. Mg incorporation the apatitic structure was detected. Depending on the increase in Mg content, Ca-deficiency was observed.

Effect of aerated concrete blockwork joints on the heat transfer performance uniformity

NASA Astrophysics Data System (ADS)

Pukhkal, Viktor; Murgul, Vera

2018-03-01

Analysis of data on the effect of joints of the aerated concrete blocks on the heat transfer uniformity of exterior walls was carried out. It was concluded, that the values of the heat transfer performance uniformity factor in the literature sources were obtained for the regular fragment of a wall construction by approximate addition of thermal conductivities. Heat flow patterns for the aerated concrete exterior walls amid different values of the thermal conductivity factors and design ambient air temperature of -26 °C were calculated with the use of "ELCUT" software for modelling of thermal patterns by finite element method. There were defined the values for the heat transfer performance uniformity factor, reduced total thermal resistance and heat-flux density for the exterior walls. The calculated values of the heat transfer performance uniformity factors, as a function of the coefficient of thermal conductivity of aerated concrete blocks, differ from the known data by a more rigorous thermal and physical substantiation.

Net carbon flux of dead wood in forests of the Eastern US.

PubMed

Woodall, C W; Russell, M B; Walters, B F; D'Amato, A W; Fraver, S; Domke, G M

2015-03-01

Downed dead wood (DDW) in forest ecosystems is a C pool whose net flux is governed by a complex of natural and anthropogenic processes and is critical to the management of the entire forest C pool. As empirical examination of DDW C net flux has rarely been conducted across large scales, the goal of this study was to use a remeasured inventory of DDW C and ancillary forest attributes to assess C net flux across forests of the Eastern US. Stocks associated with large fine woody debris (diameter 2.6-7.6 cm) decreased over time (-0.11 Mg ha(-1) year(-1)), while stocks of larger-sized coarse DDW increased (0.02 Mg ha(-1) year(-1)). Stocks of total DDW C decreased (-0.14 Mg ha(-1) year(-1)), while standing dead and live tree stocks both increased, 0.01 and 0.44 Mg ha(-1) year(-1), respectively. The spatial distribution of DDW C stock change was highly heterogeneous with random forests model results indicating that management history, live tree stocking, natural disturbance, and growing degree days only partially explain stock change. Natural disturbances drove substantial C transfers from the live tree pool (≈-4 Mg ha(-1) year(-1)) to the standing dead tree pool (≈3 Mg ha(-1) year(-1)) with only a minimal increase in DDW C stocks (≈1 Mg ha(-1) year(-1)) in lower decay classes, suggesting a delayed transfer of C to the DDW pool. The assessment and management of DDW C flux is complicated by the diversity of natural and anthropogenic forces that drive their dynamics with the scale and timing of flux among forest C pools remaining a large knowledge gap.

Geothermometry, geochronology, and mass transfer associated with hydrothermal alteration of a rhyolitic hyaloclastite from Ponza Island, Italy

USGS Publications Warehouse

Altaner, S.P.; Ylagan, R.F.; Savin, S.M.; Aronson, J.L.; Belkin, H.E.; Pozzuoli, A.

2003-01-01

A rhyolitic hyaloclastite from Ponza Island, Italy, was hydrothermally altered, producing four distinct alteration zones based on X-ray diffraction mineralogy and field textures: (1) nonpervasive argillic zone; (2) propylitic zone; (3) silicic zone; and (4) sericitic zone. The unaltered hyaloclastite is volcanic breccia with clasts of vesiculated obsidian in a matrix of predominantly pumice lapilli. Incomplete alteration of the hyaloclastite resulted in the nonpervasive argillic zone, characterized by smectite and disordered opal-CT. The other three zones exhibit more complete alteration of the hyaloclastite. The propylitic zone is characterized by mixed-layer illite-smectite (I-S) with 10 to 85% I, mordenite, opal-C, and authigenic K-feldspar (akspar). The silicic zone is characterized by I-S with ???90% I, pure illite, quartz, akspar, and occasional albite. The sericitic zone consists primarily of I-S with ???66% I, pure illite, quartz, and minor akspar and pyrite. K/Ar dates of I-S indicate hydrothermal alteration occurred at 3.38 ?? 0.08 Ma. Oxygen isotope compositions of I-S systematically decrease from zones 1 to 4. In the argillic zone, smectite has ??18 O values of 21.7 to 22.0??? and I-S from the propylitic, silicic, and sericitic zones ranges from 14.5 to 16.3???, 12.5 to 14.0???, and 8.6 to 11.9???, respectively. ??18 O values for quartz from the silicic and sericitic zones range from 12.6 to 15.9???. By use of isotope fractionation equations and data from authigenic quartz-hosted primary fluid inclusions, alteration temperatures ranged from 50 to 65 ??C for the argillic zone, 85 to 125 ??C for the propylitic zone, 110 to 210 ??C for the silicic zone, and 145 to 225 ??C for the sericitic zone. Fluid inclusion data and calculated ??18 O water values indicate that hydrothermal fluids were seawater dominated. Mass-transfer calculations indicate that hydrothermal alteration proceeded in a relatively open chemical system and alteration in the sericitic zone involved the most extensive loss of chemical species, especially Si. Systematic gains in Mg occur in all alteration zones as a result of I-S clay mineral formation, and systematic losses of Na, Ca, and K occur in most zones. With the exception of Ca, calculations of mass transfer associated with hydrothermal alteration on Ponza agree with chemical fluxes observed in laboratory experiments involving hydrothermal reactions of rhyolite and seawater. The anomalous Ca loss at Ponza may be due to hydrothermal formation of anhydrite and later low-temperature dissolution. On the basis of Mg enrichments derived from circulating seawater, we estimate the following minimum water/rock ratios: 9, 3, 6, and 9 for the argillic, propylitic, silicic, and sericitic zones, respectively. Hydrothermal fluid pH for the propylitic and silicic zones was neutral to slightly basic and relatively acidic for the sericitic zone as a result of condensation of carbonic and perhaps other acids. Copyright ?? 2003 Elsevier Science Ltd.

Methane fluxes during the cold season: distribution and mass transfer in the snow cover of bogs

NASA Astrophysics Data System (ADS)

Smagin, A. V.; Shnyrev, N. A.

2015-08-01

Fluxes and profile distribution of methane in the snow cover and different landscape elements of an oligotrophic West-Siberian bog (Mukhrino Research Station, Khanty-Mansiisk autonomous district) have been studied during a cold season. Simple models have been proposed for the description of methane distribution in the inert snow layer, which combine the transport of the gas and a source of constant intensity on the soil surface. The formation rates of stationary methane profiles in the snow cover have been estimated (characteristic time of 24 h). Theoretical equations have been derived for the calculation of small emission fluxes from bogs to the atmosphere on the basis of the stationary profile distribution parameters, the snow porosity, and the effective methane diffusion coefficient in the snow layer. The calculated values of methane emission significantly (by 2-3 to several tens of times) have exceeded the values measured under field conditions by the closed chamber method (0.008-0.25 mg C/(m2 h)), which indicates the possibility of underestimating the contribution of the cold period to the annual emission cycle of bog methane.

Effect of flow rate on growth and oxygen consumption of biofilm in gravity sewer.

PubMed

Xu, Jingwei; Li, Muzhi; He, Qiang; Sun, Xingfu; Zhou, Xiangren; Su, Zhenping; Ai, Hainan

2017-01-01

The function of sewer as reactors must rely on the biofilm in it. In this paper, the formation, structure, oxygen transfer, and activity of the biofilm under different hydraulic conditions were studied by the microelectrode technology, oxygen uptake rate (OUR) technology, and 454 high-throughput pyrosequencing technology. Results showed that when the wall-shear stresses were 1.12, 1.29, and 1.45 Pa, the porosity of the steady-state biofilm were 69.1, 64.4, and 55.1 %, respectively. The maximum values of OUR were 0.033, 0.027, and 0.022 mg/(L*s), respectively, and the COD removal efficiency in the sewers reached 40, 35, and 32 %, respectively. The research findings had an important significance on how to improve the treatment efficiency of the sewers. Fig. a Graphical Abstract.

[Total hair mercury in children from a coastal population in Cananéia, São Paulo State, Brazil].

PubMed

Farias, Luciana A; Santos, Nathália Renata dos; Favaro, Déborah I T; Braga, Elisabete S

2008-10-01

Mercury (Hg) levels in hair are directly related to eating habits, especially fish consumption by coastal populations with a large contingent of traditional fishing families. This study assessed total Hg levels in children's hair. The study group was selected from three public elementary schools in Cananéia, São Paulo State, Brazil (ages 4 to 12 years). The results (median and range) for total Hg levels in children's hair were: 0.04 mg.kg-1 (0.01-0.77 mg.kg-1), 0.39 mg.kg-1 (< 0.01-3.33 mg.kg-1), and 0.39 mg.kg-1 (< 0.01-2.81 mg.kg-1) for schools ES1, ES2, and ES3, respectively. The values were well below the level set by World Health Organization for an adult population unexposed to Hg (2.0 mg.kg-1). However, since there are no existing reference values for total Hg in children's hair, these results can be used as a contribution to establishing reference values for total hair Hg in Brazilian children living in coastal areas.

26 CFR 1.468A-8T - Special transfers to qualified funds pursuant to section 468A(f) (temporary).

Code of Federal Regulations, 2010 CFR

2010-04-01

... amount of cash and the fair market value of property transferred) may not exceed the present value of the... (see paragraph (c) of this section). (2) Pre-2005 nonqualifying amount. The present value of the pre... amount equal to the pre-2005 nonqualifying percentage of the present value of the estimated future...

Plutonium recovery from spent reactor fuel by uranium displacement

DOEpatents

Ackerman, J.P.

1992-03-17

A process is described for separating uranium values and transuranic values from fission products containing rare earth values when the values are contained together in a molten chloride salt electrolyte. A molten chloride salt electrolyte with a first ratio of plutonium chloride to uranium chloride is contacted with both a solid cathode and an anode having values of uranium and fission products including plutonium. A voltage is applied across the anode and cathode electrolytically to transfer uranium and plutonium from the anode to the electrolyte while uranium values in the electrolyte electrolytically deposit as uranium metal on the solid cathode in an amount equal to the uranium and plutonium transferred from the anode causing the electrolyte to have a second ratio of plutonium chloride to uranium chloride. Then the solid cathode with the uranium metal deposited thereon is removed and molten cadmium having uranium dissolved therein is brought into contact with the electrolyte resulting in chemical transfer of plutonium values from the electrolyte to the molten cadmium and transfer of uranium values from the molten cadmium to the electrolyte until the first ratio of plutonium chloride to uranium chloride is reestablished.

Contribution to the hygienic assessment of atmospheric ozone

DOE Office of Scientific and Technical Information (OSTI.GOV)

Eglite, M.E.

1968-01-01

The concentration of atmospheric ozone in Moscow in autumn and winter of 1965 and 1966 and in spring of 1967 amounted to 0.065 mg/mT and in Riga in spring and summer months of 1966 it oscillated in the limits of 0.01 to 0.093 mg/mT. The threshold value of the smell of ozone for the most sensitive persons attained 0.015 mg/mT, the subthreshold concentration equaled 0.01 mg/mT. The threshold value of the reflex action of ozone on the electric activity of the cerebral cortex amounted to 0.01 mg/mT, the subthreshold value equaled 0.005 mg/mT. A 24-hour chronic poisoning with ozone atmore » a concentration of 0.11 mg/mT for a period of 93 days produced in experimental rats weight decrease, an inhibition of the blood cholinesterase activity, a decrease of oxygen consumption rate, a rise of 17-ketosteroids content in the urine, a fall in ascorbic acid content of the suprarenal glands. Ozone at concentrations of 0.02 and 0.005 mg/mT proved to be ineffective.« less

Air pollutants and toxic emissions of various mileage motorcycles for ECE driving cycles

NASA Astrophysics Data System (ADS)

Tsai, Jiun-Horng; Huang, Pei-Hsiu; Chiang, Hung-Lung

2017-03-01

Motorcycles were selected to determine their fuel consumption and exhaust emissions following ECE driving cycles. Exhaust constituents including CO2, CO, NOx, total hydrocarbons (THC) and hydrocarbon species (27 paraffins, 9 olefins, 16 aromatics and 15 carbonyls) were investigated for this work. The age of 10- 90% of the selected motorcycles ranged from 2.5 to 12.4 years, and their mileage ranged from 5400 to 39,300 km. CO emission ranged from 1.4 to 6.4 g/km (median value: 2.98 g/km), THC from 0.41 to 1.54 g/km (median value: 0.98 g/km), NOx from 0.16 to 0.28 g/km (median value: 0.21 g/km), CO2 from 58.9 to 62.2 g/km (median value: 60.5 g/km) and fuel consumption from 30.7 to 36.4 km/L (median value: 33.4 km/L), corresponding to the percentage cumulative data from 10 to 90% of the selected motorcycles. Results indicated that the motorcycle exhaust emission and fuel consumption depended on their mileage and ages. An increase in mileage of 1000 km resulted in an increase of 103 mg for CO emission and 14.7 mg for hydrocarbon emission and a reduction of 1.52 mg NOx emission and 0.11 km per liter fuel consumption. For various VOC groups, a mileage increase of 1000 km corresponding to the increased exhaust emission of paraffins was 6.71 mg, olefins 1.90 mg, aromatics 7.04 mg, carbonyls 0.283 mg and 67 VOC species 15.9 mg. Fuel consumption and emissions of CO and hydrocarbon increased in motorcycles over the guaranteed mileage of 15,000 km.

The effect of bacterial sepsis severity on triglyceride value

NASA Astrophysics Data System (ADS)

Fahila, R.; Kembaren, T.; Rahimi, A.

2018-03-01

Sepsis can increase the amount of triglyceride as well as change the functional and structural components of lipoproteins. The triglyceride level is directly proportional to the severity of sepsis and associated with a systemic inflammatory response. The study aims to determine the correlation between the severity of bacterial sepsis with triglyceride value. An observational study with case control design from January2017 to March 2017 in 30 sepsis and 30 non-sepsis patients at H. Adam Malik General Hospital Medan. We examined Procalcitonin (PCT) and triglyceride level on the 1st, 3rd and 5th day and then analyzed using MannWhitney to assess their correlation.The triglyceride value in the sepsis group was 120 ± 5.1 mg/dl on day 1, non-sepsis 117.53 ± 36.37mg/dl. However, on the fifth day, the sepsis group of triglyceride values was 124.2±50.29mg/dl and the non-sepsis group triglyceride values 134.03±68.12mg/dl. There was no specific connection between the severity of sepsis and triglyceride value in a patient with sepsis.

Administration of the nonsteroidal anti-inflammatory drug tolfenamic acid at embryo transfer improves maintenance of pregnancy and embryo survival in recipient mice.

PubMed

Schlapp, Geraldine; Goyeneche, Lucía; Fernández, Gabriel; Menchaca, Alejo; Crispo, Martina

2015-02-01

To evaluate the effect of the nonsteroidal anti-inflammatory drugs tolfenamic acid and flunixin meglumine in pregnancy rate and embryo survival of recipient mice subjected to embryo transfer. A total of 142 recipient females were transferred with 2,931 embryos and treated with a single injection of tolfenamic acid (1 mg/kg; n = 54 females with 1,129 embryos), flunixin meglumine (2.5 mg/kg; n = 46 females with 942 embryos), or bi-distilled water (10 mL/kg) as control group (n = 42 females with 860 embryos). Pregnancy was checked 2 weeks after embryo transfer, delivery was registered on the due date, and litter size was recorded on Day 7 after birth. Pregnancy rate of tolfenamic acid treated females was significantly higher than flunixin group (P < 0.05) and showed a tendency to be higher when compared to the control group (P = 0.06). The number of pups born from transferred embryos in pregnant females was significantly higher for both treatment groups compared to controls (P < 0.05). Number of pups from total transferred embryos was higher for both treatment groups (P < 0.05) when compared to controls. The use of tolfenamic acid at the time of embryo transfer improves both pregnancy rate and number of live pups in recipient mice, with optimal effects observed with flunixin meglumine. We suggest that the use of tolfenamic acid has beneficial effects on the maintenance of pregnancy and embryo survival in recipient mice, which should be taken into account for further studies in other mammalian females.

Electrodialytic matrix isolation for metal cations.

PubMed

Ohira, Shin-Ichi; Hiroyama, Yuri; Nakamura, Koretaka; Koda, Takumi; Dasgupta, Purnendu K; Toda, Kei

2015-01-01

Electrodialytic ion transfer was studied as a matrix isolation tool for heavy metal determinations. An ion transfer device (ITD) was used for the transfer of heavy metal cations. Under optimized flow rates applied voltage and receptor composition, heavy metal ions were quantitatively transferred at concentrations spanning µg L(-1) to mg L(-1). As long as the sample pH was acidic, there was no significant sample pH effect on the transfer efficiencies. Significant salt concentrations (>1 mM NaCl), however, decreased the transfer efficiency. This could be ameliorated (up to 5 mM NaCl) by transient instead of continuous sample introduction. The device was applied to the determination of Fe, Cu and Zn in equine and bovine serum; the reproducibility was better than conventional digestion method. Copyright © 2014 Elsevier B.V. All rights reserved.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhang, Xinmin, E-mail: zhxmuga@163.com; Pan, Qi; Kim, Sun Il

Graphical abstract: - Highlights: • Emission spectrum at 20 K confirms that Eu{sup 2+} ions occupy three sites. • Decay curves of three types of Eu{sup 2+} reflect the characteristics of energy transfer. • The Eu(I) emission is thermally quenched at 323 K. • Ca{sub 3}Mg{sub 3}(PO{sub 4}){sub 4}:Eu{sup 2+} has good thermal stability. • Ca{sub 3}Mg{sub 3}(PO{sub 4}){sub 4}:Eu{sup 2+} is a promising phosphor for near UV excited white LEDs. - Abstract: A blue-emitting phosphor Ca{sub 3}Mg{sub 3}(PO{sub 4}){sub 4}:Eu{sup 2+} peaking at 450 nm was synthesized by a solid state reaction. The XRD patterns, luminescence properties, decay curvesmore » of samples as well as their thermal quenching and comparing the luminescence properties with that of commercial material were investigated. At 20 K, the emission spectrum exhibiting two distinct bands peaking at 437 and 473 nm with a shoulder peak at 510 nm can be attributed to the overlap of Eu(I), Eu(II) and Eu(III) emission bands. At 423 K the PL intensity decreases to 80% of the value at room temperature, and the emission wavelength shifts toward high energy. The derived activation energy indicates that the lowest energy level of the Eu{sup 2+} 4f{sup 6}5d{sup 1} state is well isolated from the host lattice conduction band. The PL spectra and chromaticity coordinates are close to those of BAM. Ca{sub 3}Mg{sub 3}(PO{sub 4}){sub 4}:Eu{sup 2+} could be a potential candidate for near-UV excited white LEDs.« less

Simultaneous removal of arsenite and fluoride via an integrated electro-oxidation and electrocoagulation process.

PubMed

Zhao, Xu; Zhang, Baofeng; Liu, Huijuan; Qu, Jiuhui

2011-04-01

An integrated electro-oxidation and electrocoagulation system was designed and used to remove As(III) and F(-) ions from water simultaneously. Dimensionally stable anodes (DSA), Fe electrodes, and Al electrodes were combined into an electrochemical system. Two pieces of DSA electrodes were assigned as the outside of the Fe and Al electrodes and were directly connected to the power supply as anode and cathode, respectively. The Fe and Al ions were generated by electro-induced process simultaneously. Subsequently, hydroxides of Fe and Al were formed. Arsenic ions are mainly removed by iron hydroxides and F(-) ions are mainly removed by the Al oxides. At the initial concentration of 1.0 mg L(-1), most of As(III) was transferred into As(V) within 40 min at current density of 4 mA cm(-2), whereas F(-) ions can be efficiently removed simultaneously. The effect of the ratio of Fe and Al plate electrodes and current density on the removal of As(III) and F(-) was investigated. With one piece of Fe plate electrode and three pieces of Al plate electrodes, it is observed that As(III) with concentration of 1 mg L(-1) and F(-) with concentration of 4.5 mg L(-1) can be removed and their final concentrations were below the values of 10 μg L(-1) and 1.0 mg L(-1), respectively within 40 min. Removal efficiency of As(III) increases with the increase of solution pH. However, in the pH range of 6-7, removal efficiency of F(-) is the largest. Copyright © 2011 Elsevier Ltd. All rights reserved.

Submitochondrial particle response to linear alkylbenzene sulfonates, nonylphenol polyethoxylates and their biodegradation derivatives

DOE Office of Scientific and Technical Information (OSTI.GOV)

Argese, E.; Marcomini, A.; Bettiol, C.

1994-05-01

The effects on mitochondrial respiratory parameters of linear alkylbenzene sulfonates (LAS), nonylphenol polyethoxylates (NPEO), and some of their biotransformation products, namely sulfophenyl carboxylates (SPCs), nonylphenol (NP), and nonylphenoxy acetic acid (NP1EC), were recorded by using the in vitro response of submitochondrial particles (SMP) from beef heart. The toxicity of these compounds was estimated by determining their effects on the energy-coupled reverse electron transfer (RET), which is induced by ATP and succinate at the first site level of the respiratory chain and reduces exogenous NAD[sup +] to NADH. The toxicity of the substances, expressed as the toxicant concentration decreasing the reductionmore » rate of NAD[sup +] to an extent of 50% (EC50), ranged from 0.61 mg/L for a commercial LAS mixture to 18,000 mg/L for individual SPCs; from 1.3 mg/L for NPEO, with an average of 10 ethoxy units, to 8.2 and 1.8 mg/L for NP1EC and NP, respectively. These results were related to the molecular structure of each compound class and compared with the toxicity values obtained by a variety of biological systems currently used for toxicity testing. The acute toxicity data have demonstrated that (a) the SMP bioassay is suitable for reproducing the toxicological response of whole organisms, such as fishes and invertebrates, to the tested chemicals; and (b) the hydrophobic moiety of these compounds plays a significant role in eliciting their toxic effects. From a toxicological standpoint, attention must be paid to the occurrence in natural waters of residual LAS, whereas in the case of NPEO both unaltered surfactant and all biotransformation products need to be identified and quantified.« less

Dose distribution of secondary radiation in a water phantom for a proton pencil beam-EURADOS WG9 intercomparison exercise.

PubMed

Stolarczyk, L; Trinkl, S; Romero-Expósito, M; Mojżeszek, N; Ambrozova, I; Domingo, C; Davídková, M; Farah, J; Kłodowska, M; Knežević, Ž; Liszka, M; Majer, M; Miljanić, S; Ploc, O; Schwarz, M; Harrison, R M; Olko, P

2018-04-19

Systematic 3D mapping of out-of-field doses induced by a therapeutic proton pencil scanning beam in a 300  ×  300  ×  600 mm 3 water phantom was performed using a set of thermoluminescence detectors (TLDs): MTS-7 ( 7 LiF:Mg,Ti), MTS-6 ( 6 LiF:Mg,Ti), MTS-N ( nat LiF:Mg,Ti) and TLD-700 ( 7 LiF:Mg,Ti), radiophotoluminescent (RPL) detectors GD-352M and GD-302M, and polyallyldiglycol carbonate (PADC)-based (C 12 H 18 O 7 ) track-etched detectors. Neutron and gamma-ray doses, as well as linear energy transfer distributions, were experimentally determined at 200 points within the phantom. In parallel, the Geant4 Monte Carlo code was applied to calculate neutron and gamma radiation spectra at the position of each detector. For the cubic proton target volume of 100  ×  100  ×  100 mm 3 (spread out Bragg peak with a modulation of 100 mm) the scattered photon doses along the main axis of the phantom perpendicular to the primary beam were approximately 0.5 mGy Gy -1 at a distance of 100 mm and 0.02 mGy Gy -1 at 300 mm from the center of the target. For the neutrons, the corresponding values of dose equivalent were found to be ~0.7 and ~0.06 mSv Gy -1 , respectively. The measured neutron doses were comparable with the out-of-field neutron doses from a similar experiment with 20 MV x-rays, whereas photon doses for the scanning proton beam were up to three orders of magnitude lower.

Observational Study to Assess the Therapeutic Value of Four Ovarian Hyperstimulation Protocols in IVF After Pituitary Suppression with GnRH Antagonists in Normally Responding Women.

PubMed

Ana, Monzó; Vicente, Montañana; María, Rubio José; Trinidad, García-Gimeno; Alberto, Romeu

2011-02-22

To compare the clinical results of four different protocols of COH for IVF-ICSI in normovulatory women, using in all cases pituitary suppression with GnRH antagonists. A single center, open label, parallel-controlled, prospective, post-authorization study under the approved conditions for use where 305 normal responders women who were candidates to COH were assigned to r-FSH +hp-hMG (n = 51, Group I), hp-hMG (n = 61, Group II), fixed-dose r-FSH (n = 118, Group III), and r-FSH with potential dose adjustment (n = 75, Group IV) to subsequently undergo IVF-ICSI. During stimulation, Group IV needed significantly more days of stimulation as compared to Group II [8.09 ± 1.25 vs. 7.62 ± 1.17; P < 0.05], but was the group in which more oocytes were recovered [Group I: 9.43 ± 4.99 vs. Group II: 8.96 ± 4.82 vs. Group III: 8.78 ± 3.72 vs. Group IV: 11.62 ± 5.80; P < 0.05]. No significant differences were seen between the groups in terms of clinical and ongoing pregnancy, but among patients in whom two embryos with similar quality parameters (ASEBIR) were transferred, the group treated with hp-hMG alone achieved a significantly greater clinical pregnancy rate as compared to all other groups [Group I: 31.6%, Group II: 56.4%, Group III: 28.7%, Group IV: 32.7%; P < 0.05]. Although randomized clinical trials should be conducted to achieve a more reliable conclusion, these observations support the concept that stimulation with hp-hMG could be beneficial in normal responders women undergoing pituitary suppression with GnRH antagonists.

Dose distribution of secondary radiation in a water phantom for a proton pencil beam—EURADOS WG9 intercomparison exercise

NASA Astrophysics Data System (ADS)

Stolarczyk, L.; Trinkl, S.; Romero-Expósito, M.; Mojżeszek, N.; Ambrozova, I.; Domingo, C.; Davídková, M.; Farah, J.; Kłodowska, M.; Knežević, Ž.; Liszka, M.; Majer, M.; Miljanić, S.; Ploc, O.; Schwarz, M.; Harrison, R. M.; Olko, P.

2018-04-01

Systematic 3D mapping of out-of-field doses induced by a therapeutic proton pencil scanning beam in a 300  ×  300  ×  600 mm3 water phantom was performed using a set of thermoluminescence detectors (TLDs): MTS-7 (7LiF:Mg,Ti), MTS-6 (6LiF:Mg,Ti), MTS-N (natLiF:Mg,Ti) and TLD-700 (7LiF:Mg,Ti), radiophotoluminescent (RPL) detectors GD-352M and GD-302M, and polyallyldiglycol carbonate (PADC)-based (C12H18O7) track-etched detectors. Neutron and gamma-ray doses, as well as linear energy transfer distributions, were experimentally determined at 200 points within the phantom. In parallel, the Geant4 Monte Carlo code was applied to calculate neutron and gamma radiation spectra at the position of each detector. For the cubic proton target volume of 100  ×  100  ×  100 mm3 (spread out Bragg peak with a modulation of 100 mm) the scattered photon doses along the main axis of the phantom perpendicular to the primary beam were approximately 0.5 mGy Gy‑1 at a distance of 100 mm and 0.02 mGy Gy‑1 at 300 mm from the center of the target. For the neutrons, the corresponding values of dose equivalent were found to be ~0.7 and ~0.06 mSv Gy‑1, respectively. The measured neutron doses were comparable with the out-of-field neutron doses from a similar experiment with 20 MV x-rays, whereas photon doses for the scanning proton beam were up to three orders of magnitude lower.

Insights into the Importance of Hydrogen Bonding in the [gamma]-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Serine 236

DOE Office of Scientific and Technical Information (OSTI.GOV)

Frye, Jeremiah J.; Klenchin, Vadim A.; Bagshaw, Clive R.

2010-09-22

The active site of myosin contains a group of highly conserved amino acid residues whose roles in nucleotide hydrolysis and energy transduction might appear to be obvious from the initial structural and kinetic analyses but become less clear on deeper investigation. One such residue is Ser236 (Dictyostelium discoideum myosin II numbering) which was proposed to be involved in a hydrogen transfer network during {gamma}-phosphate hydrolysis of ATP, which would imply a critical function in ATP hydrolysis and motility. The S236A mutant protein shows a comparatively small decrease in hydrolytic activity and motility, and thus this residue does not appear tomore » be essential. To understand better the contribution of Ser236 to the function of myosin, structural and kinetic studies have been performed on the S236A mutant protein. The structures of the D. discoideum motor domain (S1dC) S236A mutant protein in complex with magnesium pyrophosphate, MgAMPPNP, and MgADP{center_dot}vanadate have been determined. In contrast to the previous structure of wild-type S1dC, the S236A{center_dot}MgAMPPNP complex crystallized in the closed state. Furthermore, transient-state kinetics showed a 4-fold reduction of the nucleotide release step, suggesting that the mutation stabilizes a closed active site. The structures show that a water molecule approximately adopts the location of the missing hydroxyl of Ser236 in the magnesium pyrophosphate and MgAMPPNP structures. This study suggests that the S236A mutant myosin proceeds via a different structural mechanism than wild-type myosin, where the alternate mechanism is able to maintain near normal transient-state kinetic values.« less

Response surface methodology optimization for sorption of malachite green dye on sugarcane bagasse biochar and evaluating the residual dye for phyto and cytogenotoxicity.

PubMed

Vyavahare, Govind D; Gurav, Ranjit G; Jadhav, Pooja P; Patil, Ravishankar R; Aware, Chetan B; Jadhav, Jyoti P

2018-03-01

In the present study, sorption and detoxification of malachite green (MG) dye was executed using biochar resulting after pyrolysis of agro-industrial waste at 400, 600 and 800 °C. Maximum sorption of MG dye (3000 mg/L) was observed on the sugarcane bagasse biochar (SCB) prepared at 800 °C. The interactive effects of different factors like dye concentration, time, pH and temperature on sorption of MG dye were investigated using response surface methodology (RSM). Optimum MG dye concentration, contact time, temperature and pH predicted through Box-Behnken based RSM model were 3000 mg/L MG dye, 51.89 min, 60 °C and 7.5, respectively. ANOVA analysis displayed the non-significant lack of fit value (0.4566), whereas, the predicted correlation coefficient values (R 2 0.8494) were reasonably in agreement with the adjusted value (R 2 0.9363) demonstrating highly significant model for MG dye sorption. The applicability of this model was also checked through F- test (30.39) with lower probability (0.0001) value. Furthermore, the characterization of SCB was performed using fourier transform infra-red spectroscopy (FTIR), X-ray diffraction (XRD), scanning electron microscope (SEM), Brunauer-Emmett-Teller surfaces (BET), total organic carbon (TOC) and atomic absorption spectroscopy (AAS). Phyto-toxicity and cytogenotoxicity studies showed successful removal of MG dye using SCB. In addition, the batch sorption studies for reutilization of SCB revealed that the SCB was effective in removal of MG for five repeated cycles. This technology would be effective for treating the toxic textile effluent released from the textile industries. Copyright © 2017 Elsevier Ltd. All rights reserved.

Toxicological study of the Anam River in Otuocha, Anambra State, Nigeria.

PubMed

Igwilo, Innocent O; Afonne, Onyenmechi Johnson; Maduabuchi, Ugwuona John-Moses; Orisakwe, Orish Ebere

2006-01-01

The authors studied the quality of water and soil samples from the Anam River in Nigeria. Using an atomic absorption spectrophotometer, they analyzed levels of lead, cadmium, copper, and nickel. They also analyzed sulfates, nitrates, biological oxygen demand, total hardness, total dissolved solids, pH values, electrical conductivity, chloride, and salinity. The ranges of detected metals were 0.002-0.005 mg/L for cadmium, 0.008-0.016 mg/L for lead, and 0.580-1.345 mg/L for copper. In the soil samples, the authors detected cadmium (0.07-3.45 ppm), copper (4.38-13.54 ppm), lead (0.59-7.34 ppm), and nickel (0.36-5.64 ppm). The mean values of the chemical parameters were 11.34 +/- 1.20 mg/L for total hardness, 4.43 +/- 1.54 mg/L for biological oxygen demand, 20.00 +/- 0.00 mg/L for total dissolved solids, and 0.22 +/- 0.05 mg/L for nitrates. Chloride, salinity, electrical conductivity, and pH values were 8.00 +/- 1.73 mg/L, 14.44 +/- 3.13 mg/L, 19.33 +/- 0.67 ps cm-L, and 7.09 +/- 0.05, respectively. The World Health Organization guidelines for the parameters in soil were exceeded.

Growth-inhibition patterns and transfer-factor profiles in arsenic-stressed rice (Oryza sativa L.).

PubMed

Jung, Ha-Il; Lee, Jinwook; Chae, Mi-Jin; Kong, Myung-Suk; Lee, Chang-Hoon; Kang, Seong-Soo; Kim, Yoo-Hak

2017-11-16

Arsenic (As) accumulation in rice owing to uptake from the soil is a critical human health issue. Here, we studied the chemical properties of As-treated soils, growth inhibition patterns of As-stressed rice plants, changes in the As content of soil and soil solutions, and the relationship between As accumulation and As transfer factor from the soil to the rice organs. Rice plants were cultivated in a greenhouse under four concentrations of As: 0 (control), 25, 50, and 75 mg kg -1 . A significant positive correlation was found between available P 2 O 5 and exchangeable K and between As concentration and available P 2 O 5 or exchangeable K. The As concentration for 50% shoot growth inhibition was 50 mg kg -1 . As levels in roots and shoots were positively correlated with the growth stages of rice. The transfer factor (TF) root/soil increased with As concentration at the tillering stage but decreased at the heading stage. TF root/soil and TF shoot/soil were higher at the heading stage than at the tillering stage. As accumulation in the 25 mg kg -1 treatment was higher during the heading stage, whereas no difference was found at the tillering stage. As accumulation was related to plant biomass and soil As concentration. We found that As accumulation was greater at As concentrations that allowed for plant growth and development. Thus, species-specific threshold concentrations must be determined based on As phytotoxicity for the phytoremediation of As-contaminated soils. Hence, developing practical approaches for managing safe crop production in farmlands with an As contamination of 25 mg kg -1 or less is necessary.

Multi-unit dosage formulations of theophylline for controlled release applications.

PubMed

Uhumwangho, Michael U; Okor, Roland S

2007-01-01

The study was carried out to investigate the drug release profiles of multi-unit dosage formulations of theophylline consisting of both the fast and slow release components in a unit dose. The fast release component consisted of conventional granules of theophylline formed by mixing the drug powder with starch mucilage (20% w/v) while the slow release component consisted of wax granulations of theophylline formed by triturating the drug powder with a melted Carnauba wax (drug:wax ratio, 4:1). The granules were either filled into capsules or tabletted. In the study design, the drug release characteristics of the individual fast or slow release particles were first determined separately and then mixed in various proportions for the purpose of optimizing the drug release profiles. The evaluating parameters were the prompt release in the first 1 h (mp), the maximum release (m infinity) and the time to attain it (t infinity). Total drug content in each capsule or tablet was 300 mg and two of such were used in dissolution studies. The release kinetics and hence the release mechanism was confirmed by measuring the linear regression coefficient (R2 values) of the release data. The release kinetics was generally most consistent with the Higuchi square root of time relationship (R2 = 0.95). indicating a diffusion-controlled mechanism. The mp (mg) and t infinity (h) values for capsules and tablets of the conventional granules were (420 mg, 3 h) and (348 mg, 5 h), respectively, while for the capsules and tablets of the wax granulations mp and t infinity values were (228 mg, 9 h) and (156 mg, 12 h), respectively, indicating that a combination of wax granulation and tableting markedly retarded drug release. In the multi-unit dose formulations where the conventional and wax granulations were mixed in the ratios 2:1, 1:1 and 1:2 (conventional: matrix), the m infinity and t infinity values for the capsules were (378 mg, 6 h), (326 mg, 6 h) and (272 mg, 7 h), reSpectively. The corresponding values of m infinity and t infinity for the tablets were (240 mg, 9 h), (180 mg, 11 h) and (128 mg, 12 h) against the set target (200 mg, 12 h). The indication is that tableting rather than encapsulation can more effectively control drug release from the systems.

Dietary intake of trace elements, minerals, and vitamins of patients on chronic hemodialysis.

PubMed

Bossola, Maurizio; Di Stasio, Enrico; Viola, Antonella; Leo, Alessandra; Carlomagno, Giusy; Monteburini, Tania; Cenerelli, Stefano; Santarelli, Stefano; Boggi, Rolando; Miggiano, Giacinto; Vulpio, Carlo; Mele, Cristina; Tazza, Luigi

2014-04-01

We aimed to estimate dietary intakes of trace elements, minerals, and vitamins in hemodialysis patients (HDP) of three centers in one metropolitan and two urban areas of Italy. Daily dietary intake was assessed using a 3-day diet diary in 128 HDP. Mean daily intakes of trace elements were as follows: zinc, 7.6 ± 5.4 mg; copper, 14.3 ± 11.8 mg; selenium, 28.3 ± 18.1 μg; and iron, 7.2 ± 4.1 mg (7.8 ± 2.6 mg in women, 6.9 ± 2.4 mg in men). The distribution of patients by daily intakes of trace elements showed most were under the recommended values, with the exception of copper intake, which was much higher. Mean daily intakes of minerals were as follows: magnesium, 174.4 ± 94.3 mg; phosphorus, 842.6 ± 576.8 mg; calcium, 371.8 ± 363.7 mg; potassium, 1,616.2 ± 897.3 mg; and sodium, 1,350 ± 1,281 mg. Mean daily intakes of vitamins were as follows: vitamin A, 486.1 ± 544.6 μg; vitamin B1, 0.86 ± 0.7 mg; vitamin B2, 1.1 ± 0.7 mg; vitamin B3, 13.3 ± 8.1 mg; vitamin C, 47.8 ± 50.3 mg; and vitamin E, 9.5 ± 3.6 mg. The distribution of patients by daily intakes of vitamins showed most were under the recommended values. Daily intakes of trace elements and vitamins were similar among the three centers and did not differ between dialysis and non-dialysis days. Many HDP have daily dietary intakes of trace elements and vitamins below the recommended values, whereas the intake of copper is much higher.

Effects of the histamine H₃ receptor antagonist ABT-239 on cognition and nicotine-induced memory enhancement in mice.

PubMed

Kruk, Marta; Miszkiel, Joanna; McCreary, Andrew C; Przegaliński, Edmund; Filip, Małgorzata; Biała, Grażyna

2012-01-01

The strong correlation between central histaminergic and cholinergic pathways on cognitive processes has been reported extensively. However, the role of histamine H(3) receptor mechanisms interacting with nicotinic mechanisms has not previously been extensively investigated. The current study was conducted to determine the interactions of nicotinic and histamine H(3) receptor systems with regard to learning and memory function using a modified elevated plus-maze test in mice. In this test, the latency for mice to move from the open arm to the enclosed arm (i.e., transfer latency) was used as an index of memory. We tested whether ABT-239 (4-(2-{2-[(2R)-2-methylpyrrolidinyl]ethyl}-benzofuran-5-yl), an H(3) receptor antagonist/inverse agonist, had influence on two different stages of memory, i.e., memory acquisition and consolidation (administered prior to or immediately after the first trial, respectively) and whether ABT-239 influenced nicotine-induced memory enhancement. Our results revealed that the acute administration of nicotine (0.035 and 0.175 mg/kg), but not of ABT-239 (0.1-3 mg/kg) reduced transfer latency in the acquisition and consolidation phases. In combination studies, concomitant administration of either ABT-239 (1 and 3 mg/kg) and nicotine (0.035 mg/kg), or ABT-239 (0.1 mg/kg) and nicotine (0.0175 mg/kg) further increased nicotine-induced improvement in both memory acquisition and consolidation. The present data confirm an important role for H(3) receptors in regulating nicotine-induced mnemonic effects since inhibition of H(3) receptors augmented nicotine-induced memory enhancement in mice.

Inhibition effects of high calcium concentration on anaerobic biological treatment of MSW leachate.

PubMed

Xia, Yi; He, Pin-Jing; Pu, Hong-Xia; Lü, Fan; Shao, Li-Ming; Zhang, Hua

2016-04-01

With the increasing use of municipal solid waste incineration (MSWI) and more stringent limits on landfilling of organic waste, more MSWI bottom ash is being landfilled, and the proportion of inorganic wastes in landfills is increasing, causing the increased Ca concentrations in landfill leachate. In this research, the inhibition effect of Ca concentration on the anaerobic treatment of landfill leachate was studied using a biochemical methane potential experiment. Slight inhibition of methane production occurred when the addition of Ca concentration was less than 2000 mg/L. When the addition of Ca concentration was between 6000 and 8000 mg/L, methane production was significantly reduced (to 29.4-34.8 % of that produced by the BLK reactor), and the lag phase was increased from 8.55 to 16.32 d. Moreover, when the dosage of Ca concentration increased from zero to 8000 mg/L, reductions in solution Ca concentration increased from 929 to 2611 mg/L, and the proportion of Ca in the residual sludge increased from 22.58 to 46.87 %. Based on the results, when the dosage of Ca concentration was less than 4000 mg/L, the formation of Ca precipitates on the surface of sludge appeared to prevent mass transfer and was the dominant reason for the reduction in methane production and sludge biomass. At higher Ca concentrations (6000-8000 mg/L), the severe inhibition of methane production appeared to be caused by the toxic effect of highly concentrated Ca on sludge as well as mass transfer blockage.

Mechanisms for Magnesium Isotopic Variation in Low-grade Metamorphosed Mudrocks from the British Caledonides

NASA Astrophysics Data System (ADS)

Wang, S.; Teng, F.; Rudnick, R. L.; Li, S.

2013-12-01

We report Mg isotope ratios for low-grade metamorphosed mudrocks from three lower Paleozoic basins (northern Lake District, southern Lake District and Southern Uplands) in the British Caledonides, previously analyzed for Li, Sr and Nd isotopes (Qiu et al., 2009, GCA), with the aim of understanding the behavior of Mg isotopes during subgreenschist-facies metamorphism, and the processes responsible for Mg isotopic variations in mudrocks. The δ26Mg of mudrocks varies greatly from -0.754 to 0.251, and displays no correlation with metamorphic grade, which ranges from diagenesis to subgreenschist-facies. Thus, low-grade metamorphism has no apparent influence on Mg isotopes. The variations instead likely reflect their provenance and mineralogical components. Samples from the northern Lake District, previously interpreted to derive from ancient, heavily weathered crust have δ26Mg (-0.06 × 0.11 on average) significantly heavier than that of average upper continental crust (~ -0.22), which is consistent with this interpretation. By contrast, mudrocks from the southern Lake District are characterized by low δ26Mg values (from -0.754 to -0.093) that require the presences of an unusually light component. The previously inferred provenance for these rocks of upper continental crust and arc volcanic detritus cannot explain such light isotopic compositions. Rather, such values may reflect the presence of carbonate in these samples and uptake of sea water Mg. Samples from the Southern Uplands, which contain the heaviest Li isotopes and ɛNd, and contain volcanic arc detritus, display Mg isotopic compositions divergent from a 'normal' mantle value (-0.25) towards both high and low δ26Mg values (from -0.742 to -0.079). Therefore, these mudrocks must contain a minimum of three end-members: mature felsic upper continental crust, arc lavas and carbonate. Given that limited Mg isotope fractionation occurs during low-grade metamorphism, Mg isotopes could be a potential tracer of provenance as well as carbonate involvement for fine-grained terrigenous sediments.

Impact of Empagliflozin on Blood Pressure in Patients With Type 2 Diabetes Mellitus and Hypertension by Background Antihypertensive Medication.

PubMed

Mancia, Giuseppe; Cannon, Christopher P; Tikkanen, Ilkka; Zeller, Cordula; Ley, Ludwin; Woerle, Hans J; Broedl, Uli C; Johansen, Odd Erik

2016-12-01

In the EMPA-REG BP trial, empagliflozin 10 mg and 25 mg once daily reduced glycohemoglobin, blood pressure (BP), and weight versus placebo in patients with type 2 diabetes mellitus and hypertension. Patients received placebo (n=271), empagliflozin 10 mg (n=276), or empagliflozin 25 mg (n=276) for 12 weeks (n=full analysis set). This present analysis investigated changes from baseline to week 12 in mean 24-hour systolic BP (SBP) and diastolic BP (DBP) in patients receiving 0, 1, or ≥2 antihypertensive medications and patients receiving/not receiving diuretics or angiotensin-converting enzyme inhibitors/angiotensin receptor blockers. Compared with placebo, empagliflozin 10 mg and 25 mg reduced mean 24-hour SBP/DBP in patients receiving 0 (10 mg: -3.89/-2.58 mm Hg; 25 mg: -3.77/-2.45 mm Hg), 1 (10 mg: -4.74/-1.97 mm Hg; 25 mg: -4.27/-1.81 mm Hg), or ≥2 (10 mg: -2.36/-0.68 mm Hg; 25 mg: -4.17/-1.54 mm Hg) antihypertensives. The effect of empagliflozin was not significantly different between subgroups by number of antihypertensives for changes in SBP (interaction P value 0.448) or DBP (interaction P value 0.498). Empagliflozin reduced 24-hour mean SBP/DBP irrespective of diuretic or angiotensin-converting enzyme inhibitor/angiotensin receptor blocker use, with no significant difference between subgroups by use/no use of diuretics (interaction P values 0.380 [systolic]; 0.240 [diastolic]) or angiotensin-converting enzyme inhibitors/angiotensin receptor blockers (interaction P values 0.900 [systolic]; 0.359 [diastolic]). In conclusion, in patients with type 2 diabetes mellitus and hypertension, empagliflozin for 12 weeks reduced SBP and DBP versus placebo, irrespective of the number of antihypertensives and use of diuretics or angiotensin-converting enzyme inhibitors/angiotensin receptor blockers. URL: https://clinicaltrials.gov. Unique identifier: NCT01370005. © 2016 American Heart Association, Inc.

Dietary risk evaluation for 28 polycyclic aromatic hydrocarbons (PAHs) in tea preparations made of teas available on the Polish retail market.

PubMed

Roszko, Marek; Kamińska, Marta; Szymczyk, Krystyna; Jędrzejczak, Renata

2018-01-02

The aim of this work was to assess dietary risk resulting from consumption of polycyclic aromatic hydrocarbons (PAHs) with tea infusions. To this end, levels of 28 PAHs in black, green, red and white teas available on the Polish retail market have been assessed. Profiles and correlation between concentrations of individual PAHs have been identified. A model study on transfer of PAHs from tea leaves into tea preparations has been conducted. Relatively high concentrations of 28 evaluated PAHs have been found in 58 tested samples of black, green, red and white teas sampled on the Polish retail market. Total concentration ∑28PAH ranged from 57 to 696 µg kg -1 with mean 258 µg kg -1 (dry tea leaves). The most mature tea leaves fermented to a small degree contained relatively the highest PAH levels among all four tested tea types. Relatively low PAH transfer rates into tea infusions and limited volumes of the consumed tea keep the risks associated with PAH dietary intake at a safely low level. The worst-case scenario dietary intake values were 7.62/0.82/0.097 ng kg -1 b.w. day -1 (estimated on the basis of the maximum found concentrations 696/113/23 µg kg -1 and maximum observed transfer rates 24/16/9%) for ∑28PAH/∑PAH4/B[a]P, respectively. MOE values calculated using the above worst case estimates exceeded 700,000 and 400,000 (BMDL 10 0.07 and 0.34 mg kg -1 b.w. day -1 ) for B[a]P and PAH4, respectively. Both B[a]P and PAH4 concentrations may be used as indicators of total PAH concentration in tea leaves; PAH4 slightly better fits low molecular weight PAHs. Several correlations between various PAHs/groups of PAHs have been identified, the strongest one (R 2 = 0.92) between PAH4 and EU PAH 15+1.

Microembossing of ultrafine grained Al: microstructural analysis and finite element modelling

NASA Astrophysics Data System (ADS)

Qiao, Xiao Guang; Bah, Mamadou T.; Zhang, Jiuwen; Gao, Nong; Moktadir, Zakaria; Kraft, Michael; Starink, Marco J.

2010-10-01

Ultra-fine-grained (UFG) Al-1050 processed by equal channel angular pressing and UFG Al-Mg-Cu-Mn processed by high-pressure torsion (HPT) were embossed at both room temperature and 300 °C, with the aim of producing micro-channels. The behaviour of Al alloys during the embossing process was analysed using finite element modelling. The cold embossing of both Al alloys is characterized by a partial pattern transfer, a large embossing force, channels with oblique sidewalls and a large failure rate of the mould. The hot embossing is characterized by straight channel sidewalls, fully transferred patterns and reduced loads which decrease the failure rate of the mould. Hot embossing of UFG Al-Mg-Cu-Mn produced by HPT shows a potential of fabrication of microelectromechanical system components with micro channels.

Interfacial oxygen migration and its effect on the magnetic anisotropy in Pt/Co/MgO/Pt films

DOE Office of Scientific and Technical Information (OSTI.GOV)

Chen, Xi; Feng, Chun, E-mail: fengchun@ustb.edu.cn, E-mail: ghyu@mater.ustb.edu.cn; Liu, Yang

2014-02-03

This paper reports the interfacial oxygen migration effect and its induced magnetic anisotropy evolution in Pt/Co/MgO/Pt films. During depositing the MgO layer, oxygen atoms from the MgO combine with the neighboring Co atoms, leading to the formation of CoO at the Co/MgO interface. Meanwhile, the films show in-plane magnetic anisotropy (IMA). After annealing, most of the oxygen atoms in CoO migrate back to the MgO layer, resulting in obvious improvement of Co/MgO interface and the enhancement of effective Co-O orbital hybridization. These favor the evolution of magnetic anisotropy from IMA to perpendicular magnetic anisotropy (PMA). The oxygen migration effect ismore » achieved by the redox reaction at the Co/MgO interface. On the contrary, the transfer from IMA to PMA cannot be observed in Pt/Co/Pt films due to the lack of interfacial oxygen migration.« less

Serum cystatin C: a surrogate marker for the characteristics of peritoneal membrane in dialysis patients.

PubMed

Al-Wakeel, Jamal S; Hammad, Durdana; Memon, Nawaz Ali; Tarif, Nauman; Shah, Iqbal; Chaudhary, Abdulrauf

2009-03-01

To evaluate whether cystatin C levels can be a surrogate marker of creatinine clearance and reflect the characteristics of peritoneal membrane in dialysis patients, we performed peritoneal equilibration tests (PET) in 18 anuric adult chronic peritoneal dialysis (PD) patients with a mean age of 39.7 +/- 20 years. All the samples were analyzed for urea, creatinine, and cystatin C. Peritoneal transport, mass transfer, and peritoneal clearance of cystatin C were calculated. Correlation and regression analysis was done using cystatin C as a dependent variable and age, sex, height, weight, body surface area, and creatinine as independent variables. Cystatin C demonstrated a significant time dependent increase of dialysate concentration and decline in the serum concentrations during PET, and a strong correlation between serum creatinine and serum cystatin C concentrations(r: 0.62, p= 0.008). The trans-peritoneal clearance (mL/min/1.73 m 2 ) of cystatin C was related to its serum concentration and was similar to creatinine in its pattern but of smaller magnitude. Peritoneal mass transfer (mg/4 hr per 1.73 m 2 ) for cystatin C serum creatinine was 1.68 +/- 0.67 and 73.3 +/- 29.8, respectively. The dialysis/plasma D/P cystatin C concentration was > or = 0.1 at 4 hrs of PET denoted high peritoneal transport, while the values of < 0.1 denoted low transport type. We conclude that cystatin C follows the same pattern of peritoneal exchange as creatinine but the magnitude of transfer is many folds lower than creatinine. At present clinical utility of cystatin C in the evaluation of solute clearance is probably limited due to the minute amounts transferred across the membrane and the high renal clearance in the presence of residual renal function.

Metal speciation in soil and health risk due to vegetables consumption in Bangladesh.

PubMed

Islam, Md Saiful; Ahmed, Md Kawser; Habibullah-Al-Mamun, Md

2015-05-01

This study was conducted to investigate the contamination level of heavy metals in soil and vegetables, chemical speciation, and their transfer to the edible part of vegetables. Metals were analyzed using inductively coupled plasma mass spectrometer (ICP-MS). The ranges of Cr, Ni, Cu, As, Cd, and Pb in agricultural soils were 3.7-41, 3.9-36, 3.7-46, 2.3-26, 0.6-13, and 4.5-32 mg/kg, respectively. The metals were predominantly associated with the residual fractions of 39, 41, 40, 40, 34, and 41 % for Cr, Ni, Cu, As, Cd, and Pb, respectively. Considering the metal transfer from soil to the edible part of vegetables, the mean transfer factors (TFs) were in the descending order of Cu > Ni > Cr > Pb > As > Cd. In the edible tissues of vegetables, the concentrations of As, Cd, and Pb in most vegetable samples exceeded the maximum permissible levels, indicating not safe for human consumption. Total target hazard quotient (THQ) of the studied metals (except Cr) from all vegetables were higher than 1, indicated that if people consume these types of vegetables in their diet, they might pose risk to these metals. Total values of carcinogenic risk (CR) were 3.2 for As and 0.15 for Pb which were higher than the US Environmental Protection Agency (USEPA) threshold level (0.000001), indicating that the inhabitants consuming these vegetables are exposed to As and Pb with a lifetime cancer risk.

Level of endogenous formaldehyde in maple syrup as determined by spectrofluorimetry.

PubMed

Lagacé, Luc; Guay, Stéphane; Martin, Nathalie

2003-01-01

The level of endogenous formaldehyde in maple syrup was established from a large number (n = 300) of authentic maple syrup samples collected during 2000 and 2001 in the province of Quebec, Canada. The average level of formaldehyde from these authentic samples was measured at 0.18 mg/kg in 2000 and 0.28 mg/kg in 2001, which is lower than previously published. These average values can be attributed to the improved spectrofluorimetric method used for the determination. However, the formaldehyde values obtained demonstrate a relatively large distribution with maximums observed at 1.04 and 1.54 mg/kg. These values are still under the maximum tolerance level of 2.0 mg/kg paraformaldehyde pesticide residue. Extensive heat treatment of maple syrup samples greatly enhanced the formaldehyde concentration of the samples, suggesting that extensive heat degradation of the sap constituents during evaporation could be responsible for the highest formaldehyde values in maple syrup.

The effect of weight, body mass index, age, sex, and race on plasma concentrations of subcutaneous sumatriptan: a pooled analysis.

PubMed

Munjal, Sagar; Gautam, Anirudh; Rapoport, Alan M; Fisher, Dennis M

2016-01-01

Factors such as body size (weight and body mass index [BMI]), age, sex, and race might influence the clinical response to sumatriptan. We evaluated the impact of these covariates on the plasma concentration (Cp) profile of sumatriptan administered subcutaneously. We conducted three pharmacokinetic studies of subcutaneous sumatriptan in 98 healthy adults. Sumatriptan was administered subcutaneously (236 administrations) as either DFN-11 3 mg, a novel 0.5 mL autoinjector being developed by Dr. Reddy's Laboratories; Imitrex(®) (Sumatriptan) injection 3 mg or 6 mg (6 mg/0.5 mL); or Imitrex STATdose 4 mg or 6 mg (0.5 mL). Blood was sampled for 12 hours to determine sumatriptan Cp. Maximum Cp (Cmax), area under the curve during the first 2 hours (AUC0-2), and total area under the curve (AUC0-∞) were determined using noncompartmental methods. Post hoc analyses were conducted to determine the relationship between these exposure metrics and each of body weight, BMI, age, sex, and race (categorized as white, black, or others). Both weight and BMI correlated negatively with each exposure metric for each treatment group. Across all treatment groups, AUC0-2 for subjects with BMI less than or equal to median value was 1.03-1.12 times the value for subjects with BMI more than median value. For subjects with BMI less than or equal to median value receiving DFN-11, median AUC0-2 was slightly less than that for subjects with BMI more than median value receiving Imitrex 4 mg and larger than that for subjects with BMI more than median value receiving Imitrex 3 mg. Results were similar for the other exposure metrics and for weight. Exposure was higher in women than in men, which can be attributed in part to differences in weight. There was no relationship between exposure and age. For DFN-11, AUC0-2 and AUC0-∞ were lower in nonwhites compared with whites; the ratio of median values was 0.84 and 0.89, respectively. A similar, nonstatistically significant, trend was observed in the other products (ratio of median values ranging from 0.84 to 0.89). Weight and BMI appear to be important covariates for sumatriptan exposure: subjects with lower values for either metric of body size have higher systemic exposure compared with subjects with higher values. Additional studies are required to determine if doses of subcutaneous sumatriptan may be adjusted based on BMI for comparable efficacy and a potentially improved tolerability profile.

Effect of Cold Rolling on Age Hardening in Excess Mg-Type Al-Mg-Si Alloys Including Some Minor Elements

NASA Astrophysics Data System (ADS)

Ogawa, Yurie; Matsuda, Kenji; Kawabata, Tokimasa; Uetani, Yasuhiro; Ikeno, Susumu

It has been known that transition metals improve the mechanical property of Al-Mg-Si alloy. The thermo-mechanical treatment is also effective to improve the strength of Al-Mg-Si alloy. In this work, the aging behavior of deformed excess Mg-type Al-Mg-Si alloy including Ag,Cu,Pt was investigated by hardness test and TEM observation. The value of the maximum hardness increased and the aging time to the maximum hardness became shorter by increasing the amount of the deformation. The age-hardening ability (ΔHV) was decreased with increasing amount of the deformation. The effect of additional element on AHV was also similar to the result of the deformation described above. Comparing the value of the maximum hardness for the alloys aged at 423-523 K, the ex. Mg-Cu alloy was the highest, the ex. Mg-Ag alloy was middle, and the ex. Mg and ex. Mg-Pt alloys were the lowest because of total amounts of added elements.

26 CFR 1.367(d)-1T - Transfers of intangible property to foreign corporations (temporary).

Code of Federal Regulations, 2014 CFR

2014-04-01

... limited election to treat certain transfers of intangible property as sales at fair market value (in lieu... accordance with the provisions of section 482 and regulations thereunder. See § 1.482-2(d). The amount of the... United States in an amount equal to the difference between the fair market value of the transferred...

26 CFR 1.367(d)-1T - Transfers of intangible property to foreign corporations (temporary).

Code of Federal Regulations, 2012 CFR

2012-04-01

... limited election to treat certain transfers of intangible property as sales at fair market value (in lieu... accordance with the provisions of section 482 and regulations thereunder. See § 1.482-2(d). The amount of the... United States in an amount equal to the difference between the fair market value of the transferred...

26 CFR 1.367(d)-1T - Transfers of intangible property to foreign corporations (temporary).

Code of Federal Regulations, 2013 CFR

2013-04-01

... limited election to treat certain transfers of intangible property as sales at fair market value (in lieu... accordance with the provisions of section 482 and regulations thereunder. See § 1.482-2(d). The amount of the... United States in an amount equal to the difference between the fair market value of the transferred...

Use of octopus as a bioindicator species: Baseline studies

DOE Office of Scientific and Technical Information (OSTI.GOV)

Holdway, D.A.; Butty, J.S.; Brennan, S.E.

1995-12-31

The Australian octopus Octopus pallidus, is abundant, territorial, has a large digestive gland. This study was undertaken to assess octopii as a potential bioindicator species by establishing the efficacy of capturing octopi using traplines, and determining the impact of various modifying factors on the activities of digestive gland mixed-function oxidase (MFO) enzymes including ethoxyresorufin O-deethylase (EROD), ethoxycoumarin O-deethylase (ECOD) and total P-450. Trap success rates in Port Phillip Bay were 15--28% for the ``potentially contaminated`` site and 85% for the reference site. Cytochrome P-450 showed significant seasonal differences, with no site or sex differences. Mean ({+-} SE) Autumn P-450 valuesmore » of 74.8 ({+-}5.5) pmol/mg protein were higher than Winter values of 51.2 ({+-}7.6), which were higher than Spring values of 21.8 ({+-}4.0) pmol/mg protein. Summer P-450 values of 61.4 ({+-} 9.8) pmol/mg protein were only different from Spring values. Mean ({+-} SE) Spring ECOD activity of 3.3 ({+-} 0.7) pmol/min/mg protein was lower than Summer, Autumn and Winter ECOD values of 8.9 ({+-} 1.6) 6.5 ({+-} 1.2) and 8.6 ({+-} 2.3) pmol/min/mg protein respectively. Females had roughly half the ECOD activities of males (3.8 {+-} 0.8 compared to 7.4 {+-} 0.9 pmol/min/mg protein). All octopi digestive gland EROD activities were low (roughly 0.2 pmol/min/mg protein) with no sex, site nor seasonal differences. Potential for using octopus as a bioindicator appears promising but sensitivity to chemical exposure has yet to be determined.« less

[Amorphous silica. Types, health effects of exposure, NDS].

PubMed

Woźniak, H; Wiecek, E

1995-01-01

Maximum allowable concentration (MAC) values for amorphous silica dust have not been identified in the Polish legal regulations up-to-date. In this work the authors review values of allowable (recommended) amorphous silica dust concentrations in other countries. Data on other types of amorphous silica (natural and synthetic) used in industry as well as data on health effects of exposure to these types of dust are presented. The work encompasses 42 entries in the references and one Table which includes the following proposed MAC values: Non-calcinate diatomaceous earth (diatomite) and synthetic silica: Total dust--10 mg/m3 Respirable dust--2 mg/m3 Calcinate diatomaceous earth (diatomite) and fused silica (vitreous silica): Total dust--2 mg/m3 Respirable dust--1 mg/m3.

12 CFR 360.6 - Treatment of financial assets transferred in connection with a securitization or participation.

Code of Federal Regulations, 2012 CFR

2012-01-01

... or market value characteristics and the credit quality of transferred financial assets (together with... with maximizing the net present value of the financial asset. Servicers shall have the authority to modify assets to address reasonably foreseeable default, and to take other action to maximize the value...

Biogeochemical cycling of Mg and its isotopes in a sugar maple forest in Québec

NASA Astrophysics Data System (ADS)

Kimmig, Sara R.; Holmden, Chris; Bélanger, Nicolas

2018-06-01

A Mg isotope study of sugar maple (Acer saccharum Marsh.) in a field site in southern Québec, Canada, and seedlings grown in sterile soil substrate in the laboratory, both demonstrate per mil level within-tree Mg isotope fractionation. However, only sugar maple seedlings grown in the laboratory fractionate Mg isotopes during uptake into fine roots, favoring heavy isotope enrichment in the plant compared to the growth medium. Absence of uptake-related Mg isotope fractionation in field stands of sugar maple is tentatively attributed to the activities of the arbuscular mycorrhizal fungi that colonize fine roots of the trees in the field, but were absent from the laboratory grown specimens. The fungi facilitate nutrient uptake for the tree, while the tree provides valuable carbohydrates to the fungi. Without the symbiotic fungi, pot-grown trees in the laboratory are visibly stressed and often die. The mechanisms responsible for Mg isotopic fractionation in stressed trees remain to be elucidated. Rivers are isotopically light compared to bedrock weathering sources of Mg, and this has bearing on the δ26Mg value of the continental weathering flux of Mg to the oceans, which is an important parameter in studies of ocean Mg cycling in the geological past. If uptake-related fractionation is negligible in many other naturally growing tree species, as it is in sugar maple, then forest growth will exert little or no influence on the δ26Mg value of the export flux of Mg to first-order streams and rivers, and in turn the ocean Mg cycle. Above the tree line, preferential retention of heavy Mg isotopes in clay minerals formed during silicate weathering has been linked to the low δ26Mg values in rivers. In the forested catchment of this study there is no clear evidence for these effects. The 1 N HNO3 leach of the Bf-BC and C mineral soils, which are often used to identify minerals that may be releasing Mg and other base cations to plant-available pools, have the same average δ26Mg value (-0.66‰, n = 2) as the litter layer and exchangeable leach of the forest floor, all soil solutions, and the stream (-0.63 ± 0.17‰ 2σ, n = 23). More revealing is the molar Mg/Ca ratio of the 1 N HNO3 treatment (0.17), which is nearly identical to the bulk Mg/Ca ratio of the aboveground biomass (0.14). We conclude that the 1 N HNO3 leach in this setting releases Mg from secondary minerals, such as vermiculite, other clays, and amorphous phases, which have taken up plant-recycled Mg and Ca that has filtered down through the soil from the litter layer of the forest floor. A single mineral, chlorite, with an estimated δ26Mg value of -0.78‰, appears to be responsible for supplying most of the Mg that is circulating between the forest and soils in this setting, which is weathered and cached over timescales of thousands of years.

The Combination of Antidepressant Duloxetine with Piracetam in Mice does not Produce Enhancement of Nootropic Activity.

PubMed

Kale, Pravin Popatrao; Addepalli, Veeranjaneyulu; Sarkar, Amrita; Patel, Sonam; Savai, Jay

2014-09-01

There is a strong association between depression and memory impairment. The present study aims to assess the nootropic activity of duloxetine and piracetam combination. Male Swiss Albino mice were divided randomly into 4 groups. Treatment of normal saline (10 ml/kg), duloxetine (10 mg/kg), piracetam (100 mg/kg), and duloxetine (5 mg/kg) plus piracetam (50 mg/kg) were given through intra-peritoneal route to group I-IV, respectively. Transfer latency in elevated plus maze (EPM) and time spent in target quadrant in Morris water maze (MWM) were recorded. Estimation of brain monoamines in hippocampus, cerebral cortex, and whole brain were done using HPLC with fluorescence detector. Piracetam treated group showed significant decrease in transfer latency in EPM and increase in time spent in target quadrant recorded in MWM. Combination treated group failed to produce statistically significant nootropic effect in both EPM and MWM. Combination treated group failed to increase brain monoamine levels when compared against duloxetine and piracetam treated groups, separately. But there was exception of significant increase in norepinephrine levels in hippocampi when compared against duloxetine treated group. Results indicate no cognitive benefits with piracetam plus duloxetine combination. These findings can be further probed with the aim of understanding the interaction between duloxetine and piracetam as a future endeavor.

Determination of as-discarded methane potential in residential and commercial municipal solid waste.

PubMed

Chickering, Giles W; Krause, Max J; Townsend, Timothy G

2018-06-01

Methane generation potential, L 0 , is a primary parameter of the first-order decay (FOD) model used for prediction and regulation of landfill gas (LFG) generation in municipal solid waste (MSW) landfills. The current US EPA AP-42 default value for L 0 , which has been in place for almost 20 years, is 100 m 3 CH 4 /Mg MSW as-discarded. Recent research suggests the yield of landfilled waste could be less than 60 m 3 CH 4 /Mg MSW. This study aimed to measure the L 0 of present-day residential and commercial as-discarded MSW. In doing so, 39 waste collection vehicles were sorted for composition before samples of each biodegradable fraction were analyzed for methane generation potential. Methane yields were determined for over 450 samples of 14 different biodegradable MSW fractions, later to be combined with moisture content and volatile solids data to calculate L 0 values for each waste load. An average value of 80 m 3 CH 4 /Mg MSW was determined for all samples with 95% of values in the interval 74-86 m 3 CH 4 /Mg MSW as-discarded. While no statistically significant difference was observed, commercial MSW yields (mean 85, median 88 m 3 CH 4 /Mg MSW) showed a higher average L 0 than residential MSW (mean 75, median 71 m 3 CH 4 /Mg MSW). Many methane potential values for individual fractions described in previous work were found within the range of values determined by BMP in this study. Copyright © 2018 Elsevier Ltd. All rights reserved.

Toxic effects of magnesium oxide nanoparticles on early developmental and larval stages of zebrafish (Danio rerio).

PubMed

Ghobadian, Mehdi; Nabiuni, Mohammad; Parivar, Kazem; Fathi, Mojtaba; Pazooki, Jamileh

2015-12-01

Magnesium oxide nanoparticles (MgONPs) are used in medicine, manufacturing and food industries. Because of their extensive application in our daily lives, environmental exposure to these nanoparticles is inevitable. The present study examined the effects of MgONPs on zebrafish (Danio rerio) early developmental stages. The results showed that, at different concentrations, MgONPs induced cellular apoptosis and intracellular reactive oxygen species. The hatching rate and survival of embryos decreased in a dose dependent manner. The 96-h LC50 value of MgONPs on zebrafish survival was 428 mg/l and the 48-h EC50 value of MgONPs on zebrafish embryo hatching rate was 175 mg/l. Moreover different types of malformation were observed in exposed embryos. The results demonstrate the toxic effects of MgONPs on zebrafish embryos and emphasize the need for further studies. Copyright © 2015 Elsevier Inc. All rights reserved.

High Bolus Tirofiban vs Abciximab in Acute STEMI Patients Undergoing Primary PCI – The Tamip Study

PubMed Central

Balghith, Mohammed A.

2012-01-01

Background: Primary percutaneous coronary intervention (PCI) has been shown to be an effective therapy for patients with acute myocardial infarction (MI). Glycoprotein (GP) IIb/IIIa receptor blockers reduce thrombotic complications in patients undergoing PCI. Most available data relate to Reopro, which has been registered for this indication. GP IIb/IIIa reduce unfavorable outcome in U/A and non ST-elevation myocardial infarction (STEMI) patients. Only few studies focused on high dose Aggrastat for STEMI patients in the emergency department (ED) before PCI. The aim is to increase the patency during the time awaiting coronary angioplasty in patients with acute MI. Objectives: To study the effect of upfront high bolus dose (HDR) of tirofiban on the extent of residual ST segment deviation 1 hour after primary PCI and the incidence of TIMI 3 flow of the infarct-related artery (IRA). Materials and Methods: A randomized, open label, single center study in the ED. A total of 90 patients with acute ST-elevation MI, diagnosed clinically by ECG criteria (ST segment elevation of >2 mm in two adjacent ECG leads), and with an expectation that a patient will undergo primary PCI. Patients were aged 21-85 years and all received heparin 5000 u, aspirin 160 mg, and Plavix 600 mg. Patients were divided in two groups (group I: triofiban high bolus vs group II: Reopro) with 45 patients in each group. In group I, high bolus triofiban 25 mcg/kg over 3 min was started in the ED with maintenance infusion of 0.15 mcg/ kg/min continued for 12 hours and transferred to cath lab for PCI. Patients in group II were transferred to cath lab, where a standard dose of Reopro was given with a bolus of 0.25 mcg/kg and maintenance infusion of 0.125 mcg/kg/min over 12 hours. Results: ST segment resolution and TIMI flow were evaluated in both groups before and after PCI. Thirty-five patients (78%) enrolled in group I and 29 patients (64%) in group II had resolution of ST segment (P-value 0.24). Twenty-one patients (47% group I) vs 23 patients (51% group II) with P-value 0.83 achieved TIMI 0 flow. Twenty-four patients (53% group I) compared with 22 patients (49% group II) with P-value 0.83 had TIMI 1 to 3 flow before PCI. TIMI 3 flow was achieved in 40 patients (89% group I) compared with 38 patients (84% group II) with P-value 0.76. Conclusion: In this study there was a trend toward better ST segment resolution and patency of IRA (i.e., improved TIMI flow) in patients given high bolus dose Aggrastat in the ED. Larger studies are needed to confirm this finding. PMID:23181175

Antimicrobial Susceptibility of Bacillus Strains Isolated from Primary Starters for African Traditional Bread Production and Characterization of the Bacitracin Operon and Bacitracin Biosynthesis

PubMed Central

Sørensen, Kim I.; Thorsen, Line; Stuer-Lauridsen, Birgitte; Abdelgadir, Warda S.; Nielsen, Dennis S.; Derkx, Patrick M. F.; Jespersen, Lene

2012-01-01

Bacillus spp. are widely used as feed additives and probiotics. However, there is limited information on their resistance to various antibiotics, and there is a growing concern over the transfer of antibiotic resistance genes. The MIC for 8 antibiotics was determined for 85 Bacillus species strains, Bacillus subtilis subsp. subtilis (n = 29), Bacillus licheniformis (n = 38), and Bacillus sonorensis (n = 18), all of which were isolated from starters for Sudanese bread production. All the strains were sensitive to tetracycline (8.0 mg/liter), vancomycin (4.0 mg/liter), and gentamicin (4.0 mg/liter) but resistant to streptomycin. Sensitivity to clindamycin, chloramphenicol, and kanamycin was species specific. The erythromycin resistance genes ermD and ermK were detected by PCR in all of the erythromycin-resistant (MIC, ≥16.0 mg/liter) B. licheniformis strains and one erythromycin-sensitive (MIC, 4.0 mg/liter) B. licheniformis strain. Several amino acid changes were present in the translated ermD and ermK nucleotide sequences of the erythromycin-sensitive strain, which could indicate ErmD and ErmK protein functionalities different from those of the resistance strains. The ermD and ermK genes were localized on an 11.4-kbp plasmid. All of the B. sonorensis strains harbored the bacitracin synthetase gene, bacA, and the transporter gene bcrA, which correlated with their observed resistance to bacitracin. Bacitracin was produced by all the investigated species strains (28%), as determined by ultra-high-definition quadrupole time-of-flight liquid chromatography-mass spectrometry (UHD-QTOF LC/MS). The present study has revealed species-specific variations in the antimicrobial susceptibilities of Bacillus spp. and provides new information on MIC values, as well as the occurrence of resistance genes in Bacillus spp., including the newly described species B. sonorensis. PMID:22941078

Antimicrobial susceptibility of Bacillus strains isolated from primary starters for African traditional bread production and characterization of the bacitracin operon and bacitracin biosynthesis.

PubMed

Adimpong, David B; Sørensen, Kim I; Thorsen, Line; Stuer-Lauridsen, Birgitte; Abdelgadir, Warda S; Nielsen, Dennis S; Derkx, Patrick M F; Jespersen, Lene

2012-11-01

Bacillus spp. are widely used as feed additives and probiotics. However, there is limited information on their resistance to various antibiotics, and there is a growing concern over the transfer of antibiotic resistance genes. The MIC for 8 antibiotics was determined for 85 Bacillus species strains, Bacillus subtilis subsp. subtilis (n = 29), Bacillus licheniformis (n = 38), and Bacillus sonorensis (n = 18), all of which were isolated from starters for Sudanese bread production. All the strains were sensitive to tetracycline (8.0 mg/liter), vancomycin (4.0 mg/liter), and gentamicin (4.0 mg/liter) but resistant to streptomycin. Sensitivity to clindamycin, chloramphenicol, and kanamycin was species specific. The erythromycin resistance genes ermD and ermK were detected by PCR in all of the erythromycin-resistant (MIC, ≥16.0 mg/liter) B. licheniformis strains and one erythromycin-sensitive (MIC, 4.0 mg/liter) B. licheniformis strain. Several amino acid changes were present in the translated ermD and ermK nucleotide sequences of the erythromycin-sensitive strain, which could indicate ErmD and ErmK protein functionalities different from those of the resistance strains. The ermD and ermK genes were localized on an 11.4-kbp plasmid. All of the B. sonorensis strains harbored the bacitracin synthetase gene, bacA, and the transporter gene bcrA, which correlated with their observed resistance to bacitracin. Bacitracin was produced by all the investigated species strains (28%), as determined by ultra-high-definition quadrupole time-of-flight liquid chromatography-mass spectrometry (UHD-QTOF LC/MS). The present study has revealed species-specific variations in the antimicrobial susceptibilities of Bacillus spp. and provides new information on MIC values, as well as the occurrence of resistance genes in Bacillus spp., including the newly described species B. sonorensis.

Cow bones char as a green sorbent for fluorides removal from aqueous solutions: batch and fixed-bed studies.

PubMed

Nigri, Elbert M; Cechinel, Maria Alice P; Mayer, Diego A; Mazur, Luciana P; Loureiro, José M; Rocha, Sônia D F; Vilar, Vítor J P

2017-01-01

Cow bone char was investigated as sorbent for the defluoridation of aqueous solutions. The cow bone char was characterized in terms of its morphology, chemical composition, and functional groups present on the bone char surface using different analytical techniques: SEM, EDS, N 2 -BET method, and FTIR. Batch equilibrium studies were performed for the bone chars prepared using different procedures. The highest sorption capacities for fluoride were obtained for the acid washed (q = 6.2 ± 0.5 mg/g) and Al-doped (q = 6.4 ± 0.3 mg/g) bone chars. Langmuir and Freundlich models fitted well the equilibrium sorption data. Fluoride removal rate in batch system is fast in the first 5 h, decreasing after this time until achieving equilibrium due to pore diffusion. The presence of carbonate and bicarbonate ions in the aqueous solution contributes to a decrease of the fluoride sorption capacity of the bone char by 79 and 31 %, respectively. Regeneration of the F-loaded bone char using 0.5 M NaOH solution leads to a sorption capacity for fluoride of 3.1 mg/g in the second loading cycle. Fluoride breakthrough curve obtained in a fixed-bed column presents an asymmetrical S-shaped form, with a slow approach of C/C 0  → 1.0 due to pore diffusion phenomena. Considering the guideline value for drinking water of 1.5 mg F - /L, as recommended by World Health Organization, the service cycle for fluoride removal was of 71.0 h ([F - ] feed  ∼ 9 mg/L; flow rate = 1 mL/min; m sorbent  = 12.6 g). A mass transfer model considering the pore diffusion was able to satisfactorily describe the experimental data obtained in batch and continuous systems.

Tunable Luminescence in Sr2MgSi2O7:Tb3+, Eu3+Phosphors Based on Energy Transfer

PubMed Central

Li, Minhong; Wang, Lili; Ran, Weiguang; Deng, Zhihan; Shi, Jinsheng; Ren, Chunyan

2017-01-01

A series of Tb3+, Eu3+-doped Sr2MgSi2O7 (SMSO) phosphors were synthesized by high temperature solid-state reaction. X-ray diffraction (XRD) patterns, Rietveld refinement, photoluminescence spectra (PL), and luminescence decay curves were utilized to characterize each sample’s properties. Intense green emission due to Tb3+ 5D4→7F5 transition was observed in the Tb3+ single-doped SMSO sample, and the corresponding concentration quenching mechanism was demonstrated to be a diople-diople interaction. A wide overlap between Tb3+ emission and Eu3+ excitationspectraresults in energy transfer from Tb3+ to Eu3+. This has been demonstrated by the emission spectra and decay curves of Tb3+ in SMSO:Tb3+, Eu3+ phosphors. Energy transfer mechanism was determined to be a quadrupole-quadrupole interaction. And critical distance of energy transfer from Tb3+ to Eu3+ ions is calculated to be 6.7 Å on the basis of concentration quenching method. Moreover, white light emission was generated via adjusting concentration ratio of Tb3+ and Eu3+ in SMSO:Tb3+, Eu3+ phosphors. All the results indicate that SMSO:Tb3+, Eu3+ is a promising single-component white light emitting phosphor. PMID:28772587

Aspartame-fed zebrafish exhibit acute deaths with swimming defects and saccharin-fed zebrafish have elevation of cholesteryl ester transfer protein activity in hypercholesterolemia.

PubMed

Kim, Jae-Yong; Seo, Juyi; Cho, Kyung-Hyun

2011-11-01

Although many artificial sweeteners (AS) have safety issues, the AS have been widely used in industry. To determine the physiologic effect of AS in the presence of hyperlipidemia, zebrafish were fed aspartame or saccharin with a high-cholesterol diet (HCD). After 12 days, 30% of zebrafish, which consumed aspartame and HCD, died with exhibiting swimming defects. The aspartame group had 65% survivability, while the control and saccharin groups had 100% survivability. Under HCD, the saccharin-fed groups had the highest increase in the serum cholesterol level (599 mg/dL). Aspartame-fed group showed a remarkable increase in serum glucose (up to 125 mg/dL), which was 58% greater than the increase in the HCD alone group. The saccharin and HCD groups had the highest cholesteryl ester transfer protein (CETP) activity (52% CE-transfer), while the HCD alone group had 42% CE-transfer. Histologic analysis revealed that the aspartame and HCD groups showed more infiltration of inflammatory cells in the brain and liver sections. Conclusively, under presence of hyperlipidemia, aspartame-fed zebrafish exhibited acute swimming defects with an increase in brain inflammation. Saccharin-fed zebrafish had an increased atherogenic serum lipid profile with elevation of CETP activity. Copyright © 2011 Elsevier Ltd. All rights reserved.

Genetic stability and phytochemical analysis of the in vitro regenerated plants of Dendrobium nobile Lindl., an endangered medicinal orchid

PubMed Central

Bhattacharyya, Paromik; Kumaria, Suman; Diengdoh, Reemavareen; Tandon, Pramod

2014-01-01

An efficient genetically stable regeneration protocol with increased phytochemical production has been established for Dendrobium nobile, a highly prized orchid for its economic and medicinal importance. Protocorm like bodies (PLBs) were induced from the pseudostem segments using thidiazuron (TDZ; 1.5 mg/l), by-passing the conventional auxin–cytokinin complement approach for plant regeneration. Although, PLB induction was observed at higher concentrations of TDZ, plantlet regeneration from those PLBs was affected adversely. The best rooting (5.41 roots/shoot) was achieved in MS medium with 1.5 mg/l TDZ and 0.25% activated charcoal. Plantlets were successfully transferred to a greenhouse with a survival rate of 84.3%, exhibiting normal development. Genetic stability of the regenerated plants was investigated using randomly amplified polymorphic DNA (RAPD) and start codon targeted (SCoT) polymorphism markers which detected 97% of genetic fidelity among the regenerants. The PIC values of RAPD and SCoT primers were recorded to be 0.92 and 0.76 and their Rp values ranged between 3.66 and 10, and 4 and 12 respectively. The amplification products of the regenerated plants showed similar banding patterns to that of the mother plant thus demonstrating the homogeneity of the micropropagated plants. A comparative phytochemical analysis among the mother and the micropropagated plants showed a higher yield of secondary metabolites. The regeneration protocol developed in this study provides a basis for ex-situ germplasm conservation and also harnesses the various secondary metabolite compounds of medicinal importance present in D. nobile. PMID:25606433

Enhancement of nootropic effect of duloxetine and bupropion by caffeine in mice.

PubMed

Kale, Pravin Popatrao; Addepalli, Veeranjaneyulu

2015-01-01

The existing evidence suggests an association between depression and memory impairment. The objective of present study was to assess the effect of low dose caffeine with duloxetine and bupropion on memory. Mice were divided randomly into seven groups. Intra-peritoneal treatment of normal saline (10 ml/kg), caffeine (10 mg/kg), duloxetine (10 mg/kg), bupropion alone (10 mg/kg), caffeine + duloxetine (5 mg/kg, each), caffeine + bupropion (5 mg/kg, each), and bupropion + duloxetine (5 mg/kg, each) were given to groups I-VII, respectively. Elevated plus maze was used to evaluate transfer latency (TL) and Morris water maze was used to estimate the time spent in target quadrant. Caffeine with duloxetine treated group was better than other combination treated groups in terms of a significant decrease in TL and increase in the time spent in target quadrant recorded. Combining lower dose of caffeine with duloxetine may enhance cognitive benefits than respective monotherapies.

Mg,Ce co-doped Lu2Gd1(Ga,Al)5O12 by micro-pulling down method and their luminescence properties

NASA Astrophysics Data System (ADS)

Kamada, Kei; Yamaguchi, Hiroaki; Yoshino, Masao; Kurosawa, Shunsuke; Shoji, Yasuhiro; Yokota, Yuui; Ohashi, Yuji; Pejchal, Jan; Nikl, Martin; Yoshikawa, Akira

2018-04-01

The effects of Mg co-doping on the scintillation properties of Ce:Lu2Gd1(Ga,Al)5O12 (LGGAG) single crystals with different Ga/Al ratios were investigated. Mg co-doped and non co-doped Ce:LGGAG single crystals were grown by the micro-pulling down (µ-PD) method and then cut, polished and annealed for each measurement. Absorption spectra, radioluminescence (RL) spectra, pulse height spectra, and scintillation decay were measured to reveal the effect of Mg co-doping. Ce4+ charge transfer (CT) absorption band peaking at ∼260 nm was observed in Mg co-doped samples, which is in good agreement with previous reports for the Ce4+ CT absorption band in other garnet-based crystals. The scintillation decay time tended to be accelerated and the light yield tended to be decreased by Mg co-doping at higher Ga concentrations.

Investigation of the source of residual phthalate in sundried salt.

PubMed

Kim, Jin Hyo; Lee, Jin Hwan; Kim, So-Young

2014-03-01

Phthalate contamination in sundried salt has recently garnered interest in Korea. Phthalate concentrations were investigated in Korean sundried salts, source waters, and aqueous extracts from polyvinyl chloride materials used in salt ponds. Preliminary screening results for phthalates in Korean sundried salts revealed that only di(2-ethylhexyl)phthalate (DEHP) was over the limit of detection, with an 8.6% detection rate, and the concentration ranged from below the limit of detection to 0.189 mg/kg. The tolerable daily intake contribution ratio of the salt was calculated to be only 0.001%. Residual phthalates were below 0.026 mg/liter in source water, and the aqueous extracted di-n-butylphthalate, benzylbutylphthalate, and DEHP, which are considered endocrine disruptors, were below 0.029 mg/kg as derived from the polyvinyl chloride materials in salt ponds. The transfer ratios of the six phthalates from seawater to sundried salts were investigated; transfer ratio was correlated with vapor pressure (r(2) = 0.9875). Thus, di-n-butylphthalate, benzylbutylphthalate, DEHP, and di-n-octylphthalate can be considered highly likely residual pollutants in some consumer salts.

Milk iron content in breast-feeding mothers after administration of intravenous iron sucrose complex.

PubMed

Breymann, Christian; von Seefried, Bettina; Stahel, Michele; Geisser, Peter; Canclini, Camillo

2007-01-01

To study the transfer of parenteral iron sucrose into maternal milk in the postpartum period. Ten healthy lactating mothers with functional iron deficiency 2-3 days after delivery received 100 mg intravenous iron sucrose and were observed together with a control group (n=5) without iron treatment during four days. Milk samples were taken before the treatment and every day afterwards. Mean milk iron levels at baseline were 0.43 and 0.46 mg/kg in the treatment and control group and decreased until the end of observation in both groups by 0.11 mg/kg. No significant difference between the groups was found on any study day as well as in the mean change from baseline over all four days. We could not show transfer of iron-sucrose into maternal milk for the given dosage. Since parenteral iron sucrose is widely used in obstetrics, the results provide information about safety of parenteral iron sucrose in the lactation period. The findings are also in agreement with other reports on active biological mammary gland regulation of milk iron concentration.

Default values for assessment of potential dermal exposure of the hands to industrial chemicals in the scope of regulatory risk assessments.

PubMed

Marquart, Hans; Warren, Nicholas D; Laitinen, Juha; van Hemmen, Joop J

2006-07-01

Dermal exposure needs to be addressed in regulatory risk assessment of chemicals. The models used so far are based on very limited data. The EU project RISKOFDERM has gathered a large number of new measurements on dermal exposure to industrial chemicals in various work situations, together with information on possible determinants of exposure. These data and information, together with some non-RISKOFDERM data were used to derive default values for potential dermal exposure of the hands for so-called 'TGD exposure scenarios'. TGD exposure scenarios have similar values for some very important determinant(s) of dermal exposure, such as amount of substance used. They form narrower bands within the so-called 'RISKOFDERM scenarios', which cluster exposure situations according to the same purpose of use of the products. The RISKOFDERM scenarios in turn are narrower bands within the so-called Dermal Exposure Operation units (DEO units) that were defined in the RISKOFDERM project to cluster situations with similar exposure processes and exposure routes. Default values for both reasonable worst case situations and typical situations were derived, both for single datasets and, where possible, for combined datasets that fit the same TGD exposure scenario. The following reasonable worst case potential hand exposures were derived from combined datasets: (i) loading and filling of large containers (or mixers) with large amounts (many litres) of liquids: 11,500 mg per scenario (14 mg cm(-2) per scenario with surface of the hands assumed to be 820 cm(2)); (ii) careful mixing of small quantities (tens of grams in <1l): 4.1 mg per scenario (0.005 mg cm(-2) per scenario); (iii) spreading of (viscous) liquids with a comb on a large surface area: 130 mg per scenario (0.16 mg cm(-2) per scenario); (iv) brushing and rolling of (relatively viscous) liquid products on surfaces: 6500 mg per scenario (8 mg cm(-2) per scenario) and (v) spraying large amounts of liquids (paints, cleaning products) on large areas: 12,000 mg per scenario (14 mg cm(-2) per scenario). These default values are considered useful for estimating exposure for similar substances in similar situations with low uncertainty. Several other default values based on single datasets can also be used, but lead to estimates with a higher uncertainty, due to their more limited basis. Sufficient analogy in all described parameters of the scenario, including duration, is needed to enable proper use of the default values. The default values lead to similar estimates as the RISKOFDERM dermal exposure model that was based on the same datasets, but uses very different parameters. Both approaches are preferred over older general models, such as EASE, that are not based on data from actual dermal exposure situations.

Efficacy of Cyclooctadepsipeptides and Aminophenylamidines against Larval, Immature and Mature Adult Stages of a Parasitologically Characterized Trichurosis Model in Mice

PubMed Central

Kulke, Daniel; Krücken, Jürgen; Harder, Achim; von Samson-Himmelstjerna, Georg

2014-01-01

Background The genus Trichuris includes parasites of major relevance in veterinary and human medicine. Despite serious economic losses and enormous impact on public health, treatment options against whipworms are very limited. Additionally, there is an obvious lack of appropriately characterized experimental infection models. Therefore, a detailed parasitological characterization of a Trichuris muris isolate was performed in C57BL/10 mice. Subsequently, the in vivo efficacies of the aminophenylamidines amidantel, deacylated amidantel (dAMD) and tribendimidine as well as the cyclooctadepsipeptides emodepside and in particular PF1022A were analyzed. This was performed using various administration routes and treatment schemes targeting histotropic and further developed larval as well as immature and mature adult stages. Methodology/Principal Findings Duration of prepatent period, time-dependent localization of larvae during period of prepatency as well as the duration of patency of the infection were determined before drugs were tested in the characterized trichurosis model. Amidantel showed no effect against mature adult T. muris. Tribendimidine showed significantly higher potency than dAMD after oral treatments (ED50 values of 6.5 vs. 15.1 mg/kg). However, the opposite was found for intraperitoneal treatments (ED50 values of 15.3 vs. 8.3 mg/kg). When emodepside and PF1022A were compared, the latter was significantly less effective against mature adults following intraperitoneal (ED50 values of 6.1 vs. 55.7 mg/kg) or subcutaneous (ED50 values of 15.2 vs. 225.7 mg/kg) administration. Only minimal differences were observed following oral administration (ED50 values of 2.7 vs. 5.2 mg/kg). Triple and most single oral doses with moderate to high dosages of PF1022A showed complete efficacy against histotropic second stage larvae (3×100 mg/kg or 1×250 mg/kg), further developed larvae (3×10 mg/kg or 1×100 mg/kg) and immature adults (3×10 mg/kg or 1×100 mg/kg). Histotropic first stage larvae were only eliminated after three doses of PF1022A (3×100 mg/kg) but not after a single dose. Conclusions/Significance These results indicate that the cyclooctadepsipeptides are a drug class with promising candidates for further evaluation for the treatment of trichurosis of humans and livestock animals in single dose regimens. PMID:24587460

43 CFR 41.120 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

6 CFR 17.120 - Transfers of property.

Code of Federal Regulations, 2012 CFR

2012-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

6 CFR 17.120 - Transfers of property.

Code of Federal Regulations, 2013 CFR

2013-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

45 CFR 86.5 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

43 CFR 41.120 - Transfers of property.

Code of Federal Regulations, 2012 CFR

2012-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

6 CFR 17.120 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

40 CFR 5.120 - Transfers of property.

Code of Federal Regulations, 2012 CFR

2012-07-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

45 CFR 86.5 - Transfers of property.

Code of Federal Regulations, 2014 CFR

2014-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

14 CFR 1253.120 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

43 CFR 41.120 - Transfers of property.

Code of Federal Regulations, 2014 CFR

2014-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

43 CFR 41.120 - Transfers of property.

Code of Federal Regulations, 2013 CFR

2013-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

40 CFR 5.120 - Transfers of property.

Code of Federal Regulations, 2014 CFR

2014-07-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

45 CFR 86.5 - Transfers of property.

Code of Federal Regulations, 2013 CFR

2013-10-01

... Transfers of property. If a recipient sells or otherwise transfers property financed in whole or in part... the Federal share of the fair market value of the property is not upon such sale or transfer properly...

6 CFR 17.120 - Transfers of property.

Code of Federal Regulations, 2014 CFR

2014-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

40 CFR 5.120 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-07-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

Evaluation of transfer rates of multiple pesticides from green tea into infusion using water as pressurized liquid extraction solvent and ultra-performance liquid chromatography tandem mass spectrometry.

PubMed

Chen, Hongping; Pan, Meiling; Liu, Xin; Lu, Chengyin

2017-02-01

Pesticide residues could be transferred from tea into its infusion and by-products, and subsequently consumed by humans. Extra extraction conditions may induce more pesticide leaching into the infusion and by-products of tea and cause greater damage to humans. The aim of this study is to evaluate the infusion of multiple pesticides from green tea into hot water via pressurized liquid extraction. The results showed that pesticides in spiked samples generally have higher leaching (0.8-45.0%) than those in the positive samples. There was a marked rise of transfer rates when water solubility increased from 20mgL(-1) to 450mgL(-1) and LogKow decreased from 6 to 4. All pesticides had more leaching into hot water using pressurized liquid extraction than traditional tea brewing. This study helps in risk assessment of pesticide residues and in the formulation of maximum residue levels (MRLs) in tea and its by-products. Copyright © 2016 Elsevier Ltd. All rights reserved.

Micropropagation of Capparis decidua (Forsk.) Edgew. - a tree of arid horticulture.

PubMed

Deora, N S; Shekhawat, N S

1995-12-01

A method for micropropagation of mature trees of Capparis decidua was developed. Multiple shoots were obtained from nodal explants on Murashige and Skoog's (1962) medium+0.1mgl(-1) NAA+5.0mgl(-1)BAP+additives (50mgl(-1) ascorbic acid and25 mgl(-1) each of adenine sulphate, L-arginine and citric acid) at 28 ± 2°C, 12 h/dphotoperiod and 35-40 μmol m(-2)s(-1) photon flux density. The shoots were multiplied by (i) subculture of nodal shoot segments onto MS +0.1 mgl(--1) IAA+1.0mgl(-1) BAPH+additives, and (ii) repeated transfer of original explant onto MS+ 0.1mgl(-1) IAA+mg l(-1) BAP+additives, at intervals of 3 weeks. Sixty to 70% of the shoots rooted when pulse treated with 100 mg l(-1) IBA in half strength MS liquid medium for 4h, and then transferred onto hormone-free half-strength agar-gelled MS basal saltmedium. Incubation in dark at 33 ± 2°C for 6d favoured root induction. In vitro hardened plants were transferred to pots.

Price To Be Paid for Two-Metal Catalysis: Magnesium Ions That Accelerate Chemistry Unavoidably Limit Product Release from a Protein Kinase

DOE Office of Scientific and Technical Information (OSTI.GOV)

Jacobsen, Douglas M.; Bao, Zhao-Qin; O'’Brien, Patrick

Incorporation of divalent metal ions into an active site is a fundamental catalytic tool used by diverse enzymes. Divalent cations are used by protein kinases to both stabilize ATP binding and accelerate chemistry. Kinetic analysis establishes that Cyclin-dependent kinase 2 (CDK2) requires simultaneous binding of two Mg 2+ ions for catalysis of phosphoryl transfer. This tool, however, comes with a price: the rate-acceleration effects are opposed by an unavoidable rate-limiting consequence of the use of two Mg 2+ ions by CDK2. The essential metal ions stabilize ADP product binding and limit the overall rate of the reaction. We demonstrate thatmore » product release is rate limiting for activated CDK2 and evaluate the effects of the two catalytically essential Mg 2+ ions on the stability of the ADP product within the active site. We present two new crystal structures of CDK2 bound to ADP showing how the phosphate groups can be coordinated by either one or two Mg 2+ ions, with the occupancy of one site in a weaker equilibrium. Molecular dynamics simulations indicate that ADP phosphate mobility is more restricted when ADP is coordinated by two Mg 2+ ions compared to one. The structural similarity between the rigid ADP·2Mg product and the cooperatively assembled transition state provides a mechanistic rational for the rate-limiting ADP release that is observed. We demonstrate that although the simultaneous binding of two Mg 2+ ions is essential for efficient phosphoryl transfer, the presence of both Mg 2+ ions in the active site also cooperatively increases ADP affinity and opposes its release. Evolution of protein kinases must have involved careful tuning of the affinity for the second Mg 2+ ion in order to balance the needs to stabilize the chemical transition state and allow timely product release. The link between Mg 2+ site affinity and activity presents a chemical handle that may be used by regulatory factors as well as explain some mutational effects.« less

Differences of Cd uptake and expression of OAS and IRT genes in two varieties of ryegrasses.

PubMed

Chi, Sunlin; Qin, Yuli; Xu, Weihong; Chai, Yourong; Feng, Deyu; Li, Yanhua; Li, Tao; Yang, Mei; He, Zhangmi

2018-06-16

Pot experiment was conducted to study the difference of cadmium uptake and OAS and IRT genes' expression between the two ryegrass varieties under cadmium stress. The results showed that with the increase of cadmium levels, the dry weights of roots of the two ryegrass varieties, and the dry weights of shoots and plants of Abbott first increased and then decreased. When exposed to 75 mg kg -1 Cd, the dry weights of shoot and plant of Abbott reached the maximum, which increased by 11.13 and 10.67% compared with the control. At 75 mg kg -1 Cd, cadmium concentrations in shoot of the two ryegrass varieties were higher than the critical value of Cd hyperaccumulator (100 mg kg -1 ), 111.19 mg kg -1 (Bond), and 133.69 mg kg -1 (Abbott), respectively. The OAS gene expression in the leaves of the two ryegrass varieties showed a unimodal curve, which was up to the highest at the cadmium level of 150 mg kg -1 , but fell back at high cadmium levels of 300 and 600 mg kg -1 . The OAS gene expression in Bond and Abbott roots showed a bimodal curve. The OAS gene expression in Bond root and Abbott stem mainly showed a unimodal curve. The expression of IRT genes family in the leaves of ryegrass varieties was basically in line with the characteristics of unimodal curve, which was up to the highest at cadmium level of 75 or 150 mg kg -1 , respectively. The IRT expression in the ryegrass stems showed characteristics of bimodal and unimodal curves, while that in the roots was mainly unimodal. The expression of OAS and IRT genes was higher in Bond than that in Abbott due to genotype difference between the two varieties. The expression of OAS and IRT was greater in leaves than that in roots and stems. Ryegrass tolerance to cadmium can be increased by increasing the expression of OAS and IRT genes in roots and stems, and transfer of cadmium from roots and stems to the leaves can be enhanced by increasing expression OAS and IRT in leaves.

Features of Patients With Severe Hepatitis Due to Mushroom Poisoning and Factors Associated With Outcome.

PubMed

Bonacini, Maurizio; Shetler, Katerina; Yu, Ira; Osorio, Robert C; Osorio, Robert W

2017-05-01

Acute liver failure after ingestion of toxic mushrooms is a significant medical problem. Most exposures to toxic mushrooms produce no symptoms or only mild gastroenteritis, but some lead to severe hepatic necrosis and fulminant hepatic failure requiring liver transplantation. We aimed to assess mortality from mushroom poisoning and identify variables associated with survival and liver transplantation. We collected information from 27 patients (13 male; median age, 47 years) admitted to the emergency department within 24 hours of ingesting wild mushrooms. They developed severe liver injury (serum levels of transaminases greater than 400 IU/L) and were treated with activated charcoal and N-acetylcysteine at a tertiary medical center in San Francisco, California from January 1997 through December 2014. Viral hepatitis, autoimmune liver disease, acetaminophen, salicylate toxicity, and chronic liver diseases were ruled out for all patients. We analyzed patient demographics, time since ingestion, presenting symptoms, laboratory values, and therapies administered. A good outcome was defined as survival without need for liver transplant. A poor outcome was defined as death or liver transplant. Positive predictive values were calculated, and the χ 2 test was used to analyze dichotomous variables. Liver injury was attributed to ingestion of Amanita phalloides in 24 patients and Amanita ocreata in 3 patients. Twenty-four of the patients ingested mushrooms with meals and 3 patients for hallucinogenic purpose. At 24-48 hours after ingestion, all patients had serum levels of alanine aminotransferase ranging from 554 to 4546 IU/L (median, 2185 IU/L). Acute renal impairment developed in 5 patients. Twenty-three patients survived without liver transplantation, and 4 patients had poor outcomes (1 woman underwent liver transplantation on day 20 after mushroom ingestion, and 3 women died of hepatic failure). Of the 23 patients with peak levels of total bilirubin of 2 mg/dL or more during hospitalization, only 4 had a poor outcome. Peak serum level of aspartate aminotransferase less than 4000 IU/L, peak international normalized ratio less than 2, and a value of serum factor V greater than 30% identified patients with good outcomes with 100% positive predictive value; if these peak values were used as a cutoff, 10 of 27 patients (37%), 7 of 27 patients (26%), and 6 of 12 patients (50%), respectively, could have avoided transfer to a transplant center. In an analysis of 27 patients with hepatocellular damage due to mushroom (Amanita) poisoning and peak levels of total bilirubin greater than 2 mg/dL, the probability of liver transplantation or death is 17%, fulfilling Hy's law. Patients with peak levels of aspartate aminotransferase less than 4000 IU/L can be monitored in a local hospital, whereas patients with higher levels should be transferred to liver transplant centers. Women and older patients were more likely to have a poor outcome than men and younger patients. Copyright © 2017 AGA Institute. Published by Elsevier Inc. All rights reserved.

Physicochemical properties, nutritional value and techno-functional properties of goldenberry (Physalis peruviana) waste powder concise title: Composition of goldenberry juice waste.

PubMed

Mokhtar, Sayed M; Swailam, Hesham M; Embaby, Hassan El-Sayed

2018-05-15

Goldenberry waste powder, contained 5.87% moisture, 15.89% protein, 13.72% fat, 3.52% ash, 16.74% dietary fiber and 61% carbohydrates. Potassium (560 mg/100 g) was the predominant element followed by sodium (170 mg/100 g) and phosphorus (130 mg/100 g). Amino acid analysis gave high levels of cystine/methionine, histidine and tyrosine/phenylalanine. Goldenberry waste powder had good levels of the techno-functional properties including water absorption index, swelling index, foaming capacity and stability (3.38 g/g, 5.24 ml/g, 4.09 and 72.0%, respectively). Fatty acids profile showed that linoleic acid was the predominant fatty acid followed by oleic, palmitic and stearic acids. Iodine value (109.5 g/100 g of oil), acid value (2.36 mg KOH/g of oil), saponification value (183.8 mg KOH/g of oil), peroxide value (8.2 meq/kg of oil) and refractive index (1.4735) were comparable to those of soybean and sunflower oils. Goldenberry waste oil exhibited absorbance in the UV range at 100-400 nm. Copyright © 2017 Elsevier Ltd. All rights reserved.

Nitrogen isotopes as indicators of nitrate sources in Minnesota sand-plain aquifers

USGS Publications Warehouse

Komor, Stephen C.; Anderson, Henry W.

1993-01-01

Nitrate concentrations in excess of national drinking-water standards (10 mg/1 as N) are present in certain sand-plain aquifers in central Minnesota. To investigate nitrate sources in the aquifers, nitrogen-isotope values of nitrate (δ15NNO3No3) were measured in shallow ground water from 51 wells in five land-use settings. The land-use settings and corresponding average nitrate concentrations (as N) and δ15NNO3 values are: livestock feedlots, 12.7 mg/1, 21.3%0; cultivated-irrigated fields, 13 mg/1, 7.4%0; residential areas with septic systems, 8.3 mg/1, 6.0%0; cultivated-nonirrigated fields, 15.5 mg/1, 3.4%0; and natural, undeveloped areas, 3.8 mg/1, 3.1%0. Values of δ15NNO3 less than 2%0 suggest that nitrogen from commercial inorganic fertilizers exists in ground water beneath all settings except the feedlots. Values of δ15NNO3 greater than 10%0 suggest that nitrogen from animal waste is present in ground water beneath certain feedlots, cultivated-irrigated fields that are fertilized with manure, and residential areas with septic systems. Values of δ15NNO3 between 22 and 43%0 in ground water beneath the feedlots probably result from denitrification. Values of δ15NNO3 increase with depth in many locations in the sand-plain aquifers. These increases may be caused by progressive denitrification with depth or by changes with depth in the proportions of nitrate from different sources. Similarly, variations of δ15NNO3 values from 1986 to 1987 in certain locations may be due to temporal variations in the amounts of denitrification or to changes in the proportions of nitrate from different sources. Ambiguities in the interpretation of changes in δ15NNO3 values could be eliminated by increasing the spatial and temporal frequency of sampling.

A risk scoring model based on vital signs and laboratory data predicting transfer to the intensive care unit of patients admitted to gastroenterology wards.

PubMed

Kim, Won-Young; Lee, Jinmi; Lee, Ju-Ry; Jung, Youn Kyung; Kim, Hwa Jung; Huh, Jin Won; Lim, Chae-Man; Koh, Younsuck; Hong, Sang-Bum

2017-08-01

To compare the ability of a score based on vital signs and laboratory data with that of the modified early warning score (MEWS) to predict ICU transfer of patients with gastrointestinal disorders. Consecutive events triggering medical emergency team activation in adult patients admitted to the gastroenterology wards of the Asan Medical Center were reviewed. Binary logistic regression was used to identify factors predicting transfer to the ICU. Gastrointestinal early warning score (EWS-GI) was calculated as the sum of simplified regression weights (SRW). Of the 1219 included patients, 468 (38%) were transferred to the ICU. Multivariate analysis identified heart rate≥105bpm (SRW 1), respiratory rate≥26bpm (SRW 2), ACDU (Alert, Confused, Drowsy, Unresponsive) score≥1 (SRW 2), SpO 2 /FiO 2 ratio<240 (SRW 2), creatinine ≥2.0mg/dL (SRW 2), total bilirubin ≥9.0mg/dL (SRW 2), prothrombin time/international normalized ratio (INR) ≥1.5 (SRW 2), and lactate ≥3.0mmol/L (SRW 2) for inclusion in EWS-GI. The area under the receiver operating characteristic curve of the EWS-GI was larger than that of MEWS (0.76 vs. 0.64; P<0.001). EWS-GI may predict ICU transfer among patients admitted to gastroenterology wards. The EWS-GI should be prospectively validated. Copyright © 2017 Elsevier Inc. All rights reserved.

Positive effects of bio-nano Pd (0) toward direct electron transfer in Pseudomona putida and phenol biodegradation.

PubMed

Niu, Zhuyu; Jia, Yating; Chen, Yuancai; Hu, Yongyou; Chen, Junfeng; Lv, Yuancai

2018-06-08

This study constructed a biological-inorganic hybrid system including Pseudomonas putida (P. putida) and bioreduced Pd (0) nanoparticles (NPs), and inspected the influence of bio-nano Pd (0) on the direct electron transfer and phenol biodegradation. Scanning electron microscopy and energy-dispersive X-ray spectroscopy (SEM-EDX) showed that bio-nano Pd (0) (~10 nm) were evenly dispersed on the surface and in the periplasm of P. putida. With the incorporation of bio-nano Pd (0), the redox currents of bacteria in the cyclic voltammetry (CV) became higher and the oxidation current increased as the addition of lactate, while the highest increase rates of two electron transfer system (ETS) rates were 63.97% and 33.79%, respectively. These results indicated that bio-nano Pd (0) could directly promote the electron transfer of P. putida. In phenol biodegradation process, P. putida-Pd (0)- 2 showed the highest k (0.2992 h -1 ), μ m (0.035 h -1 ) and K i (714.29 mg/L) and the lowest apparent K s (76.39 mg/L). The results of kinetic analysis indicated that bio-nano Pd (0) markedly enhanced the biocatalytic efficiency, substrate affinity and the growth of cells compared to native P. putida. The positive effects of bio-nano Pd (0) to the electron transfer of P. putida would promote the biodegradation of phenol. Copyright © 2018 Elsevier Inc. All rights reserved.

First principles calculations on the influence of solute elements and chlorine adsorption on the anodic corrosion behavior of Mg (0001) surface

NASA Astrophysics Data System (ADS)

Luo, Zhe; Zhu, Hong; Ying, Tao; Li, Dejiang; Zeng, Xiaoqin

2018-06-01

The influences of solute atoms (Li, Al, Mn, Zn, Fe, Ni, Cu, Y, Zr) and Cl adsorption on the anodic corrosion performance on Mg (0001) surface have been investigated based on first-principles calculations, which might be useful for the design of corrosion-resistant Mg alloys. Work function and local electrode potential shift are chosen as descriptors since they quantify the barrier for charge transfer and anodic stability. We found that at 25% surface doping rate, Y decreased the work function of Mg, while the impact of remaining doping elements on the work function of Mg was trivial due to the small surface dipole moment change. The adsorption of Cl destabilized the Mg atoms at surface by weakening the bonding between surface Mg atoms. We find that a stronger hybridization of d orbits of alloying elements (e.g. Zr) with the orbits of Mg can greatly increase the local electrode potential,which even overbalances the negative effect introduced by Cl adsorbates and hence improves the corrosion resistance of Mg alloys.

Structural, elastic and electronic properties of typical NdMgT4 (T = Co, Ni, Cu) alloys from ab initio calculation

NASA Astrophysics Data System (ADS)

Wang, Na; Zhang, Wei-bing; Tang, Bi-yu; Gao, Hai-Tao; He, En-jie; Wang, Lei

2018-07-01

The crystal structure, elastic and magnetic properties of important ternary Mg-based alloys NdMgT4 (T = Co, Ni, Cu) have been studied using reliable ab initio calculations. Both cohesive energy and charge density difference suggest that three alloys have good structural stability with the order: NdMgCo4 > NdMgNi4 > NdMgCu4. It shows that NdMgCo4 alloy has magnetic moments with the Co atoms being the main contribution, which is also in agreement with the calculated electronic structures. We find that NdMgT4 (T = Co, Ni, Cu) alloys are all ductile materials with bulk-to-shear modulus (B/G) values higher than 1.75. The trends of calculated values for the shear moduli Cs and C44 are consistent with that of shear modulus G and young's modulus E, proving that NdMgT4 (T = Co, Ni, Cu) alloys exhibit good plasticity with the trend: NdMgNi4 > NdMgCu4 > NdMgCo4. These calculated results give the basis guidance for the design of rare earth-magnesium-transition metal (R-Mg-T) alloys with improved mechanical properties.

Optimization of Supercritical Fluid Extraction of Total Alkaloids, Peimisine, Peimine and Peiminine from the Bulb of Fritillaria thunbergii Miq, and Evaluation of Antioxidant Activities of the Extracts

PubMed Central

Ruan, Xiao; Yang, Li; Cui, Wen-Xia; Zhang, Men-Xing; Li, Zhao-Hui; Liu, Ben; Wang, Qiang

2016-01-01

Supercritical fluid extraction (SFE) was used to extract total alkaloids, peimisine, peimine and peiminine from the bulb of Fritillaria thunbergii Miq. The antioxidant capacity of the extracts was evaluated by DPPH radical scavenging activity (DPPH-RSA), ABTS radical scavenging activity (ABTS-RSA) and ferric reducing capacity (FRAP) assay. A central composite design (CCD) with four variables and five levels was employed for optimization of process parameters, and response surface plots were constructed in accordance with a second order polynomial model. Under optimal conditions of 3.0 h, 60.4 °C, 26.5 MPa and 89.3% ethanol, the highest yields were predicted to be 3.8 mg/g for total alkaloids, 0.5 mg/g for peimisine, 1.3 mg/g for peimine and 1.3 mg/g for peiminine, and the antioxidant capacity of extracts displayed EC50, DPPH value of 5.5 mg/mL, EC50, ABTS value of 0.3 mg/mL and FRAP value of 118.2 mg ascorbic acid equivalent (AAE)/100 g. PMID:28773648

Autoregulation of renal blood flow in the conscious dog and the contribution of the tubuloglomerular feedback

PubMed Central

Just, Armin; Wittmann, Uwe; Ehmke, Heimo; Kirchheim, Hartmut R

1998-01-01

The aim of this study was to investigate the autoregulation of renal blood flow under physiological conditions, when challenged by the normal pressure fluctuations, and the contribution of the tubuloglomerular feedback (TGF). The transfer function between 0.0018 and 0.5 Hz was calculated from the spontaneous fluctuations in renal arterial blood pressure (RABP) and renal blood flow (RBF) in conscious resting dogs. The response of RBF to stepwise artificially induced reductions in RABP was also studied (stepwise autoregulation). Under control conditions (n = 12 dogs), the gain of the transfer function started to decrease, indicating improving autoregulation, below 0.06-0.15 Hz (t = 7-17 s). At 0.027 Hz a prominent peak of high gain was found. Below 0.01 Hz (t > 100 s), the gain reached a minimum (maximal autoregulation) of -6.3 ± 0.6 dB. The stepwise autoregulation (n = 4) was much stronger (-19.5 dB). The time delay of the transfer function was remarkably constant from 0.03 to 0.08 Hz (high frequency (HF) range) at 1.7 s and from 0.0034 to 0.01 Hz (low frequency (LF) range) at 14.3 s, respectively. Nifedipine, infused into the renal artery, abolished the stepwise autoregulation (-2.0 ± 1.1 dB, n = 3). The gain of the transfer function (n = 4) remained high down to 0.0034 Hz; in the LF range it was higher than in the control (0.3 ± 1.0 dB, P < 0.05). The time delay in the HF range was reduced to 0.5 s (P < 0.05). After ganglionic blockade (n = 7) no major changes in the transfer function were observed. Under furosemide (frusemide) (40 mg + 10 mg h−1 or 300 mg + 300 mg h−1 i.v.) the stepwise autoregulation was impaired to -7.8 ± 0.3 or -6.7 ± 1.9 dB, respectively (n = 4). In the transfer function (n = 7 or n = 4) the peak at 0.027 Hz was abolished. The delay in the LF range was reduced to -1.1 or -1.6 s, respectively. The transfer gain in the LF range (-5.5 ± 1.2 or -3.8 ± 0.8 dB, respectively) did not differ from the control but was smaller than that under nifedipine (P < 0.05). It is concluded that the ample capacity for regulation of RBF is only partially employed under physiological conditions. The abolition by nifedipine and the negligible effect of ganglionic blockade show that above 0.0034 Hz it is almost exclusively due to autoregulation by the kidney itself. TGF contributes to the maximum autoregulatory capacity, but it is not required for the level of autoregulation expended under physiological conditions. Around 0.027 Hz, TGF even reduces the degree of autoregulation. PMID:9481688

15 CFR 8a.120 - Transfers of property.

Code of Federal Regulations, 2013 CFR

2013-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

31 CFR 28.120 - Transfers of property.

Code of Federal Regulations, 2012 CFR

2012-07-01

... § 28.120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

31 CFR 28.120 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-07-01

... § 28.120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

14 CFR 1253.120 - Transfers of property.

Code of Federal Regulations, 2012 CFR

2012-01-01

... § 1253.120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

31 CFR 28.120 - Transfers of property.

Code of Federal Regulations, 2014 CFR

2014-07-01

... § 28.120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

15 CFR 8a.120 - Transfers of property.

Code of Federal Regulations, 2011 CFR

2011-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

15 CFR 8a.120 - Transfers of property.

Code of Federal Regulations, 2014 CFR

2014-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

15 CFR 8a.120 - Transfers of property.

Code of Federal Regulations, 2012 CFR

2012-01-01

....120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole or... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

14 CFR 1253.120 - Transfers of property.

Code of Federal Regulations, 2013 CFR

2013-01-01

... § 1253.120 Transfers of property. If a recipient sells or otherwise transfers property financed in whole... activity, and the Federal share of the fair market value of the property is not upon such sale or transfer...

Photophysical analysis of 1,10-phenanthroline-embedded porphyrin analogues and their magnesium(II) complexes.

PubMed

Ishida, Masatoshi; Lim, Jong Min; Lee, Byung Sun; Tani, Fumito; Sessler, Jonathan L; Kim, Dongho; Naruta, Yoshinori

2012-11-05

The synthesis, characterization, photophysical properties, and theoretical analysis of a series of tetraaza porphyrin analogues (H-Pn: n=1-4) containing a dipyrrin subunit and an embedded 1,10-phenanthroline subunit are described. The meso-phenyl-substituted derivative (H-P1) interacts with a Mg(2+) salt (e.g., MgCl(2), MgBr(2), MgI(2), Mg(ClO(4))(2), and Mg(OAc)(2)) in MeCN solution, thereby giving rise to a cation-dependent red-shift in both the absorbance- and emission maxima. In this system, as well as in the other H-Pn porphyrin analogues used in this study, the four nitrogen atoms of the ligand interact with the bound magnesium cation to form Mg(2+)-dipyrrin-phenanthroline complexes of the general structure MgX-Pn (X=counteranion). Both single-crystal X-ray diffraction analysis of the corresponding zinc-chloride derivative (ZnCl-P1) and fluorescence spectroscopy of the Mg-adducts that are formed from various metal salts provide support for the conclusion that, in complexes such as MgCl-P1, a distorted square-pyramidal geometry persists about the metal cation wherein a chloride anion acts as an axial counteranion. Several analogues (HPn) that contain electron-donating and/or electron-withdrawing dipyrrin moieties were prepared in an effort to understand the structure-property relationships and the photophysical attributes of these Mg-dipyrrin complexes. Analysis of various MgX-Pn (X=anion) systems revealed significant substitution effects on their chemical, electrochemical, and photophysical properties, as well as on the Mg(2+)-cation affinities. The fluorescence properties of MgCl-Pn reflected the effect of donor-excited photoinduced electron transfer (d-PET) processes from the dipyrrin subunit (as a donor site) to the 1,10-phenanthroline acceptor subunit. The proposed d-PET process was analyzed by electron paramagnetic resonance (EPR) spectroscopy and by femtosecond transient absorption (TA) spectroscopy, as well as by theoretical DFT calculations. Taken together, these studies provide support for the suggestion that a radical species is produced as the result of an intramolecular charge-transfer process, following photoexcitation. These photophysical effects, combined with a mixed dipyrrin-phenanthroline structure that is capable of effective Mg(2+)-cation complexation, lead us to suggest that porphyrin-inspired systems, such as HPn, have a role to play as magnesium-cation sensors. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Cross-Validation of Suspended Sediment Concentrations Derived from Satellite Imagery and Numerical Modeling of the 1997 New Year's Flood on the Feather River, CA

NASA Astrophysics Data System (ADS)

Kilham, N. E.

2009-12-01

Image analysis was applied to assess suspended sediment concentrations (SSC) predicted by a numerical model of 2D hydraulics and sediment transport (Telemac-2D), coupled to a solver for the advection-diffusion equation (SISYPHE) and representing 18 days of flooding over 70 kilometers of the lower Feather-Yuba Rivers. Sisyphe treats the suspended load as a tracer, removed from the flow if the bed shear velocity, u* is lower than an empirically derived threshold (ud* = 7.8E-3 m s-1). Agreement between model (D50 = 0.03 mm) and image-derived SSC (mg L-1) suggests that image interpretation could prove to be a viable approach for verifying spatially-distributed models of floodplain sediment transport if imagery is acquired for a particular flood and at a sufficient spatial and radiometric resolution. However, remotely derived SSC represents the integrated concentration of suspended sediment at the water surface. Hence, comparing SSC magnitudes derived from imagery and numerical modeling requires that a relationship is first established between the total suspended load and the portion of this load suspended within the optical range of the sensor (e.g., Aalto, 1995). Using the optical depth (0.5 m) determined from radiative transfer modeling, surface SSC measured from a 1/14/97 Landsat TM5 image (30 m) were converted to depth-integrated SSC with the Rouse (1937) equation. Surface concentrations were derived using a look-up table for the sensor to convert endmember fractions obtained from a spectral mixture analysis of the image. A two-endmember model (2.0 and 203 mg L-1) was used, with synthetic endmembers derived from optical and radiative transfer modeling and inversion of field spectra collected from the Sacramento and Feather Rivers and matched to measured SSC values. Remotely sensed SSC patterns were then compared to the Telemac results for the same day and time. Modeled concentrations are a function of both the rating curve boundary conditions, and the transport and deposition calculations. At each of three upstream channel boundaries, hourly SSC was derived from instantaneous discharge and SSC records at USGS gages for winter months (December-April) following dam closure on the Feather, Yuba, and Bear Rivers (r2 = 0.61; r2 = 0.81; r2 = 0.55). Model channel concentrations declined downstream from about 90 mg L-1 to 40 mg L-1 as sediment input was depleted through decanting of river water overbank, advection through floodplain channels, and deposition onto the floodplain. Similar downstream declines in the image values suggest that bed and bank erosion downstream of the major gages did not contribute much new sediment two weeks following the flood peak. Model predicted concentrations agree with image derived concentrations to within 10 mg L-1, although the model predicts a more rapid drawdown of floodplain flow than is apparent from the image. Aalto, R., 1995. Discordance between suspended sediment diffusion theory and observed sediment concentration profiles in rivers. M.S., University of Washington, Seattle, WA. Rouse, H.R., 1937. Modern conceptions of the mechanics of turbulence. Transactions, American Society of Civil Engineers, 102: 463-543.

Using geochemical and isotopic techniques for exploration of geothermal energy in Southern Sabalan geothermal field, NW Iran

NASA Astrophysics Data System (ADS)

Masoumi, Rahim

2017-04-01

From a hydrogeochemical point of view the geothermal fluids in the study area can be divided into two categories, (1) Na-Cl and (2) Na-Ca-HCO3. In the study area, the hot water samples depict temperature and pH ranges of 22 °C to 77 °C and 6.4 to 7.3, respectively. The total dissolved solids vary from 456 mg/L to 7006 mg/L. The concentration of rare metallic and non-metallic elements such as Li, Rb, B, Ba, Sr, CS, Se, Al, As, Hg in cold and hot spring waters in the Bushdi area were also analyzed. The utmost concentration belongs to Se which ranges from 135 mg/L to 273 mg/L. Boron also shows notable concentration values, in most samples it exceeds 20 mg/L, and in certain samples it ranges from 28 mg/L to 33.5 mg/L. The concentration value of arsenic ranges from 3 mg/L to 4 mg/L. The maximum concentration value of mercury is 0.01 mg/L. The δ18O values of these samples vary from -12.4 ‰ to -7.5 ‰ and the δD values range from -78.6 ‰ to -70.6 ‰. Plotting δ18O versus δD demonstrates that the data points are clustered close to both, the global meteoric water line (GMWL) with the equation δD = 8 δ18O + 10 and, the national meteoric water line (NMWL) with the equation δD = 6.89 δ18O + 6.57. As can be observed, the geothermal fluids in the Bushdi area show relatively slight increase in δ18O values that may be caused by interaction of hot fluids with host volcanic rocks. In fact, this relatively slight increment in δ18O values may indicate the low to moderate temperature of the geothermal system. The δD values, in general, do not show notable variation because of very low hydrogen content of the host rocks. The slight increase in δD, however, may be in conjunction with vaporization and isotopic interaction with the host rocks. The 3H content of the cold and hot waters in the Bushdi area is relatively high and varies from 0.65 TU to 41.4 TU. This may be caused either by mixing with meteoric sources or rapid fluid flow within the system in a shorter time than the β- disintegration of the isotope 3H. The δ18O versus δD diagram demonstrates that the data for the Bushdi area is plotted in three distinct domains, a, b, c. In a, the 3H content is > 10 TU indicating these waters being modern waters. Domain b belongs to samples whose 3H values are within the range of 1 TU to 10 TU being temporally categorized as sub-modern waters. The water samples in c possess 3H values < 1 TU indicating the oldest waters within the geothermal system in the study area. Key words: Geothermal fluids, Stable isotopes, Tracemetals, Sabalan volcano.

Nutritive value and chemical composition of prickly pear seeds (Opuntia ficus indica L.) growing in Turkey.

PubMed

Özcan, Mehmet Musa; Al Juhaimi, Fahad Y

2011-08-01

The proximate composition and physico-chemical properties (moisture, crude lipid, crude protein, ash, and crude fiber, peroxide value, saponification value, acidity, relative density and refractive index) of prickly pear seed and corresponding oil were determined. The mineral contents (Ca, Cu, Fe, K, Mg, Na, P, Mn and Zn) of samples were analyzed by inductively coupled plasma atomic emission spectrometry. Minerals determined were: calcium 471.2 mg/kg, potassium 532.7 mg/kg, magnesium 117.3 mg/kg, phosphorus 1,627.5 mg/kg and natrium 71.3 mg/kg. The fatty acid profiles of seed oil from the Opuntia ficus indica were analyzed by gas chromatography. Linoleic acid was established as the major fatty acid (61.01%), followed by oleic (25.52%) and palmitic (12.23%) acids. Both myristic, stearic and arachidonic acids were detected in O. ficus indica seed oil in low amounts. As a result, O. ficus indica seeds are an important source of natural fiber and, given its high linoleic acid content, its oil can be used as a nutraceutic agent.

Soil contamination by heavy metals: measurements from a closed unlined landfill.

PubMed

Kasassi, A; Rakimbei, P; Karagiannidis, A; Zabaniotou, A; Tsiouvaras, K; Nastis, A; Tzafeiropoulou, K

2008-12-01

The aim of the present study was the characterization of soil samples of a closed unlined landfill located northwest of Thessaloniki, North Greece, in relation to heavy metals values. Samples were obtained by drilling in different depths (2.5-17.5m). Then they were analyzed by atomic absorption spectrophotometry for Cd, Cr, Cu, Ni, Pb and Zn investigation. The chemical analysis showed that the metal values varied over a wide range: from 0.50 to 18.75mg/kg for Cd, 3.88-171.88mg/kg for Cr, 8.13-356.25mg/kg for Cu, 5.63-63.75mg/kg for Ni, 2.50-92.50mg/kg for Pb and 6.38-343.75mg/kg for Zn. The highest values found in three of the six drillings, in depths over 2.5m. Although the area is heavily industrialized, the presented results indicated that local industries have not constituted an extensive metal pollution source for the site. Finally, after all necessary preparatory operations of site cleaning and flattening, surface planting selected and applied as a phytoremediation rehabilitation method of the site.

Predictive value of plasma β2-microglobulin on human body function and senescence.

PubMed

Dong, X-M; Cai, R; Yang, F; Zhang, Y-Y; Wang, X-G; Fu, S-L; Zhang, J-R

2016-06-01

To explore the correlation between plasma β2-microglobulin (β2-MG) as senescence factor with age, heart, liver and kidney function as well as the predictive value of β2-MG in human metabolism function and senescence. 387 cases of healthy people of different ages were selected and the automatic biochemical analyzer was used to test β2-MG in plasma based on immunoturbidimetry and also all biochemical indexes. The correlation between β2-MG and age, gender and all biochemical indexes was analyzed. β2-MG was positively correlated to age, r = 0.373; and the difference was of statistical significance (p < 0.010). It was significantly negative correlated to HDL-C but positively correlated to LP (a), BUN, CREA, UA, CYS-C, LDH, CK-MB, HBDH, AST, GLB and HCY. β2-MG was closely correlated to age, heart, kidney and liver biochemical indexes, which can be taken as an important biomarker for human body function and anti-senescence and have significant basic research and clinical guidance values.

Factors influencing inactivation of Klebsiella pneumoniae by chlorine and chloramine.

PubMed

Goel, Sudha; Bouwer, Edward J

2004-01-01

Inactivation of Klebsiella pneumoniae cultures by chlorine and chloramine was evaluated under different growth conditions by varying nutrient media dilution, concentrations of essential inorganic nutrients (FeCl3, MgSO4, phosphate, and ammonium salts), and temperature. All inactivation assays were performed at room temperature (22-23 degrees C) and near neutral pH (7.2-7.5). C*T(99.9) values for chlorine increased >20-fold and for chloramine increased 2.6-fold when cells were grown in 100-fold diluted nutrient broth (2NB) solutions (final TOC of 35-40 mg/L). Background levels of Mg: 6.75 x 10(-2) mM and Fe: 3.58 x 10(-5) mM or high levels of FeCl3 (0.01 mM) and MgSO4 (1 mM) during growth resulted in the highest resistances to chlorine with C*T(99.9) values of 13.06 (+/-0.91) and 13.78 (+/-1.97) mg-min/L, respectively. Addition of low levels of FeCl3 (0.001 mM) and MgSO4 (0.1 mM) to K. pneumoniae cultures during growth resulted in the lowest bacterial resistances to inactivation; C*T(99.9) values ranged from 0.28 (+/-0.06) to 1.88 (+/-0.53)mg-min/L in these cultures. Increase in growth temperature from 22.5 degrees C to 35 degrees C for unamended 2NB cultures resulted in a 42-fold decrease in C*T(99.9) values for chlorine. A similar change in temperature resulted in no significant change in C*T(99.9) values for chloramine. These results indicate that inactivation of K. pneumoniae cultures by chlorine was highly sensitive to changes in growth conditions unlike inactivation by chloramine.

Calculating the ankylosing spondylitis disease activity score if the conventional c-reactive protein level is below the limit of detection or if high-sensitivity c-reactive protein is used: an analysis in the DESIR cohort.

PubMed

Machado, Pedro; Navarro-Compán, Victoria; Landewé, Robert; van Gaalen, Floris A; Roux, Christian; van der Heijde, Désirée

2015-02-01

The Ankylosing Spondylitis Disease Activity Score (ASDAS) is a composite measure of disease activity in axial spondyloarthritis. The aims of this study were to determine the most appropriate method for calculating the ASDAS using the C-reactive protein (CRP) level when the conventional CRP level was below the limit of detection, to determine how low CRP values obtained by high-sensitivity CRP (hsCRP) measurement influence ASDAS-CRP results, and to test agreement between different ASDAS formulae. Patients with axial spondyloarthritis who had a conventional CRP level below the limit of detection (5 mg/liter) were selected (n = 257). The ASDAS–conventional CRP with 11 different imputations for the conventional CRP value (range 0–5 mg/liter, at 0.5-mg/liter intervals) was calculated. The ASDAS-hsCRP and ASDAS using the erythrocyte sedimentation rate (ESR) were also calculated. Agreement between the ASDAS formulae was tested. The ASDAS-hsCRP showed better agreement with the ASDAS-CRP calculated using the conventional CRP imputation values of 1.5 and 2.0 mg/liter and with the ASDAS-ESR than with other imputed formulae. Disagreement occurred mainly in lower disease activity states (inactive/moderate disease activity). When the CRP value was <2 mg/liter, the resulting ASDAS-CRP scores may have been inappropriately low. When the conventional CRP level is below the limit of detection or when the hsCRP level is <2 mg/liter, the constant value of 2 mg/liter should be used to calculate the ASDAS-CRP score. There is good agreement between the ASDAS-hsCRP and ASDAS-ESR; however, formulae are not interchangeable.

Field Evaluation of Particle Counter Technology for Aviation Fuel Contamination Detection - Fort Rucker

DTIC Science & Technology

2013-06-20

Automatic Particle Counter, cleanliness, free water, Diesel 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT none 18. NUMBER OF PAGES...Governmental transfer receipts and 1.0 mg/L on issue to aircraft, or up to 10 mg/L for product used as a diesel product for ground use (1). Free...industry. The International Organization for Standardization (ISO) has published several methods and test procedures for the calibration and use of

Influence of Magnesium Ions in the Seawater Environment on the Improvement of the Corrosion Resistance of Low-Chromium-Alloy Steel.

PubMed

Song, Sol-Ji; Kim, Jung-Gu

2018-01-20

This study examined the synergic effect of alloying the element Cr and the environmental element Mg 2+ ions on the corrosion property of a low-alloy steel in seawater at 60 °C, by means of electrochemical impedance spectroscopy (EIS), linear polarization resistance (LPR) tests and weight-loss tests. The Mg 2+ ions in seawater played an important role in lowering the electron transfer of the rust layer in the Cr-containing steel. The corrosion resistance of the Cr-containing steel is superior to that of blank steel in Mg 2+ ions containing seawater. XPS and XRD results indicated that the formation of MgFe₂O₄ and a mixed layer (Cr oxide + FeCr₂O₄ + MgCr₂O₄) improved the corrosion resistance of the low-alloy steel in the seawater.

Resonant transfer excitation in collisions of F sup 6+ and Mg sup 9+ with H sub 2

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bernstein, E.M.; Kamal, A.; Zaharakis, K.E.

1991-10-01

Experimental and theoretical investigations of resonant transfer excitation (RTE) for F{sup 6+}+H{sub 2} and Mg{sup 9+}+H{sub 2} collisions have been made. For both collision systems good agreement is obtained between the measured cross sections for {ital K}-shell x-ray emission coincident with electron-capture and theoretical RTE calculations. For F{sup 6+} the present calculations are about 10% lower than previous results of Bhalla and Karim (Phys. Rev. A 39, 6060 (1989); 41, 4097(E) (1990)); the measured cross sections are a factor of 2.3 larger than earlier measurements of Schulz {ital et} {ital al}. (Phys. Rev. A 38, 5454 (1988)). The previous disagreementmore » between experiment and theory for F{sup 6+} is removed.« less

Accumulation of heavy metals in soil and their transfer to leafy vegetables in the region of Dhaka Aricha Highway, Savar, Bangladesh.

PubMed

Aktaruzzaman, M; Fakhruddin, A N M; Chowdhury, M A Z; Fardous, Z; Alam, M K

2013-04-01

Accumulation of heavy metals in environmental matrices is a potential risk to living system due to their uptake by plants and subsequent introduction into the food chain. A study was conducted to investigate the heavy metals concentration in soils and leafy vegetables samples along the Dhaka Aricha Road to assess their potential ecological risk. Heavy metals concentration was analyzed by Atomic Absorption Spectroscopy. Concentrations ofallthetestedheavy metals except Cd in soil samples were below the permissible level. The mean concentration of Cd was found 3.99 +/- 1.85 mg kg(-1). Concentrations of all the tested heavy metals except Cd and Cr in vegetables samples were lower than recommended level. Mean concentration of Cd and Cr were found 1.00 +/- 0.68 mg kg(-1) and 2.32 +/- 0.84 mg kg(-1), respectively. Based on the Potential Ecological Risk Index, Cd posed very high risk to the local ecosystem due to its higher Risk Factor, > 320 and based on Transfer Factor of Pb and Cd were found higher accumulator among the tested metals. The results of present study revealed that the bioconcentration of heavy metals along the Dhaka Aricha Road posed high risk to the ecosystem. Considering the Transfer Factor of Cd and Pb it can be suggested that plants and leafy vegetables grow in the soil near Dhaka Aricha Road should not be used as food or feed.

[Characteristics and loads of key sources of pollutions discharged into Beishi River, Changzhou City].

PubMed

Li, Chun-Ping; Jiang, Jian-Guo; Chen, Ai-Mei; Wu, Jia-Ling; Fan, Xiu-Juan; Ye, Bin

2010-11-01

Choosing the Beishi river, Changzhou City as the study area, the sewage generation, pollutants characteristics and sewage discharge in catchment area of Beishi river were conducted, detailed investigated and monitored. After using pollution coefficients, the yearly loads of all sources of pollutions were calculated to determine the highest sewage. The results showed that: except pH, the high concentration of SS, COD, BOD5, ammonia nitrogen, TN and TP discharged from MSW collecting houses, MSW transfer stations, public toilets and dining in Changzhou city far exceeded the "Integrated Wastewater Discharge Standard" (GB 8978-1996) and "Effluent Discharged into the City Sewer Water Quality Standards" (CJ 3082-1999). Among which: the highest concentration of COD discharged from MSW transfer stations was up to 51 700 mg/L, while the ammonia nitrogen and TN were as high as 1 616 mg/L and 2 044 mg/L in the toilet wastewater. In addition to this, the ratio of wastewater discharged directly into the river through storm water pipe network was higher from MSW houses, MSW transfer stations, public toilets, dining and other waste in Changzhou city. The 125.2 t/a of COD and 40.53 t/a of BOD5 were the two highest concentrations of various sources of pollution. The highest annual polluting loads discharged into Beishi river is dining, followed by the sanitation facilities. Therefore, cutting pollution control of food and sanitation facilities along the river is particularly urgent.

Design and performance of a trickle-bed bioreactor with immobilized hybridoma cells.

PubMed

Phillips, H A; Scharer, J M; Bols, N C; Moo-Young, M

1992-01-01

A trickle-bed system employing inert matrices of vermiculite or polyurethane foam packed in the downcomer section of a split-flow air-lift reactor has been developed for hybridoma culture to enhance antibody productivity. This quiescent condition favoured occlusion and allowed the cells to achieve densities twelve fold greater (12.8 x 10(6) cells/ml reactor for polyurethane foam) than in free cell suspension. The reactor was operated in a cyclic batch mode whereby defined volumes of medium were periodically withdrawn and replaced with equal volumes of fresh medium. The pH of the medium was used as the indicator of the feeding schedule. Glucose, lactate and ammonia concentrations reached a stationary value after 5 days. With vermiculite packing, a monoclonal antibody (MAb) concentration of 2.4 mg/l was achieved after 12 days. The MAb concentration declined then increased to a value of 1.8 mg/l. In the polyurethane foam average monoclonal antibody (MAb) concentrations reached a stationary value of 1.1 mg/l in the first 20 days and increased to a new stationary state value of 2.1 mg/l for the remainder of the production. MAb productivity in the trickle-bed reactor was 0.3 mg/l.d (polyurethane foam) and 0.18 mg/l.d (vermiculite) in comparison to 0.12 mg/l.d for free cell suspension. This trickle-bed system seems to be an attractive way of increasing MAb productivity in culture.

Antioxidant status and smoking habits: relationship with diet.

PubMed

Jain, A; Agrawal, B K; Varma, M; Jadhav, A A

2009-06-01

The present study was conducted to assess the association between smoking, dietary intake of antioxidants and plasma indices of oxidative stress and antioxidant defences in male smokers (cigarette and bidi smokers). The study sample consisted of 100 healthy men, including 50 non-smokers and 50 smokers, who were subclassified into 25 cigarette smokers and 25 bidi smokers, aged 18-55 years. Erythrocyte superoxide dismutase and plasma ascorbic acid were measured as antioxidants and erythrocyte malondialdehyde as an oxidative stress index, by colorimetric methods. Smokers ate less fruits and vegetables than non-smokers, leading to them having a lower antioxidant level. Erythrocyte superoxide dismutase was significantly lower in cigarette smokers (0.193 U/mgP, p-value is less than 0.05) and bidi smokers (0.169 U/mgP, p-value is less than 0.001) as compared to non-smokers (0.231 U/mgP). Plasma ascorbic acid was also significantly lower in cigarette smokers (1.45 mg/100 ml, p-value is less than 0.05) as well as in bidi smokers (1.38 mg/100 ml, p-value is less than 0.001) as compared to non-smokers (1.73 mg/100 ml). There was a significant increase in erythrocyte malondialdehyde concentration levels in cigarette smokers (171.47 micromol/gHb, p-value is less than 0.05) as well as in bidi smokers (231.04 micromol/gHb, p-value is less than 0.001) as compared to non-smokers (127.30 micromol/gHb). These results provide enough evidence of increased oxidative stress and a compromised antioxidant defence system in smokers, and they are more profound in bidi smokers than in those smoking cigarettes. This study also revealed that the diet and nutrient intake of smokers are different from that of non-smokers.

The effect of tributyltin-oxide on earthworms, springtails, and plants in artificial and natural soils.

PubMed

Römbke, J; Jänsch, S; Junker, T; Pohl, B; Scheffczyk, A; Schallnass, H-J

2007-05-01

Chemical bioavailability in Organisation for Economic Co-operation and Development (OECD) artificial soil can contrast with bioavailability in natural soils and produce ecotoxicologic benchmarks that are not representative of species' exposure conditions in the field. Initially, reproduction and growth of earthworm and Collembolan species, and early seedling growth of a dicotyledonous plant species, in nine natural soils (with a wide range of physicochemical properties) and in OECD soil were evaluated. Soils that supported reproduction and growth of the test species were then used to investigate the toxicity of tributyltin-oxide (TBT-O). Natural soils caused greater toxicity of TBT-O to earthworms (EC(50) values varied from 0.5 to 4.7 mg/kg soil dry weight [dw]) compared with toxicity in OECD soil (EC(50) = 13.4 mg/kg dw). Collembolans were less sensitive to TBT-O than earthworms in natural soils, with EC(50) values ranging from 23.4 to 177.8 mg/kg dw. In contrast, the toxicity of TBT-O to collembolans in OECD soil (EC(50) = 104.0 mg/kg dw) was within the range of EC(50) values in natural soils. Phytotoxicity tests revealed even greater difference between the effects in natural soils (EC(50) values ranged from 10.7 to 189.2 mg/kg dw) and in OECD soil (EC(50) = 535.5 mg/kg dw) compared with results of the earthworm tests. Studies also showed that EC(50) values were a more robust end point compared with EC(10) values based on comparisons of coefficients of variation. These results show that toxicity testing should include studies with natural soils in addition to OECD soil to better reflect exposure conditions in the field.