NEW MEMBERS OF THE SCORPIUS-CENTAURUS COMPLEX AND AGES OF ITS SUB-REGIONS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Song, Inseok; Zuckerman, B.; Bessell, M. S.

2012-07-15

We have spectroscopically identified {approx}100 G-, K-, and M-type members of the Scorpius-Centaurus complex. To deduce the age of these young stars we compare their Li {lambda}6708 absorption line strengths against those of stars in the TW Hydrae association and {beta} Pictoris moving group. These line strengths indicate that Sco-Cen stars are younger than {beta} Pic stars whose ages of {approx}12 Myr have previously been derived from a kinematic traceback analysis. Our derived age, {approx}10 Myr, for stars in the Lower Centaurus Crux and Upper Centaurus Lupus subgroups of ScoCen is younger than previously published ages based on the movingmore » cluster method and upper main-sequence fitting. The discrepant ages are likely due to an incorrect (or lack of) cross-calibration between model-dependent and model-independent age-dating methods.« less

A REVISED AGE FOR UPPER SCORPIUS AND THE STAR FORMATION HISTORY AMONG THE F-TYPE MEMBERS OF THE SCORPIUS-CENTAURUS OB ASSOCIATION

DOE Office of Scientific and Technical Information (OSTI.GOV)

Pecaut, Mark J.; Mamajek, Eric E.; Bubar, Eric J.

2012-02-20

We present an analysis of the ages and star formation history of the F-type stars in the Upper Scorpius (US), Upper Centaurus-Lupus (UCL), and Lower Centaurus-Crux (LCC) subgroups of Scorpius-Centaurus (Sco-Cen), the nearest OB association. Our parent sample is the kinematically selected Hipparcos sample of de Zeeuw et al., restricted to the 138 F-type members. We have obtained classification-resolution optical spectra and have also determined the spectroscopic accretion disk fraction. With Hipparcos and 2MASS photometry, we estimate the reddening and extinction for each star and place the candidate members on a theoretical H-R diagram. For each subgroup we construct empiricalmore » isochrones and compare to published evolutionary tracks. We find that (1) our empirical isochrones are consistent with the previously published age-rank of the Sco-Cen subgroups; (2) subgroups LCC and UCL appear to reach the main-sequence turn-on at spectral types {approx}F4 and {approx}F2, respectively. An analysis of the A-type stars shows US reaching the main sequence at about spectral type {approx}A3. (3) The median ages for the pre-main-sequence members of UCL and LCC are 16 Myr and 17 Myr, respectively, in agreement with previous studies, however we find that (4) Upper Sco is much older than previously thought. The luminosities of the F-type stars in US are typically a factor of {approx}2.5 less luminous than predicted for a 5 Myr old population for four sets of evolutionary tracks. We re-examine the evolutionary state and isochronal ages for the B-, A-, and G-type Upper Sco members, as well as the evolved M supergiant Antares, and estimate a revised mean age for Upper Sco of 11 {+-} 1 {+-} 2 Myr (statistical, systematic). Using radial velocities and Hipparcos parallaxes we calculate a lower limit on the kinematic expansion age for Upper Sco of >10.5 Myr (99% confidence). However, the data are statistically consistent with no expansion. We reevaluate the inferred masses for the known substellar companions in Upper Sco using the revised age and find that the inferred masses are typically {approx}20%-70% higher than the original estimates which had assumed a much younger age; specifically, we estimate the mass of 1RXS J1609-2105b to be 14{sup +2}{sub -3} M{sub Jup}, suggesting that it is a brown dwarf rather than a planet. Finally, we find the fraction of F-type stars exhibiting H{alpha} emission and/or a K-band excess consistent with accretion to be 0/17 (<19%; 95% CL) in US at {approx}11 Myr, while UCL has 1/41 (2{sup +5}{sub -1}%; 68% CL) accretors and LCC has 1/50 (2{sup +4}{sub -1}%; 68% CL) accretors at {approx}16 Myr and {approx}17 Myr, respectively.« less

A Revised Age for Upper Scorpius and the Star Formation History among the F-type Members of the Scorpius-Centaurus OB Association

NASA Astrophysics Data System (ADS)

Pecaut, Mark J.; Mamajek, Eric E.; Bubar, Eric J.

2012-02-01

We present an analysis of the ages and star formation history of the F-type stars in the Upper Scorpius (US), Upper Centaurus-Lupus (UCL), and Lower Centaurus-Crux (LCC) subgroups of Scorpius-Centaurus (Sco-Cen), the nearest OB association. Our parent sample is the kinematically selected Hipparcos sample of de Zeeuw et al., restricted to the 138 F-type members. We have obtained classification-resolution optical spectra and have also determined the spectroscopic accretion disk fraction. With Hipparcos and 2MASS photometry, we estimate the reddening and extinction for each star and place the candidate members on a theoretical H-R diagram. For each subgroup we construct empirical isochrones and compare to published evolutionary tracks. We find that (1) our empirical isochrones are consistent with the previously published age-rank of the Sco-Cen subgroups; (2) subgroups LCC and UCL appear to reach the main-sequence turn-on at spectral types ~F4 and ~F2, respectively. An analysis of the A-type stars shows US reaching the main sequence at about spectral type ~A3. (3) The median ages for the pre-main-sequence members of UCL and LCC are 16 Myr and 17 Myr, respectively, in agreement with previous studies, however we find that (4) Upper Sco is much older than previously thought. The luminosities of the F-type stars in US are typically a factor of ~2.5 less luminous than predicted for a 5 Myr old population for four sets of evolutionary tracks. We re-examine the evolutionary state and isochronal ages for the B-, A-, and G-type Upper Sco members, as well as the evolved M supergiant Antares, and estimate a revised mean age for Upper Sco of 11 ± 1 ± 2 Myr (statistical, systematic). Using radial velocities and Hipparcos parallaxes we calculate a lower limit on the kinematic expansion age for Upper Sco of >10.5 Myr (99% confidence). However, the data are statistically consistent with no expansion. We reevaluate the inferred masses for the known substellar companions in Upper Sco using the revised age and find that the inferred masses are typically ~20%-70% higher than the original estimates which had assumed a much younger age; specifically, we estimate the mass of 1RXS J1609-2105b to be 14+2 -3 M Jup, suggesting that it is a brown dwarf rather than a planet. Finally, we find the fraction of F-type stars exhibiting Hα emission and/or a K-band excess consistent with accretion to be 0/17 (<19% 95% CL) in US at ~11 Myr, while UCL has 1/41 (2+5 -1% 68% CL) accretors and LCC has 1/50 (2+4 -1% 68% CL) accretors at ~16 Myr and ~17 Myr, respectively.

The End of Protoplanetary Disk Evolution: An ALMA Survey of Upper Scorpius

NASA Astrophysics Data System (ADS)

Barenfeld, Scott A.; Carpenter, John M.; Sargent, Anneila I.; Ricci, Luca; Isella, Andrea

2017-01-01

The evolution of the mass of solids in circumstellar disks is a key factor in determining how planets form. Infrared observations have established that the dust in primordial disks vanishes around the majority of stars by an age of 5-10 Myr. However, how this disappearance proceeds is poorly constrained. Only with longer wavelength observations, where the dust emission is optically thin, is it possible to measure disk dust mass and how it varies as a function of age. To this end, we have obtained ALMA 0.88 mm observations of over 100 sources with suspected circumstellar disks in the Upper Scorpius OB Association (Upper Sco). The 5-11 Myr age of Upper Sco suggests that any such disks will be quite evolved, making this association an ideal target to compare to systems of younger disks in order to study evolution. With ALMA, we achieve an order of magnitude improvement in sensitivity over previous (sub)millimeter surveys of Upper Sco and detect 58 disks in the continuum. We calculate the total dust masses of these disks and compare their masses to those of younger disks in Taurus, Lupus, and Chamaeleon. We find strong evidence for a decline in disk dust mass between these 1-3 Myr old systems and the 5-11 Myr old Upper Sco. Our results represent the first definitive measurement of a decline in disk dust mass with age.

Very Low-mass Stars and Brown Dwarfs in Upper Scorpius Using Gaia DR1: Mass Function, Disks, and Kinematics

NASA Astrophysics Data System (ADS)

Cook, Neil J.; Scholz, Aleks; Jayawardhana, Ray

2017-12-01

Our understanding of the brown dwarf population in star-forming regions is dependent on knowing distances and proper motions and therefore will be improved through the Gaia space mission. In this paper, we select new samples of very low-mass objects (VLMOs) in Upper Scorpius using UKIDSS colors and optimized proper motions calculated using Gaia DR1. The scatter in proper motions from VLMOs in Upper Scorpius is now (for the first time) dominated by the kinematic spread of the region itself, not by the positional uncertainties. With age and mass estimates updated using Gaia parallaxes for early-type stars in the same region, we determine masses for all VLMOs. Our final most complete sample includes 453 VLMOs of which ˜125 are expected to be brown dwarfs. The cleanest sample is comprised of 131 VLMOs, with ˜105 brown dwarfs. We also compile a joint sample from the literature that includes 415 VLMOs, out of which 152 are likely brown dwarfs. The disk fraction among low-mass brown dwarfs (M< 0.05 {M}⊙ ) is substantially higher than in more massive objects, indicating that disks around low-mass brown dwarfs survive longer than in low-mass stars overall. The mass function for 0.01< M< 0.1 {M}⊙ is consistent with the Kroupa Initial Mass Function. We investigate the possibility that some “proper motion outliers” have undergone a dynamical ejection early in their evolution. Our analysis shows that the color-magnitude cuts used when selecting samples introduce strong bias into the population statistics due to varying levels of contamination and completeness.

High-Resolution Infrared Spectroscopic Observations of the Upper Scorpius Eclipsing Binary EPIC 203868608

NASA Astrophysics Data System (ADS)

Johnson, Marshall C.; Mace, Gregory N.; Kim, Hwihyun; Kaplan, Kyle; McLane, Jacob; Sokal, Kimberly R.

2017-06-01

EPIC 203868608 is a source in the ~10 Myr old Upper Scorpius OB association. Using K2 photometry and ground-based follow-up observations, David et al. (2016) found that it consists of two brown dwarfs with a tertiary object at a projected separation of ~20 AU; the former objects appear to be a double-lined eclipsing binary with a period of 4.5 days. This is one of only two known eclipsing SB2s where both components are below the hydrogen-burning limit. We present additional follow-up observations of this system from the IGRINS high-resolution near-infrared spectrograph at McDonald Observatory. Our measured radial velocities do not follow the orbital solution presented by David et al. (2016). Instead, our combined IGRINS plus literature radial velocity dataset appears to indicate a period significantly different than that of the eclipsing binary obvious from the K2 light curve. We will discuss possible scenarios to account for the conflicting observations of this system.

Measurement of Circumstellar Disk Sizes in the Upper Scorpius OB Association with ALMA

NASA Astrophysics Data System (ADS)

Barenfeld, Scott A.; Carpenter, John M.; Sargent, Anneila I.; Isella, Andrea; Ricci, Luca

2017-12-01

We present detailed modeling of the spatial distributions of gas and dust in 57 circumstellar disks in the Upper Scorpius OB Association observed with ALMA at submillimeter wavelengths. We fit power-law models to the dust surface density and CO J = 3–2 surface brightness to measure the radial extent of dust and gas in these disks. We found that these disks are extremely compact: the 25 highest signal-to-noise disks have a median dust outer radius of 21 au, assuming an {R}-1 dust surface density profile. Our lack of CO detections in the majority of our sample is consistent with these small disk sizes assuming the dust and CO share the same spatial distribution. Of seven disks in our sample with well-constrained dust and CO radii, four appear to be more extended in CO, although this may simply be due to the higher optical depth of the CO. Comparison of the Upper Sco results with recent analyses of disks in Taurus, Ophiuchus, and Lupus suggests that the dust disks in Upper Sco may be approximately three times smaller in size than their younger counterparts, although we caution that a more uniform analysis of the data across all regions is needed. We discuss the implications of these results for disk evolution.

ROTATION PERIODS OF YOUNG BROWN DWARFS: K2 SURVEY IN UPPER SCORPIUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Scholz, Alexander; Kostov, Veselin; Jayawardhana, Ray

2015-08-20

We report rotational periods for 16 young brown dwarfs in the nearby Upper Scorpius association, based on 72 days of high-cadence, high-precision photometry from the Keplerspace telescope’s K2 mission. The periods range from a few hours to two days (plus one outlier at five days), with a median just above one day, confirming that brown dwarfs, except at the very youngest ages, are fast rotators. Interestingly, four of the slowest rotators in our sample exhibit mid-infrared excess emission from disks; at least two also show signs of disk eclipses and accretion in the light curves. Comparing these new periods withmore » those for two other young clusters and simple angular momentum evolution tracks, we find little or no rotational braking in brown dwarfs between 1–10 Myr, in contrast to low-mass stars. Our findings show that disk braking, while still at work, is inefficient in the substellar regime, thus providing an important constraint on the mass dependence of the braking mechanism.« less

Search for gravitational waves from Scorpius X-1 in the first Advanced LIGO observing run with a hidden Markov model

NASA Astrophysics Data System (ADS)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allen, G.; Allocca, A.; Almoubayyed, H.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Etienne, Z. B.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Essick, R. C.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y.-F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Weßels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; Suvorova, S.; Moran, W.; Evans, R. J.; LIGO Scientific Collaboration; Virgo Collaboration

2017-06-01

Results are presented from a semicoherent search for continuous gravitational waves from the brightest low-mass X-ray binary, Scorpius X-1, using data collected during the first Advanced LIGO observing run. The search combines a frequency domain matched filter (Bessel-weighted F -statistic) with a hidden Markov model to track wandering of the neutron star spin frequency. No evidence of gravitational waves is found in the frequency range 60-650 Hz. Frequentist 95% confidence strain upper limits, h095 %=4.0 ×1 0-25, 8.3 ×1 0-25, and 3.0 ×1 0-25 for electromagnetically restricted source orientation, unknown polarization, and circular polarization, respectively, are reported at 106 Hz. They are ≤10 times higher than the theoretical torque-balance limit at 106 Hz.

A SPITZER MIPS STUDY OF 2.5-2.0 M{sub Sun} STARS IN SCORPIUS-CENTAURUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Chen, Christine H.; Bitner, Martin; Pecaut, Mark

2012-09-10

We have obtained Spitzer Space Telescope Multiband Imaging Photometer for Spitzer (MIPS) 24 {mu}m and 70 {mu}m observations of 215 nearby, Hipparcos B- and A-type common proper-motion single and binary systems in the nearest OB association, Scorpius-Centaurus. Combining our MIPS observations with those of other ScoCen stars in the literature, we estimate 24 {mu}m B+A-type disk fractions of 17/67 (25{sup +6}{sub -5}%), 36/131 (27{sup +4}{sub -4}%), and 23/95 (24{sup +5}{sub -4}%) for Upper Scorpius ({approx}11 Myr), Upper Centaurus Lupus ({approx}15 Myr), and Lower Centaurus Crux ({approx}17 Myr), respectively, somewhat smaller disk fractions than previously obtained for F- and G-type members.more » We confirm previous IRAS excess detections and present new discoveries of 51 protoplanetary and debris disk systems, with fractional infrared luminosities ranging from L{sub IR}/L{sub *} = 10{sup -6} to 10{sup -2} and grain temperatures ranging from T{sub gr} = 40 to 300 K. In addition, we confirm that the 24 {mu}m and 70 {mu}m excesses (or fractional infrared luminosities) around B+A-type stars are smaller than those measured toward F+G-type stars and hypothesize that the observed disk property dependence on stellar mass may be the result of a higher stellar companion fraction around B- and A-type stars at 10-200 AU. Finally, we note that the majority of the ScoCen 24 {mu}m excess sources also possess 12 {mu}m excess, indicating that Earth-like planets may be forming via collisions in the terrestrial planet zone at {approx}10-100 Myr.« less

More Rapidly Rotating PMS M Dwarfs with Light Curves Suggestive of Orbiting Clouds of Material

NASA Astrophysics Data System (ADS)

Stauffer, John; Rebull, Luisa; David, Trevor J.; Jardine, Moira; Collier Cameron, Andrew; Cody, Ann Marie; Hillenbrand, Lynne A.; Barrado, David; van Eyken, Julian; Melis, Carl; Briceno, Cesar

2018-02-01

In a previous paper, using data from K2 Campaign 2, we identified 11 very low mass members of the ρ Oph and Upper Scorpius star-forming region as having periodic photometric variability and phased light curves showing multiple scallops or undulations. All of the stars with the “scallop-shell” light curve morphology are mid-to-late M dwarfs without evidence of active accretion and with photometric periods generally <1 day. Their phased light curves have too much structure to be attributed to non-axisymmetrically distributed photospheric spots and rotational modulation. We have now identified an additional eight probable members of the same star-forming region plus three stars in the Taurus star-forming region with this same light curve morphology and sharing the same period and spectral type range as the previous group. We describe the light curves of these new stars in detail and present their general physical characteristics. We also examine the properties of the overall set of stars in order to identify common features that might help elucidate the causes of their photometric variability.

Searches for continuous gravitational waves from Scorpius X-1 and XTE J1751-305 in LIGO's sixth science run

NASA Astrophysics Data System (ADS)

Meadors, G. D.; Goetz, E.; Riles, K.; Creighton, T.; Robinet, F.

2017-02-01

Scorpius X-1 (Sco X-1) and x-ray transient XTE J1751-305 are low-mass x-ray binaries (LMXBs) that may emit continuous gravitational waves detectable in the band of ground-based interferometric observatories. Neutron stars in LMXBs could reach a torque-balance steady-state equilibrium in which angular momentum addition from infalling matter from the binary companion is balanced by angular momentum loss, conceivably due to gravitational-wave emission. Torque balance predicts a scale for detectable gravitational-wave strain based on observed x-ray flux. This paper describes a search for Sco X-1 and XTE J1751-305 in LIGO science run 6 data using the TwoSpect algorithm, based on searching for orbital modulations in the frequency domain. While no detections are claimed, upper limits on continuous gravitational-wave emission from Sco X-1 are obtained, spanning gravitational-wave frequencies from 40 to 2040 Hz and projected semimajor axes from 0.90 to 1.98 light-seconds. These upper limits are injection validated, equal any previous set in initial LIGO data, and extend over a broader parameter range. At optimal strain sensitivity, achieved at 165 Hz, the 95% confidence level random-polarization upper limit on dimensionless strain h0 is approximately 1.8 ×10-24. The closest approach to the torque-balance limit, within a factor of 27, is also at 165 Hz. Upper limits are set in particular narrow frequency bands of interest for J1751-305. These are the first upper limits known to date on r -mode emission from this XTE source. The TwoSpect method will be used in upcoming searches of Advanced LIGO and Virgo data.

Upper Limits on Gravitational Waves from Scorpius X-1 from a Model-based Cross-correlation Search in Advanced LIGO Data

NASA Astrophysics Data System (ADS)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Chatziioannou, K.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M., Jr.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Galloway, D. K.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lousto, C. O.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y.-F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration; Steeghs, D.; Wang, L.

2017-09-01

We present the results of a semicoherent search for continuous gravitational waves from the low-mass X-ray binary Scorpius X-1, using data from the first Advanced LIGO observing run. The search method uses details of the modeled, parametrized continuous signal to combine coherently data separated by less than a specified coherence time, which can be adjusted to trade off sensitivity against computational cost. A search was conducted over the frequency range 25-2000 {Hz}, spanning the current observationally constrained range of binary orbital parameters. No significant detection candidates were found, and frequency-dependent upper limits were set using a combination of sensitivity estimates and simulated signal injections. The most stringent upper limit was set at 175 {Hz}, with comparable limits set across the most sensitive frequency range from 100 to 200 {Hz}. At this frequency, the 95% upper limit on the signal amplitude h 0 is 2.3× {10}-25 marginalized over the unknown inclination angle of the neutron star’s spin, and 8.0× {10}-26 assuming the best orientation (which results in circularly polarized gravitational waves). These limits are a factor of 3-4 stronger than those set by other analyses of the same data, and a factor of ˜7 stronger than the best upper limits set using data from Initial LIGO science runs. In the vicinity of 100 {Hz}, the limits are a factor of between 1.2 and 3.5 above the predictions of the torque balance model, depending on the inclination angle; if the most likely inclination angle of 44° is assumed, they are within a factor of 1.7.

A MAGELLAN MIKE AND SPITZER MIPS STUDY OF 1.5-1.0 M{sub sun} STARS IN SCORPIUS-CENTAURUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Chen, Christine H.; Bitner, Martin A.; Mamajek, Eric E.

2011-09-10

We obtained Spitzer Space Telescope Multiband Imaging Photometer for Spitzer (MIPS) 24 {mu}m and 70 {mu}m observations of 182 nearby, Hipparcos F- and G-type common proper motion single and binary systems in the nearest OB association, Scorpius-Centaurus. We also obtained Magellan/MIKE R {approx} 50,000 visual spectra at 3500-10500 A for 181 candidate ScoCen stars in single and binary systems. Combining our MIPS observations with those of other ScoCen stars in the literature, we estimate 24 {mu}m F+G-type disk fractions of 9/27 (33% {+-} 11%), 21/67 (31% {+-} 7%), and 25/71 (35% {+-} 7%) for Upper Scorpius ({approx}10 Myr), Upper Centaurusmore » Lupus ({approx}15 Myr), and Lower Centaurus Crux ({approx}17 Myr), respectively. We confirm previous IRAS and MIPS excess detections and present new discoveries of 41 protoplanetary and debris disk systems, with fractional infrared luminosities ranging from L{sub IR}/L{sub *} = 10{sup -5} to 10{sup -2} and grain temperatures ranging from T{sub gr} = 40-300 K. We searched for an increase in 24 {mu}m excess at an age of 15-20 Myr, consistent with the onset of debris production predicted by coagulation N-body simulations of outer planetary systems. We found such an increase around 1.5 M{sub sun} stars but discovered a decrease in the 24 {mu}m excess around 1.0 M{sub sun} stars. We additionally discovered that the 24 {mu}m excess around 1.0 M{sub sun} stars is larger than predicted by self-stirred models. Finally, we found a weak anti-correlation between fractional infrared luminosity (L{sub IR}/L{sub *}) and chromospheric activity (R'{sub HK}), that may be the result of differences in stellar properties, such as mass, luminosity, and/or winds.« less

New members of the TW Hydrae Association and two accreting M-dwarfs in Scorpius-Centaurus

NASA Astrophysics Data System (ADS)

Murphy, Simon J.; Lawson, Warrick A.; Bento, Joao

2015-11-01

We report the serendipitous discovery of several young mid-M stars found during a search for new members of the 30-40 Myr-old Octans Association. Only one of the stars may be considered a possible Octans(-Near) member. However, two stars have proper motions, kinematic distances, radial velocities, photometry and Li I λ6708 measurements consistent with membership in the 8-10 Myr-old TW Hydrae Association. Another may be an outlying member of TW Hydrae but has a velocity similar to that predicted by membership in Octans. We also identify two new lithium-rich members of the neighbouring Scorpius-Centaurus OB Association (Sco-Cen). Both exhibit large 12 and 22 μm excesses and strong, variable Hα emission which we attribute to accretion from circumstellar discs. Such stars are thought to be incredibly rare at the ˜16 Myr median age of Sco-Cen and they join only one other confirmed M-type and three higher mass accretors outside of Upper Scorpius. The serendipitous discovery of two accreting stars hosting large quantities of circumstellar material may be indicative of a sizeable age spread in Sco-Cen, or further evidence that disc dispersal and planet formation time-scales are longer around lower mass stars. To aid future studies of Sco-Cen, we also provide a newly compiled catalogue of 305 early-type Hipparcos members with spectroscopic radial velocities sourced from the literature.

Mapping of the extinction in giant molecular clouds using optical star counts

NASA Astrophysics Data System (ADS)

Cambrésy, L.

1999-05-01

This paper presents large scale extinction maps of most nearby Giant Molecular Clouds of the Galaxy (Lupus, rho Ophiuchus, Scorpius, Coalsack, Taurus, Chamaeleon, Musca, Corona Australis, Serpens, IC 5146, Vela, Orion, Monoceros R1 and R2, Rosette, Carina) derived from a star count method using an adaptive grid and a wavelet decomposition applied to the optical data provided by the USNO-Precision Measuring Machine. The distribution of the extinction in the clouds leads to estimate their total individual masses M and their maximum of extinction. I show that the relation between the mass contained within an iso-extinction contour and the extinction is similar from cloud to cloud and allows the extrapolation of the maximum of extinction in the range 5.7 to 25.5 magnitudes. I found that about half of the mass is contained in regions where the visual extinction is smaller than 1 magnitude. The star count method used on large scale ( ~ 250 square degrees) is a powerful and relatively straightforward method to estimate the mass of molecular complexes. A systematic study of the all sky would lead to discover new clouds as I did in the Lupus complex for which I found a sixth cloud of about 10(4) M_⊙.

Analysis of interstellar cloud structure based on IRAS images

NASA Technical Reports Server (NTRS)

Scalo, John M.

1992-01-01

The goal of this project was to develop new tools for the analysis of the structure of densely sampled maps of interstellar star-forming regions. A particular emphasis was on the recognition and characterization of nested hierarchical structure and fractal irregularity, and their relation to the level of star formation activity. The panoramic IRAS images provided data with the required range in spatial scale, greater than a factor of 100, and in column density, greater than a factor of 50. In order to construct densely sampled column density maps of star-forming clouds, column density images of four nearby cloud complexes were constructed from IRAS data. The regions have various degrees of star formation activity, and most of them have probably not been affected much by the disruptive effects of young massive stars. The largest region, the Scorpius-Ophiuchus cloud complex, covers about 1000 square degrees (it was subdivided into a few smaller regions for analysis). Much of the work during the early part of the project focused on an 80 square degree region in the core of the Taurus complex, a well-studied region of low-mass star formation.

Identification of young stellar variables with KELT for K2 - II. The Upper Scorpius association

NASA Astrophysics Data System (ADS)

Ansdell, Megan; Oelkers, Ryan J.; Rodriguez, Joseph E.; Gaidos, Eric; Somers, Garrett; Mamajek, Eric; Cargile, Phillip A.; Stassun, Keivan G.; Pepper, Joshua; Stevens, Daniel J.; Beatty, Thomas G.; Siverd, Robert J.; Lund, Michael B.; Kuhn, Rudolf B.; James, David; Gaudi, B. Scott

2018-01-01

High-precision photometry from space-based missions such as K2 and Transiting Exoplanet Survey Satellite enables detailed studies of young star variability. However, because space-based observing campaigns are often short (e.g. 80 d for K2), complementary long-baseline photometric surveys are critical for obtaining a complete understanding of young star variability, which can change on time-scales of minutes to years. We therefore present and analyse light curves of members of the Upper Scorpius association made over 5.5 yr by the ground-based Kilodegree Extremely Little Telescope (KELT), which complement the high-precision observations of this region taken by K2 during its Campaigns 2 and 15. We show that KELT data accurately identify the periodic signals found with high-precision K2 photometry, demonstrating the power of ground-based surveys in deriving stellar rotation periods of young stars. We also use KELT data to identify sources exhibiting variability that is likely related to circumstellar material and/or stellar activity cycles; these signatures are often unseen in the short-term K2 data, illustrating the importance of long-term monitoring surveys for studying the full range of young star variability. We provide the KELT light curves as electronic tables in an ongoing effort to establish legacy time series data sets for young stellar clusters.

Search for Wide Planetary-Mass Companions in Young Star-Forming Regions with UKIDSS and Pan-STARRS

NASA Astrophysics Data System (ADS)

Aller, Kimberly M.; Kraus, A. L.; Liu, M. C.; Bowler, B. P.

2013-01-01

Over the past decade, planetary-mass (<15 MJup) companions have been discovered in very wide orbits (>100 AU) around young stars. It is unclear whether these objects formed like planets or like stars. If these are planets, then modifications to core accretion or disk instability models are needed to allow formation at such wide orbits, or planet scattering must be an important mechanism. On the other hand, if these objects formed like stars, we need to understand the frequency of these extremely low mass ratio binary companions which challenge brown dwarf formation models. Regardless of their origins, these wide companions are easier to observe than close-in planets and can be used as benchmarks to understand the properties of young planets. We have combined optical and NIR photometry from UKIDSS and Pan-STARRS-1 to search the young star-forming region of Upper Scorpius and Taurus for new planetary-mass objects, going ≈3 mag deeper than previous work with 2MASS. We identified several candidates with very wide separations (≈400-4000 AU) from known members using a combination of color selection and spectral energy distribution (SED) fitting to templates of known low-mass stars and brown dwarfs. Furthermore, we have obtained followup NIR spectra of several Upper Scorpius candidates to spectroscopically identify three new wide very low-mass companions (≈15-25 MJup spectral type of M8-L0).

Tuning into Scorpius X-1: adapting a continuous gravitational-wave search for a known binary system

NASA Astrophysics Data System (ADS)

Meadors, Grant David; Goetz, Evan; Riles, Keith

2016-05-01

We describe how the TwoSpect data analysis method for continuous gravitational waves (GWs) has been tuned for directed sources such as the low-mass X-ray binary (LMXB), Scorpius X-1 (Sco X-1). A comparison of five search algorithms generated simulations of the orbital and GW parameters of Sco X-1. Whereas that comparison focused on relative performance, here the simulations help quantify the sensitivity enhancement and parameter estimation abilities of this directed method, derived from an all-sky search for unknown sources, using doubly Fourier-transformed data. Sensitivity is shown to be enhanced when the source sky location and period are known, because we can run a fully templated search, bypassing the all-sky hierarchical stage using an incoherent harmonic sum. The GW strain and frequency, as well as the projected semi-major axis of the binary system, are recovered and uncertainty estimated, for simulated signals that are detected. Upper limits for GW strain are set for undetected signals. Applications to future GW observatory data are discussed. Robust against spin-wandering and computationally tractable despite an unknown frequency, this directed search is an important new tool for finding gravitational signals from LMXBs.

Rotation in USco and rho Oph with K2

NASA Astrophysics Data System (ADS)

Rebull, Luisa; Stauffer, John; K2 Clusters Team

2018-01-01

K2 observed Upper Scorpius and rho Oph as part of their Campaign 2 in 2014. At ~8 and ~1 Myr respectively, the stars in Upper Sco and rho Oph exhibit greater diversity of light curve shapes than are found in older clusters observed with K2 such as Pleiades or Praesepe. Nonetheless, we are able to derive rotation periods for 85% (971/1136) of the USco members and 80% (71/88) of the rho Oph members. About 25% of the periodic stars have evidence for multiple periods. These light curves sample smaller amplitudes to lower masses and with a far better cadence, than has even been probed before. We can compare USco with similar stars in Praesepe (~700 Myr) and the Pleiades (~125 Myr), all with K2 light curves.

Discovery of new dipper stars with K2: a window into the inner disc region of T Tauri stars

NASA Astrophysics Data System (ADS)

Hedges, Christina; Hodgkin, Simon; Kennedy, Grant

2018-05-01

In recent years, a new class of young stellar object (YSO) has been defined, referred to as dippers, where large transient drops in flux are observed. These dips are too large to be attributed to stellar variability, last from hours to days and can reduce the flux of a star by 10-50 per cent. This variability has been attributed to occultations by warps or accretion columns near the inner edge of circumstellar discs. Here, we present 95 dippers in the Upper Scorpius association and ρ Ophiuchus cloud complex found in K2 Campaign 2 data using supervised machine learning with a random forest classifier. We also present 30 YSOs that exhibit brightening events on the order of days, known as bursters. Not all dippers and bursters are known members, but all exhibit infrared excesses and are consistent with belonging to either of the two young star-forming regions. We find 21.0 ± 5.5 per cent of stars with discs are dippers for both regions combined. Our entire dipper sample consists only of late-type (KM) stars, but we show that biases limit dipper discovery for earlier spectral types. Using the dipper properties as a proxy, we find that the temperature at the inner disc edge is consistent with interferometric results for similar and earlier type stars.

A Transient Transit Signature Associated with the Young Star RIK-210

DOE Office of Scientific and Technical Information (OSTI.GOV)

David, Trevor J.; Hillenbrand, Lynne A.; Howard, Andrew W.

We find transient transit-like dimming events within the K2 time series photometry of the young star RIK-210 in the Upper Scorpius OB association. These dimming events are variable in depth, duration, and morphology. High spatial resolution imaging revealed that the star is single and radial velocity monitoring indicated that the dimming events cannot be due to an eclipsing stellar or brown dwarf companion. Archival and follow-up photometry suggest the dimming events are transient in nature. The variable morphology of the dimming events suggests they are not due to a single spherical body. The ingress of each dimming event is alwaysmore » shallower than egress, as one would expect for an orbiting body with a leading tail. The dimming events are periodic and synchronous with the stellar rotation. However, we argue it is unlikely the dimming events could be attributed to anything on the stellar surface based on the observed depths and durations. Variable obscuration by a protoplanetary disk is unlikely on the basis that the star is not actively accreting and lacks the infrared excess associated with an inner disk. Rather, we explore the possibilities that the dimming events are due to magnetospheric clouds, a transiting protoplanet surrounded by circumplanetary dust and debris, eccentric orbiting bodies undergoing periodic tidal disruption, or an extended field of dust or debris near the corotation radius.« less

Wide-field Infrared Polarimetry of the ρ Ophiuchi Cloud Core

NASA Astrophysics Data System (ADS)

Kwon, Jungmi; Tamura, Motohide; Hough, James H.; Nakajima, Yasushi; Nishiyama, Shogo; Kusakabe, Nobuhiko; Nagata, Tetsuya; Kandori, Ryo

2015-09-01

We conducted wide and deep simultaneous JHKs-band imaging polarimetry of the ρ Ophiuchi cloud complex. Aperture polarimetry in the JHKs band was conducted for 2136 sources in all three bands, of which 322 sources have significant polarizations in all the JHKs bands and have been used for a discussion of the core magnetic fields. There is a positive correlation between degrees of polarization and H - Ks color up to H - Ks ≈ 3.5. The magnetic field structures in the core region are revealed up to at least AV ≈ 47 mag and are unambiguously defined in each sub-region (core) of Oph-A, Oph-B, Oph-C, Oph-E, Oph-F, and Oph-AC. Their directions, degrees of polarization, and polarization efficiencies differ but their changes are gradual; thus, the magnetic fields appear to be connected from core to core, rather than as a simple overlap of the different cloud core components. Comparing our results with the large-scale field structures obtained from previous optical polarimetric studies, we suggest that the magnetic field structures in the core were distorted by the cluster formation in this region, which may have been induced by shock compression due to wind/radiation from the Scorpius-Centaurus association.

Study Pollution Impacts on Upper-Tropospheric Clouds with Aura, CloudSat, and CALIPSO Data

NASA Technical Reports Server (NTRS)

Wu, Dong

2007-01-01

This viewgraph presentation reviews the impact of pollution on clouds in the Upper Troposphere. Using the data from the Aura Microwave Limb Sounder (MLS), CloudSat, CALIPSO the presentation shows signatures of pollution impacts on clouds in the upper troposphere. The presentation demonstrates the complementary sensitivities of MLS , CloudSat and CALIPSO to upper tropospheric clouds. It also calls for careful analysis required to sort out microphysical changes from dynamical changes.

VizieR Online Data Catalog: VLM stars and BDs in Upper Sco using Gaia DR1 (Cook+, 2017)

NASA Astrophysics Data System (ADS)

Cook, N. J.; Scholz, A.; Jayawardhana, R.

2018-04-01

We used literature samples (Dawson et al. (2011MNRAS.418.1231D, Cat. J/MNRAS/418/1231), Lodieu et al. (2011MNRAS.418.2604L), Dawson et al. (2013MNRAS.429..903D, Cat. J/MNRAS/429/903), Lodieu (2013MNRAS.431.3222L, Cat. J/MNRAS/431/3222), Lodieu (2013MNRAS.435.2474L, Cat. J/MNRAS/435/2474) and Dawson et al. (2014MNRAS.442.1586D)) and UKIDSS photometric data (Lawrence et al. (2007MNRAS.379.1599L, Cat. II/314) along with new proper motion data (using data from Gaia DR1 i.e. Altmann et al. (2017A&A...600L...4A, Cat. I/339), Tian et al. (2017ApJS..232....4T)) to construct catalogues of objects in Upper Scorpius. (8 data files).

Zodiacal Exoplanets in Time (ZEIT). V. A Uniform Search for Transiting Planets in Young Clusters Observed by K2

NASA Astrophysics Data System (ADS)

Rizzuto, Aaron C.; Mann, Andrew W.; Vanderburg, Andrew; Kraus, Adam L.; Covey, Kevin R.

2017-12-01

Detection of transiting exoplanets around young stars is more difficult than for older systems owing to increased stellar variability. Nine young open cluster planets have been found in the K2 data, but no single analysis pipeline identified all planets. We have developed a transit search pipeline for young stars that uses a transit-shaped notch and quadratic continuum in a 12 or 24 hr window to fit both the stellar variability and the presence of a transit. In addition, for the most rapid rotators ({P}{rot}< 2 days) we model the variability using a linear combination of observed rotations of each star. To maximally exploit our new pipeline, we update the membership for four stellar populations observed by K2 (Upper Scorpius, Pleiades, Hyades, Praesepe) and conduct a uniform search of the members. We identify all known transiting exoplanets in the clusters, 17 eclipsing binaries, one transiting planet candidate orbiting a potential Pleiades member, and three orbiting unlikely members of the young clusters. Limited injection recovery testing on the known planet hosts indicates that for the older Praesepe systems we are sensitive to additional exoplanets as small as 1-2 R ⊕, and for the larger Upper Scorpius planet host (K2-33) our pipeline is sensitive to ˜4 R ⊕ transiting planets. The lack of detected multiple systems in the young clusters is consistent with the expected frequency from the original Kepler sample, within our detection limits. With a robust pipeline that detects all known planets in the young clusters, occurrence rate testing at young ages is now possible.

World-Wide Effort Produces Dramatic "Movie" of Cosmic Jet

NASA Astrophysics Data System (ADS)

2001-05-01

Astronomers using a world-wide collection of radio telescopes, including the National Science Foundation's Very Long Baseline Array (VLBA) of the National Radio Astronomy Observatory (NRAO), have made a dramatic "movie" of a voracious, superdense neutron star repeatedly spitting out subatomic particles at nearly the speed of light into two narrow jets as it pulls material from a companion star. The movie shows these jets ejecting clouds of hot plasma that are then "zapped" by pulses of energy in the jets as they move away from the neutron star. Frame from Radio-Telescope 'Movie' of Scorpius X-1 "We have directly measured the speed of energy flow in a cosmic jet for the first time," said Ed Fomalont, an astronomer at the NRAO in Charlottesville, Virginia. Fomalont worked with Barry Geldzahler and Charles Bradshaw of George Mason University in Fairfax, Virginia. The astronomers used the VLBA, the NSF's Very Large Array (VLA) and the Green Bank 140-foot telescope, along with radio telescopes from the European VLBI Network, Australia, Japan and South Africa to record the double-star system's eruptions continuously for 56 hours. "This study is going to be extremely valuable in helping us understand a phenomenon that we see throughout the universe," Fomalont said. Cosmic jets of superfast particles are ejected from the cores of numerous galaxies. On a smaller scale, similar jets are ejected from binary-star systems closer to home, in our own Milky Way Galaxy. While the jets from galaxy cores are thought to be powered by supermassive black holes millions of times more massive than the Sun, the closer "microquasars" are powered by much smaller black holes or by neutron stars only a few times more massive than the sun. "Studying one of the closer, smaller examples will help us understand how they all work, including the bigger ones," Geldzahler said. "The jets coming from distant galaxies are harder to study because of their much greater distance and the slowness of their evolution. The changes we saw in an hour take thousands of years in the distant galaxies," he added. The astronomers observed Scorpius X-1, a system consisting of a neutron star roughly 1.5 times the mass of the sun and a "normal" star about the same mass as the sun. The two, more than 9,000 light-years from Earth in the constellation Scorpius, orbit each other every 18 hours and 53 minutes. Scientific instruments aboard a brief rocket flight over New Mexico in 1962 revealed that X-rays are coming from the system, and the pair of stars has been observed extensively since then. For the latest study, whose results are published in the May 20 issue of the Astrophysical Journal Letters, Fomalont, Geldzahler and Bradshaw used telescopes around the world to make highly-detailed radio images of the ejections. As the object went below the horizon for one set of radio telescopes, it was rising for the next set, allowing continuous imaging for the 56-hour period. The Very Long Baseline Array In the U.S., the astronomers used the VLBA, a network of 10 radio telescopes spread across U.S. territory from Hawaii to the Virgin Islands. They also used the European VLBI Network, including telescopes in the United Kingdom, Italy, Poland, Spain, Sweden and the Netherlands, plus a telescope in South Africa and one at the NRAO in Green Bank, WV. In addition, they used the Asia-Pacific Telescope Array which included five telescopes in Australia, plus telescopes in China, Japan and South Africa. "To keep watching this thing as the Earth turned, we had to use most of the major radio telescopes in the world, and the necessary coordination took months to organize," Fomalont said. At the same time, two optical observatories, Braeside Observatory and the Steward Observatory 90-inch telescope on Kitt Peak, and the orbiting Rossi X-ray Timing Explorer observed the object. "These observations tell us what is happening near the neutron star and the accretion disk" said Bradshaw. "All of the energy in the jet and the radio source is produced from this small region." The individual radio telescopes were combined into larger "virtual telescopes" capable of producing extremely detailed images. The "movie" of Scorpius X-1 consists of images showing detail roughly equivalent to being able to read a newspaper in Los Angeles from the distance of New York. Cosmic jets, most astronomers believe, arise when a massive object, such as a neutron star or a black hole, draws in material. Instead of being sucked directly into the massive object, the material first forms a whirling "accretion disk" that closely orbits the central object. Friction within the accretion disk can heat it to temperatures so hot that it radiates X-rays. Excess energy also is vented by ejecting subatomic particles from the poles of the disk at speeds nearly that of light. "These things are tremendous particle accelerators, propelling huge amounts of matter at fantastic speeds. Unfortunately, we don't understand the physics of how they work very well at all. That's why we're so excited to have this 'movie' of extremely detailed images to help us figure out what is really going on in this system," Geldzahler said. "Ed and I have been studying Scorpius X-1 for nearly 20 years and we finally got the resources to probe deeply into its evolution." During the 56 hours in June of 1999 when the astronomers were observing, Scorpius X-1 cooperated by being very active. The object's core, near the orbiting pair of stars, showed changes in the brightness of its radio emission. In addition, "lobes" of bright radio emission were pushed outward by the jets at about half the speed of light. These lobes, the scientists think, are produced when the fast moving particles in the jet, created from the accretion disk, collide with the surrounding interstellar material caught in the flow. Near the beginning of the movie, one moving set of lobes disappeared, but new lobes were ejected from the core a few hours later and proceeded outward. The movie also shows Einstein's relativity in action. Although two clouds are pushed by the jets in opposite directions away from the core, the cloud moving toward the Earth appears to be 15 times brighter and moving two times as fast as the cloud moving away from us. "We believe that both clouds are similar and the difference that we see is just a relativistic illusion caused by their fast motions," said Fomalont. Twice, the core flared in brightness as it shot a burst of electrons outward at more than 95 percent of light speed. As this burst reached the lobes, the collision of the fast electrons with the lobe material caused the lobes to brighten. The exquisite detail and continuous formation of the radio images allowed the scientists to directly measure the speed of the fast electrons in the beam, marking the first time ever that the speed of energy flow in such a cosmic jet has been measured. "Scorpius X-1 put on a great show for us. Now it's up to us to figure out how it performs its act," said Fomalont. The National Radio Astronomy Observatory is a facility of the National Science Foundation, operated under cooperative agreement by Associated Universities, Inc.

The optical + infrared L dwarf spectral sequence of young planetary-mass objects in the Upper Scorpius association

NASA Astrophysics Data System (ADS)

Lodieu, N.; Zapatero Osorio, M. R.; Béjar, V. J. S.; Peña Ramírez, K.

2018-01-01

We present the results of photometric and spectroscopic follow-ups of the lowest mass member candidates in the nearest OB association, Upper Scorpius (∼5-10 Myr; 145 ± 17 pc), with the Gran Telescopio de Canarias (GTC) and European Southern Observatory (ESO) Very Large Telescope (VLT). We confirm the membership of the large majority (>80 per cent) of candidates originally selected photometrically and astrometrically based on their spectroscopic features, weak equivalent widths of gravity-sensitive doublets and radial velocities. Confirmed members follow a sequence over a wide magnitude range (J = 17.0-19.3 mag) in several colour-magnitude diagrams with optical, near- and mid-infrared photometry and have near-infrared spectral types in the L1-L7 interval with likely masses below 15 Jupiter masses. We find that optical spectral types tend to be earlier than near-infrared spectral types by a few subclasses for spectral types later than M9. We investigate the behaviour of spectral indices, defined in the literature as a function of spectral type and gravity, by comparison with values reported in the literature for young and old dwarfs. We also derive effective temperatures in the 1900-1600 K range from fits of synthetic model-atmosphere spectra to the observed photometry, but we caution that the procedure carries large uncertainties. We determine bolometric corrections for young L dwarfs with ages of ∼5-10 Myr (Upper Sco association) and find them to be similar in the J band but larger by 0.1-0.4 mag in the K band with respect to field L dwarfs. Finally, we discover two faint young L dwarfs, Visible and Infrared Survey Telescope for Astronomy (VISTA) J1607-2146 (L4.5) and VISTA J1611-2215 (L5), that have Hα emission and possible flux excesses at 4.5 μm, pointing to the presence of accretion from a disc on to the central objects of mass below ∼15MJup at an age of 5-10 Myr.

Cirrus Cloud Retrieval Using Infrared Sounding Data: Multilevel Cloud Errors.

NASA Astrophysics Data System (ADS)

Baum, Bryan A.; Wielicki, Bruce A.

1994-01-01

In this study we perform an error analysis for cloud-top pressure retrieval using the High-Resolution Infrared Radiometric Sounder (HIRS/2) 15-µm CO2 channels for the two-layer case of transmissive cirrus overlying an overcast, opaque stratiform cloud. This analysis includes standard deviation and bias error due to instrument noise and the presence of two cloud layers, the lower of which is opaque. Instantaneous cloud pressure retrieval errors are determined for a range of cloud amounts (0.1 1.0) and cloud-top pressures (850250 mb). Large cloud-top pressure retrieval errors are found to occur when a lower opaque layer is present underneath an upper transmissive cloud layer in the satellite field of view (FOV). Errors tend to increase with decreasing upper-cloud elective cloud amount and with decreasing cloud height (increasing pressure). Errors in retrieved upper-cloud pressure result in corresponding errors in derived effective cloud amount. For the case in which a HIRS FOV has two distinct cloud layers, the difference between the retrieved and actual cloud-top pressure is positive in all casts, meaning that the retrieved upper-cloud height is lower than the actual upper-cloud height. In addition, errors in retrieved cloud pressure are found to depend upon the lapse rate between the low-level cloud top and the surface. We examined which sounder channel combinations would minimize the total errors in derived cirrus cloud height caused by instrument noise and by the presence of a lower-level cloud. We find that while the sounding channels that peak between 700 and 1000 mb minimize random errors, the sounding channels that peak at 300—500 mb minimize bias errors. For a cloud climatology, the bias errors are most critical.

A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius.

PubMed

Cutfield, S M; Cutfield, J F

1993-09-01

The peptide hormone glucagon has been isolated from the islet tissue (Brockmann bodies) of the teleost Cottus scorpius (daddy sculpin) and sequenced. The sequence is HSEGTSNDYSKYLEDRKAQDFVQWLMNN differing at four positions from the glucagon found earlier in the same species by Conlon and coworkers (1987b, Eur. J. Biochem, 164, 117-122). Thus sculpin, in common with anglerfish, possesses two distinct glucagons. Comparative sequence data are presented as a phylogenetic tree.

Directed searches for continuous gravitational waves from spinning neutron stars in binary systems

NASA Astrophysics Data System (ADS)

Meadors, Grant David

2014-09-01

Gravitational wave detectors such as the Laser Interferometer Gravitational-wave Observatory (LIGO) seek to observe ripples in space predicted by General Relativity. Black holes, neutron stars, supernovae, the Big Bang and other sources can radiate gravitational waves. Original contributions to the LIGO effort are presented in this thesis: feedforward filtering, directed binary neutron star searches for continuous waves, and scientific outreach and education, as well as advances in quantum optical squeezing. Feedforward filtering removes extraneous noise from servo-controlled instruments. Filtering of the last science run, S6, improves LIGO's astrophysical range (+4.14% H1, +3.60% L1: +12% volume) after subtracting noise from auxiliary length control channels. This thesis shows how filtering enhances the scientific sensitivity of LIGO's data set during and after S6. Techniques for non-stationarity and verifying calibration and integrity may apply to Advanced LIGO. Squeezing is planned for future interferometers to exceed the standard quantum limit on noise from electromagnetic vacuum fluctuations; this thesis discusses the integration of a prototype squeezer at LIGO Hanford Observatory and impact on astrophysical sensitivity. Continuous gravitational waves may be emitted by neutron stars in low-mass X-ray binary systems such as Scorpius X-1. The TwoSpect directed binary search is designed to detect these waves. TwoSpect is the most sensitive of 4 methods in simulated data, projecting an upper limit of 4.23e-25 in strain, given a year-long data set at an Advanced LIGO design sensitivity of 4e-24 Hz. (-1/2). TwoSpect is also used on real S6 data to set 95% confidence upper limits (40 Hz to 2040 Hz) on strain from Scorpius X-1. A millisecond pulsar, X-ray transient J1751-305, is similarly considered. Search enhancements for Advanced LIGO are proposed. Advanced LIGO and fellow interferometers should detect gravitational waves in the coming decade. Methods in these thesis will benefit both the instrumental and analytical sides of observation.

Evaluation of Satellite-Based Upper Troposphere Cloud Top Height Retrievals in Multilayer Cloud Conditions During TC4

NASA Technical Reports Server (NTRS)

Chang, Fu-Lung; Minnis, Patrick; Ayers, J. Kirk; McGill, Matthew J.; Palikonda, Rabindra; Spangenberg, Douglas A.; Smith, William L., Jr.; Yost, Christopher R.

2010-01-01

Upper troposphere cloud top heights (CTHs), restricted to cloud top pressures (CTPs) less than 500 hPa, inferred using four satellite retrieval methods applied to Twelfth Geostationary Operational Environmental Satellite (GOES-12) data are evaluated using measurements during the July August 2007 Tropical Composition, Cloud and Climate Coupling Experiment (TC4). The four methods are the single-layer CO2-absorption technique (SCO2AT), a modified CO2-absorption technique (MCO2AT) developed for improving both single-layered and multilayered cloud retrievals, a standard version of the Visible Infrared Solar-infrared Split-window Technique (old VISST), and a new version of VISST (new VISST) recently developed to improve cloud property retrievals. They are evaluated by comparing with ER-2 aircraft-based Cloud Physics Lidar (CPL) data taken during 9 days having extensive upper troposphere cirrus, anvil, and convective clouds. Compared to the 89% coverage by upper tropospheric clouds detected by the CPL, the SCO2AT, MCO2AT, old VISST, and new VISST retrieved CTPs less than 500 hPa in 76, 76, 69, and 74% of the matched pixels, respectively. Most of the differences are due to subvisible and optically thin cirrus clouds occurring near the tropopause that were detected only by the CPL. The mean upper tropospheric CTHs for the 9 days are 14.2 (+/- 2.1) km from the CPL and 10.7 (+/- 2.1), 12.1 (+/- 1.6), 9.7 (+/- 2.9), and 11.4 (+/- 2.8) km from the SCO2AT, MCO2AT, old VISST, and new VISST, respectively. Compared to the CPL, the MCO2AT CTHs had the smallest mean biases for semitransparent high clouds in both single-layered and multilayered situations whereas the new VISST CTHs had the smallest mean biases when upper clouds were opaque and optically thick. The biases for all techniques increased with increasing numbers of cloud layers. The transparency of the upper layer clouds tends to increase with the numbers of cloud layers.

On the existence of tropical anvil clouds

NASA Astrophysics Data System (ADS)

Seeley, J.; Jeevanjee, N.; Langhans, W.; Romps, D.

2017-12-01

In the deep tropics, extensive anvil clouds produce a peak in cloud cover below the tropopause. The dominant paradigm for cloud cover attributes this anvil peak to a layer of enhanced mass convergence in the clear-sky upper-troposphere, which is presumed to force frequent detrainment of convective anvils. However, cloud cover also depends on the lifetime of cloudy air after it detrains, which raises the possibility that anvil clouds may be the signature of slow cloud decay rather than enhanced detrainment. Here we measure the cloud decay timescale in cloud-resolving simulations, and find that cloudy updrafts that detrain in the upper troposphere take much longer to dissipate than their shallower counterparts. We show that cloud lifetimes are long in the upper troposphere because the saturation specific humidity becomes orders of magnitude smaller than the typical condensed water loading of cloudy updrafts. This causes evaporative cloud decay to act extremely slowly, thereby prolonging cloud lifetimes in the upper troposphere. As a consequence, extensive anvil clouds still occur in a convecting atmosphere that is forced to have no preferential clear-sky convergence layer. On the other hand, when cloud lifetimes are fixed at a characteristic lower-tropospheric value, extensive anvil clouds do not form. Our results support a revised understanding of tropical anvil clouds, which attributes their existence to the microphysics of slow cloud decay rather than a peak in clear-sky convergence.

A FORMATION SCENARIO OF YOUNG STELLAR GROUPS IN THE REGION OF THE SCORPIO CENTAURUS OB ASSOCIATION

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ortega, V. G.; Jilinski, E.; De la Reza, R.

2009-04-15

The main objective of this work is to investigate the role played by Lower Centaurus Crux (LCC) and Upper Centaurus Lupus (UCL), both subcomponents of the Scorpio Centaurus OB association (Sco-Cen), in the formation of the groups {beta} Pictoris, TW Hydrae, and the {eta} Chamaeleontis cluster. The dynamical evolution of all the stellar groups involved and of the bubbles and shells blown by LCC and UCL are calculated, and followed from the past to the present. This leads to a formation scenario in which (1) the groups {beta} Pictoris, TW Hydrae were formed in the wake of the shells createdmore » by LCC and UCL, (2) the young cluster {eta} Chamaeleontis was born as a consequence of the collision of the shells of LCC and UCL, and (3) the formation of Upper Scorpius (US), the other main subcomponent of the Sco-Cen association, may have been started by the same process that created {eta} Chamaeleontis.« less

SCORPIUS, A New Generation of Responsive, Low Cost Expendable Launch Vehicles

NASA Astrophysics Data System (ADS)

Conger, R. E.; Chakroborty, S. P.; Wertz, J. R.

2002-01-01

The Scorpius vehicle family extends from one and two stage sub-orbital vehicles for target and science applications to small, medium and heavy lift orbital vehicles. These new liquid fueled vehicles have LEO and GTO capabilities. Microcosm and the Scorpius Space Launch Company (SSLC) are well into the development of this all-new generation of expendable launch vehicles to support commercial and government missions. This paper presents the projected performance of the family of vehicles, status of the development program and projected launch service prices. The paper will discuss the new low cost ablative engines and low cost pressure-fed LOX/Jet-A propulsion systems. Schedules, payload volumes, dispensers, attach fittings, and planned dual manifest capabilities will be presented. The unique configuration of the wide base first stage allows fairings that may extend beyond the current 4-meters. The Scorpius family is designed to facilitate encapsulated payloads and launch-on-demand. The implications of these new operational procedures will be addressed, including the techniques that will be used to drive down the cost of access to space while improving reliability. The Scorpius family of low cost vehicles addresses the full range of payloads from 700 lbs. in the Sprite Mini-Lift to over 50,000 lbs. to LEO in the Heavy-Lift, and over 18,000 lbs. to GTO. Two sub-orbital vehicles have been developed and successfully launched, with the latest vehicle (SR-XM) launched in March of 2001 from White Sands Missile Range. Development of the family of vehicles commenced in 1993 under contracts with the Air Force Research Laboratory Space Vehicle Directorate after a number of years of independent studies and system engineering. The Sprite Mini-Lift Small Expendable Launch Vehicle (SELV) that utilizes the SR-XM technologies is planned for an initial launch in mid 2005 with larger, scaled-up vehicles to follow.

Radiative Heating of the ISCCP Upper Level Cloud Regimes and its Impact on the Large-scale Tropical Circulation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Li, Wei; Schumacher, Courtney; McFarlane, Sally A.

2013-01-31

Radiative heating profiles of the International Satellite Cloud Climatology Project (ISCCP) cloud regimes (or weather states) were estimated by matching ISCCP observations with radiative properties derived from cloud radar and lidar measurements from the Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) sites at Manus, Papua New Guinea, and Darwin, Australia. Focus was placed on the ISCCP cloud regimes containing the majority of upper level clouds in the tropics, i.e., mesoscale convective systems (MCSs), deep cumulonimbus with cirrus, mixed shallow and deep convection, and thin cirrus. At upper levels, these regimes have average maximum cloud occurrences ranging from 30% tomore » 55% near 12 km with variations depending on the location and cloud regime. The resulting radiative heating profiles have maxima of approximately 1 K/day near 12 km, with equal heating contributions from the longwave and shortwave components. Upper level minima occur near 15 km, with the MCS regime showing the strongest cooling of 0.2 K/day and the thin cirrus showing no cooling. The gradient of upper level heating ranges from 0.2 to 0.4 K/(day∙km), with the most convectively active regimes (i.e., MCSs and deep cumulonimbus with cirrus) having the largest gradient. When the above heating profiles were applied to the 25-year ISCCP data set, the tropics-wide average profile has a radiative heating maximum of 0.45Kday-1 near 250 hPa. Column-integrated radiative heating of upper level cloud accounts for about 20% of the latent heating estimated by the Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR). The ISCCP radiative heating of tropical upper level cloud only slightly modifies the response of an idealized primitive equation model forced with the tropics-wide TRMM PR latent heating, which suggests that the impact of upper level cloud is more important to large-scale tropical circulation variations because of convective feedbacks rather than direct forcing by the cloud radiative heating profiles. However, the height of the radiative heating maxima and gradient of the heating profiles are important to determine the sign and patterns of the horizontal circulation anomaly driven by radiative heating at upper levels.« less

Long-term Behaviour Of Venus Winds At Cloud Level From Virtis/vex Observations

NASA Astrophysics Data System (ADS)

Hueso, Ricardo; Peralta, J.; Sánchez-Lavega, A.; Pérez-Hoyos, S.; Piccioni, G.; Drossart, P.

2009-09-01

The Venus Express (VEX) mission has been in orbit to Venus for more than three years now. The VIRTIS instrument onboard VEX observes Venus in two channels (visible and infrared) obtaining spectra and multi-wavelength images of the planet. Images in the ultraviolet range are used to study the upper cloud at 66 km while images in the infrared (1.74 μm) map the opacity of the lower cloud deck at 48 km. Here we present an analysis of the overall dynamics of Venus’ atmosphere at both levels using observations that cover a large fraction of the VIRTIS dataset. We will present our latest results concerning the zonal winds, the overall stability in the lower cloud deck motions and the variability in the upper cloud. Meridional winds are also observed in the upper and lower cloud in the UV and IR images obtained with VIRTIS. While the upper clouds present a net meridional motion consistent with the upper branch of a Hadley cell the lower cloud present more irregular, variable and less intense motions in the meridional direction. Acknowledgements This work has been funded by Spanish MEC AYA2006-07735 with FEDER support and Grupos Gobierno Vasco IT-464-07. RH acknowledges a "Ramón y Cajal” contract from MEC.

Upper Tropospheric Ozone Between Latitudes 60S and 60N Derived from Nimbus 7 TOMS/THIR Cloud Slicing

NASA Technical Reports Server (NTRS)

Ziemke, Jerald R.; Chandra, Sushil; Bhartia, P. K.

2002-01-01

This study evaluates the spatial distributions and seasonal cycles in upper tropospheric ozone (pressure range 200-500 hPa) from low to high latitudes (60S to 60N) derived from the satellite retrieval method called "Cloud Slicing." Cloud Slicing is a unique technique for determining ozone profile information in the troposphere by combining co-located measurements of cloud-top, pressure and above-cloud column ozone. For upper tropospheric ozone, co-located measurements of Nimbus 7 Total Ozone Mapping Spectrometer (TOMS) above-cloud column ozone, and Nimbus 7 Temperature Humidity Infrared Radiometer (THIR) cloud-top pressure during 1979-1984 were incorporated. In the tropics, upper tropospheric ozone shows year-round enhancement in the Atlantic region and evidence of a possible semiannual variability. Upper tropospheric ozone outside the tropics shows greatest abundance in winter and spring seasons in both hemispheres with largest seasonal and largest amounts in the NH. These characteristics are similar to lower stratospheric ozone. Comparisons of upper tropospheric column ozone with both stratospheric ozone and a proxy of lower stratospheric air mass (i.e., tropopause pressure) from National Centers for Environmental Prediction (NCEP) suggest that stratosphere-troposphere exchange (STE) may be a significant source for the seasonal variability of upper tropospheric ozone almost everywhere between 60S and 60N except in low latitudes around 10S to 25N where other sources (e.g., tropospheric transport, biomass burning, aerosol effects, lightning, etc.) may have a greater role.

Directional selection in the evolution of elongated upper canines in clouded leopards and sabre-toothed cats.

PubMed

Harano, Tomohiro; Kutsukake, Nobuyuki

2018-06-14

Extremely developed or specialised traits such as the elongated upper canines of extinct sabre-toothed cats are often not analogous to those of any extant species, which limits our understanding of their evolutionary cause. However, an extant species may have undergone directional selection for a similar extreme phenotype. Among living felids, the clouded leopard, Neofelis nebulosa, has exceptionally long upper canines for its body size. We hypothesised that directional selection generated the elongated upper canines of clouded leopards in a manner similar to the process in extinct sabre-toothed cats. To test this, we developed an approach that compared the effect of directional selection among lineages in a phylogeny using a simulation of trait evolution and approximate Bayesian computation. This approach was applied to analyse the evolution of upper canine length in the Felidae phylogeny. Our analyses consistently showed directional selection favouring longer upper canines in the clouded leopard lineage and a lineage leading to the sabre-toothed cat with the longest upper canines, Smilodon. Most of our analyses detected an effect of directional selection for longer upper canines in the lineage leading to another sabre-toothed cat, Homotherium, although this selection may have occurred exclusively in the primitive species. In all the analyses, the clouded leopard and Smilodon lineages showed comparable directional selection. This implies that clouded leopards share a selection advantage with sabre-toothed cats in having elongated upper canines. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

Young Binaries and Early Stellar Evolution

NASA Astrophysics Data System (ADS)

Brandner, Wolfgang

1996-07-01

Most main-sequence stars are members of binary or multiple systems. The same is true for pre-main-sequence (PMS) stars, as recent surveys have shown. Therefore studying star formation means to a large extent studying the formation of binary systems. Similarly, studying early stellar evolution primarily involves PMS binary systems. In this thesis I have studied the binary frequency among ROSAT selected T Tauri stars in the Chamaeleon T association and the Scorpius-Centaurus OB association, and the evolutionary status of Hα-selected PMS binaries in the T associations of Chamaeleon, Lupus, and ρ Ophiuchi. The direct imaging and spectroscopic observations in the optical have been carried out under subarcsec seeing conditions at the ESO New Technology Telescope (NTT) at La Silla. Furthermore, high-spatial resolution images of selected PMS stars in the near infrared were obtained with the ESO adaptive optics system COME-ON+/ADONIS. Among 195 T Tauri stars observed using direct imaging 31 binaries could be identified, 12 of them with subarcsec separation. Based on statistical arguments alone I conclude that almost all of them are indeed physical (i.e. gravitationally bound) binary or multiple systems. Using astrometric measurements of some binaries I showed that the components of these binaries are common proper motion pairs, very likely in a gravitationally bound orbit around each other. The overall binary frequency among T Tauri stars with a range of separations between 120 and 1800 AU is in agreement with the binary frequency observed among main-sequence stars in the solar neighbourhood. However, within individual regions the spatial distribution of binaries is non-uniform. In particular, in Upper Scorpius, weak-line T Tauri stars in the vicinity of early type stars seem to be almost devoid of multiple systems, whereas in another area in Upper Scorpius half of all weak-line T Tauri stars have a companion in a range of separation between 0.''7 and 3.''0. For a sample of 14 spatially resolved PMS binaries (separations 0.''6 to 1.prime'7) located in the above mentioned T associations both photometric and spectroscopic information has been analyzed. All binaries (originally unresolved) were identified as PMS stars based on their strong Hα emission and their association with dark clouds. Using the spectral A index, which measures the strength of the CaH band at 697.5nm relative to the nearby continuum as a luminosity class indicator, I showed that the classical T Tauri stars in the sample tend to be close to luminosity class V. Eight out of the 14 pairs could be placed on an H--R diagram. When comparing with theoretical PMS evolutionary tracks the individual components of all pairs appear to be coeval within the observational errors. This result is similar to Hartigan et al. (1994) who found two thirds of the wider pairs with separations from 400 AU to 6000 AU to be coeval. However, unlike Hartigan et al.'s finding for the wider pairs, I find no non-coeval pairs. One of the presumed binaries in our sample (ESO Hα 281) turned out to be a likely chance projection with the ``primary'' showing neither Hα emission nor Li absorption. Finally, using adaptive optics at the ESO 3.6m telescope, diffraction-limited JHK images of the region around the Herbig AeBe star NX Pup were obtained. The close companion (sep. 0.''128) to NX Pup -- originally discovered by HST -- was clearly resolved and its JHK magnitudes were determined. A third object at a separation of 7.''0 from NX Pup was identified as a classical T Tauri star so that NX Pup may in fact form a hierarchical triple system. I discuss the evolutionary status of these stars and derive estimates for their spectral types, luminosities, masses, and ages. My conclusions are that binarity is established very early in stellar evolution, that the orbital parameters of wide binaries (a >= 120AU) remain virtually unchanged during their PMS evolution, and that the components of the wide binaries were formed at the same time --- perhaps either through collisional fragmentation or fragmentation of rotating filaments. (Copies of the thesis (written in German) and related pre-/reprints are available from the author upon request.)

Upper tropospheric cloud systems determined from IR Sounders and their influence on the atmosphere

NASA Astrophysics Data System (ADS)

Stubenrauch, Claudia; Protopapadaki, Sofia; Feofilov, Artem; Velasco, Carola Barrientos

2017-02-01

Covering about 30% of the Earth, upper tropospheric clouds play a key role in the climate system by modulating the Earth's energy budget and heat transport. Infrared Sounders reliably identify cirrus down to an IR optical depth of 0.1. Recently LMD has built global cloud climate data records from AIRS and IASI observations, covering the periods from 2003-2015 and 2008-2015, respectively. Upper tropospheric clouds often form mesoscale systems. Their organization and properties are being studied by (1) distinguishing cloud regimes within 2° × 2° regions and (2) applying a spatial composite technique on adjacent cloud pressures, which estimates the horizontal extent of the mesoscale cloud systems. Convective core, cirrus anvil and thin cirrus of these systems are then distinguished by their emissivity. Compared to other studies of tropical mesoscale convective systems our data include also the thinner anvil parts, which make out about 30% of the area of tropical mesoscale convective systems. Once the horizontal and vertical structure of these upper tropospheric cloud systems is known, we can estimate their radiative effects in terms of top of atmosphere and surface radiative fluxes and by computing their heating rates.

Multidecadal Changes in Near-Global Cloud Cover and Estimated Cloud Cover Radiative Forcing

NASA Technical Reports Server (NTRS)

Norris, Joel

2005-01-01

The first paper was Multidecadal changes in near-global cloud cover and estimated cloud cover radiative forcing, by J. R. Norris (2005, J. Geophys. Res. - Atmos., 110, D08206, doi: lO.l029/2004JD005600). This study examined variability in zonal mean surface-observed upper-level (combined midlevel and high-level) and low-level cloud cover over land during 1971-1 996 and over ocean during 1952-1997. These data were averaged from individual synoptic reports in the Extended Edited Cloud Report Archive (EECRA). Although substantial interdecadal variability is present in the time series, long-term decreases in upper-level cloud cover occur over land and ocean at low and middle latitudes in both hemispheres. Near-global upper-level cloud cover declined by 1.5%-sky-cover over land between 1971 and 1996 and by 1.3%-sky-cover over ocean between 1952 and 1997. Consistency between EECRA upper-level cloud cover anomalies and those from the International Satellite Cloud Climatology Project (ISCCP) during 1984-1 997 suggests the surface-observed trends are real. The reduction in surface-observed upper-level cloud cover between the 1980s and 1990s is also consistent with the decadal increase in all-sky outgoing longwave radiation reported by the Earth Radiation Budget Satellite (EMS). Discrepancies occur between time series of EECRA and ISCCP low-level cloud cover due to identified and probable artifacts in satellite and surface cloud data. Radiative effects of surface-observed cloud cover anomalies, called "cloud cover radiative forcing (CCRF) anomalies," are estimated based on a linear relationship to climatological cloud radiative forcing per unit cloud cover. Zonal mean estimated longwave CCRF has decreased over most of the globe. Estimated shortwave CCRF has become slightly stronger over northern midlatitude oceans and slightly weaker over northern midlatitude land areas. A long-term decline in the magnitude of estimated shortwave CCRF occurs over low-latitude land and ocean, but comparison with EMS all-sky reflected shortwave radiation during 1985-1997 suggests this decrease may be underestimated.

Nitric Acid Particles in Cold Thick Ice Clouds Observed at Global Scale: Link with Lightning, Temperature, and Upper Tropospheric Water Vapor

NASA Technical Reports Server (NTRS)

Chepfer, H.; Minnis, P.; Dubuisson, P.; Chiriaco, M.; Sun-Mack, S.; Riviere, E. D.

2007-01-01

Signatures of nitric acid particles (NAP) in cold thick ice clouds have been derived from satellite observations. Most NAP are detected in the Tropics (9 to 20% of clouds with T less than 202.5 K). Higher occurrences were found in the rare mid-latitudes very cold clouds. NAP occurrence increases as cloud temperature decreases and NAP are more numerous in January than July. Comparisons of NAP and lightning distributions show that lightning is the main source of the NOx, which forms NAP in cold clouds. Qualitative comparisons of NAP with upper tropospheric humidity distributions suggest that NAP play a role in the dehydration of the upper troposphere when the tropopause is colder than 195K.

Nitric acid particles in cold thick ice clouds observed at global scale: Link with lightning, temperature, and upper tropospheric water vapor

NASA Astrophysics Data System (ADS)

Chepfer, H.; Minnis, P.; Dubuisson, P.; Chiriaco, M.; Sun-Mack, S.; RivièRe, E. D.

2007-03-01

Signatures of nitric acid particles (NAP) in cold thick ice clouds have been derived from satellite observations. Most NAP are detected in the tropics (9 to 20% of clouds with T < 202.5 K). Higher occurrences were found in the rare midlatitudes very cold clouds. NAP occurrence increases as cloud temperature decreases, and NAP are more numerous in January than July. Comparisons of NAP and lightning distributions show that lightning seems to be the main source of the NOx, which forms NAP in cold clouds over continents. Qualitative comparisons of NAP with upper tropospheric humidity distributions suggest that NAP may play a role in the dehydration of the upper troposphere when the tropopause is colder than 195 K.

First all-sky search for continuous gravitational waves from unknown sources in binary systems

NASA Astrophysics Data System (ADS)

Aasi, J.; Abbott, B. P.; Abbott, R.; Abbott, T.; Abernathy, M. R.; Accadia, T.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Affeldt, C.; Agathos, M.; Aggarwal, N.; Aguiar, O. D.; Ain, A.; Ajith, P.; Alemic, A.; Allen, B.; Allocca, A.; Amariutei, D.; Andersen, M.; Anderson, R.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C.; Areeda, J.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Austin, L.; Aylott, B. E.; Babak, S.; Baker, P. T.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barbet, M.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barton, M. A.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Bauchrowitz, J.; Bauer, Th. S.; Behnke, B.; Bejger, M.; Beker, M. G.; Belczynski, C.; Bell, A. S.; Bell, C.; Bergmann, G.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Beyersdorf, P. T.; Bilenko, I. A.; Billingsley, G.; Birch, J.; Biscans, S.; Bitossi, M.; Bizouard, M. A.; Black, E.; Blackburn, J. K.; Blackburn, L.; Blair, D.; Bloemen, S.; Blom, M.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, G.; Bogan, C.; Bond, C.; Bondu, F.; Bonelli, L.; Bonnand, R.; Bork, R.; Born, M.; Boschi, V.; Bose, Sukanta; Bosi, L.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Bridges, D. O.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brückner, F.; Buchman, S.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Burman, R.; Buskulic, D.; Buy, C.; Cadonati, L.; Cagnoli, G.; Calderón Bustillo, J.; Calloni, E.; Camp, J. B.; Campsie, P.; Cannon, K. C.; Canuel, B.; Cao, J.; Capano, C. D.; Carbognani, F.; Carbone, L.; Caride, S.; Castiglia, A.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Celerier, C.; Cella, G.; Cepeda, C.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chen, X.; Chen, Y.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Chow, J.; Christensen, N.; Chu, Q.; Chua, S. S. Y.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C.; Colombini, M.; Cominsky, L.; Constancio, M.; Conte, A.; Cook, D.; Corbitt, T. R.; Cordier, M.; Cornish, N.; Corpuz, A.; Corsi, A.; Costa, C. A.; Coughlin, M. W.; Coughlin, S.; Coulon, J.-P.; Countryman, S.; Couvares, P.; Coward, D. M.; Cowart, M.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Creighton, T. D.; Crowder, S. G.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dahl, K.; Dal Canton, T.; Damjanic, M.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dattilo, V.; Daveloza, H.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; Dayanga, T.; Debreczeni, G.; Degallaix, J.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Dhurandhar, S.; Díaz, M.; Di Fiore, L.; Di Lieto, A.; Di Palma, I.; Di Virgilio, A.; Donath, A.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dossa, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Dwyer, S.; Eberle, T.; Edo, T.; Edwards, M.; Effler, A.; Eggenstein, H.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Endrőczi, G.; Essick, R.; Etzel, T.; Evans, M.; Evans, T.; Factourovich, M.; Fafone, V.; Fairhurst, S.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fehrmann, H.; Fejer, M. M.; Feldbaum, D.; Feroz, F.; Ferrante, I.; Ferrini, F.; Fidecaro, F.; Finn, L. S.; Fiori, I.; Fisher, R. P.; Flaminio, R.; Fournier, J.-D.; Franco, S.; Frasca, S.; Frasconi, F.; Frede, M.; Frei, Z.; Freise, A.; Frey, R.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gair, J.; Gammaitoni, L.; Gaonkar, S.; Garufi, F.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, C.; Gleason, J.; Goetz, E.; Goetz, R.; Gondan, L.; González, G.; Gordon, N.; Gorodetsky, M. L.; Gossan, S.; Goßler, S.; Gouaty, R.; Gräf, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greenhalgh, R. J. S.; Gretarsson, A. M.; Groot, P.; Grote, H.; Grover, K.; Grunewald, S.; Guidi, G. M.; Guido, C.; Gushwa, K.; Gustafson, E. K.; Gustafson, R.; Hammer, D.; Hammond, G.; Hanke, M.; Hanks, J.; Hanna, C.; Hanson, J.; Harms, J.; Harry, G. M.; Harry, I. W.; Harstad, E. D.; Hart, M.; Hartman, M. T.; Haster, C.-J.; Haughian, K.; Heidmann, A.; Heintze, M.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Heptonstall, A. W.; Heurs, M.; Hewitson, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Holt, K.; Hooper, S.; Hopkins, P.; Hosken, D. J.; Hough, J.; Howell, E. J.; Hu, Y.; Huerta, E.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh, M.; Huynh-Dinh, T.; Ingram, D. R.; Inta, R.; Isogai, T.; Ivanov, A.; Iyer, B. R.; Izumi, K.; Jacobson, M.; James, E.; Jang, H.; Jaranowski, P.; Ji, Y.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; K, Haris; Kalmus, P.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karlen, J.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, H.; Kawabe, K.; Kawazoe, F.; Kéfélian, F.; Keiser, G. M.; Keitel, D.; Kelley, D. B.; Kells, W.; Khalaidovski, A.; Khalili, F. Y.; Khazanov, E. A.; Kim, C.; Kim, K.; Kim, N.; Kim, N. G.; Kim, Y.-M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Klimenko, S.; Kline, J.; Koehlenbeck, S.; Kokeyama, K.; Kondrashov, V.; Koranda, S.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kremin, A.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, A.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Kwee, P.; Landry, M.; Lantz, B.; Larson, S.; Lasky, P. D.; Lawrie, C.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.-H.; Lee, H. K.; Lee, H. M.; Lee, J.; Leonardi, M.; Leong, J. R.; Le Roux, A.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B.; Lewis, J.; Li, T. G. F.; Libbrecht, K.; Libson, A.; Lin, A. C.; Littenberg, T. B.; Litvine, V.; Lockerbie, N. A.; Lockett, V.; Lodhia, D.; Loew, K.; Logue, J.; Lombardi, A. L.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J.; Lubinski, M. J.; Lück, H.; Luijten, E.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macarthur, J.; Macdonald, E. P.; MacDonald, T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magana-Sandoval, F.; Mageswaran, M.; Maglione, C.; Mailand, K.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Manca, G. M.; Mandel, I.; Mandic, V.; Mangano, V.; Mangini, N.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A.; Maros, E.; Marque, J.; Martelli, F.; Martin, I. W.; Martin, R. M.; Martinelli, L.; Martynov, D.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Matichard, F.; Matone, L.; Matzner, R. A.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McGuire, S. C.; McIntyre, G.; McIver, J.; McLin, K.; Meacher, D.; Meadors, G. D.; Mehmet, M.; Meidam, J.; Meinders, M.; Melatos, A.; Mendell, G.; Mercer, R. A.; Meshkov, S.; Messenger, C.; Meyers, P.; Miao, H.; Michel, C.; Mikhailov, E. E.; Milano, L.; Milde, S.; Miller, J.; Minenkov, Y.; Mingarelli, C. M. F.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moe, B.; Moesta, P.; Mohan, M.; Mohapatra, S. R. P.; Moraru, D.; Moreno, G.; Morgado, N.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Mukherjee, S.; Mullavey, A.; Munch, J.; Murphy, D.; Murray, P. G.; Mytidis, A.; Nagy, M. F.; Nanda Kumar, D.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nelemans, G.; Neri, I.; Neri, M.; Newton, G.; Nguyen, T.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Ochsner, E.; O'Dell, J.; Oelker, E.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oppermann, P.; O'Reilly, B.; O'Shaughnessy, R.; Osthelder, C.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Padilla, C.; Pai, A.; Palashov, O.; Palomba, C.; Pan, H.; Pan, Y.; Pankow, C.; Paoletti, F.; Paoletti, R.; Papa, M. A.; Paris, H.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Pedraza, M.; Penn, S.; Perreca, A.; Phelps, M.; Pichot, M.; Pickenpack, M.; Piergiovanni, F.; Pierro, V.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poeld, J.; Poggiani, R.; Poteomkin, A.; Powell, J.; Prasad, J.; Premachandra, S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L.; Puncken, O.; Punturo, M.; Puppo, P.; Qin, J.; Quetschke, V.; Quintero, E.; Quiroga, G.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Rácz, I.; Radkins, H.; Raffai, P.; Raja, S.; Rajalakshmi, G.; Rakhmanov, M.; Ramet, C.; Ramirez, K.; Rapagnani, P.; Raymond, V.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Reid, S.; Reitze, D. H.; Rhoades, E.; Ricci, F.; Riles, K.; Robertson, N. A.; Robinet, F.; Rocchi, A.; Rodruck, M.; Rolland, L.; Rollins, J. G.; Romano, R.; Romanov, G.; Romie, J. H.; Rosińska, D.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Salemi, F.; Sammut, L.; Sandberg, V.; Sanders, J. R.; Sannibale, V.; Santiago-Prieto, I.; Saracco, E.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Savage, R.; Scheuer, J.; Schilling, R.; Schnabel, R.; Schofield, R. M. S.; Schreiber, E.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shapiro, B.; Shawhan, P.; Shoemaker, D. H.; Sidery, T. L.; Siellez, K.; Siemens, X.; Sigg, D.; Simakov, D.; Singer, A.; Singer, L.; Singh, R.; Sintes, A. M.; Slagmolen, B. J. J.; Slutsky, J.; Smith, J. R.; Smith, M.; Smith, R. J. E.; Smith-Lefebvre, N. D.; Son, E. J.; Sorazu, B.; Souradeep, T.; Sperandio, L.; Staley, A.; Stebbins, J.; Steinlechner, J.; Steinlechner, S.; Stephens, B. C.; Steplewski, S.; Stevenson, S.; Stone, R.; Stops, D.; Strain, K. A.; Straniero, N.; Strigin, S.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Susmithan, S.; Sutton, P. J.; Swinkels, B.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tarabrin, S. P.; Taylor, R.; ter Braack, A. P. M.; Thirugnanasambandam, M. P.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, V.; Tokmakov, K. V.; Tomlinson, C.; Toncelli, A.; Tonelli, M.; Torre, O.; Torres, C. V.; Torrie, C. I.; Travasso, F.; Traylor, G.; Tse, M.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Urbanek, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van den Brand, J. F. J.; Van Den Broeck, C.; van der Putten, S.; van der Sluys, M. V.; van Heijningen, J.; van Veggel, A. A.; Vass, S.; Vasúth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Verkindt, D.; Verma, S. S.; Vetrano, F.; Viceré, A.; Vincent-Finley, R.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vousden, W. D.; Vyachanin, S. P.; Wade, A.; Wade, L.; Wade, M.; Walker, M.; Wallace, L.; Wang, M.; Wang, X.; Ward, R. L.; Was, M.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.; Wessels, P.; West, M.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Wiesner, K.; Wilkinson, C.; Williams, K.; Williams, L.; Williams, R.; Williams, T.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M.; Winkler, W.; Wipf, C. C.; Wiseman, A. G.; Wittel, H.; Woan, G.; Worden, J.; Yablon, J.; Yakushin, I.; Yamamoto, H.; Yancey, C. C.; Yang, H.; Yang, Z.; Yoshida, S.; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zendri, J.-P.; Zhang, Fan; Zhang, L.; Zhao, C.; Zhu, X. J.; Zucker, M. E.; Zuraw, S.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration

2014-09-01

We present the first results of an all-sky search for continuous gravitational waves from unknown spinning neutron stars in binary systems using LIGO and Virgo data. Using a specially developed analysis program, the TwoSpect algorithm, the search was carried out on data from the sixth LIGO science run and the second and third Virgo science runs. The search covers a range of frequencies from 20 Hz to 520 Hz, a range of orbital periods from 2 to ˜2,254 h and a frequency- and period-dependent range of frequency modulation depths from 0.277 to 100 mHz. This corresponds to a range of projected semimajor axes of the orbit from ˜0.6×10-3 ls to ˜6,500 ls assuming the orbit of the binary is circular. While no plausible candidate gravitational wave events survive the pipeline, upper limits are set on the analyzed data. The most sensitive 95% confidence upper limit obtained on gravitational wave strain is 2.3×10-24 at 217 Hz, assuming the source waves are circularly polarized. Although this search has been optimized for circular binary orbits, the upper limits obtained remain valid for orbital eccentricities as large as 0.9. In addition, upper limits are placed on continuous gravitational wave emission from the low-mass x-ray binary Scorpius X-1 between 20 Hz and 57.25 Hz.

A Hierarchical Modeling Study of the Interactions Among Turbulence, Cloud Microphysics, and Radiative Transfer in the Evolution of Cirrus Clouds

NASA Technical Reports Server (NTRS)

Curry, Judith; Khvorostyanov, V. I.

2005-01-01

This project used a hierarchy of cloud resolving models to address the following science issues of relevance to CRYSTAL-FACE: What ice crystal nucleation mechanisms are active in the different types of cirrus clouds in the Florida area and how do these different nucleation processes influence the evolution of the cloud system and the upper tropospheric humidity? How does the feedback between supersaturation and nucleation impact the evolution of the cloud? What is the relative importance of the large-scale vertical motion and the turbulent motions in the evolution of the crystal size spectra? How does the size spectra impact the life-cycle of the cloud, stratospheric dehydration, and cloud radiative forcing? What is the nature of the turbulence and waves in the upper troposphere generated by precipitating deep convective cloud systems? How do cirrus microphysical and optical properties vary with the small-scale dynamics? How do turbulence and waves in the upper troposphere influence the cross-tropopause mixing and stratospheric and upper tropospheric humidity? The models used in this study were: 2-D hydrostatic model with explicit microphysics that can account for 30 size bins for both the droplet and crystal size spectra. Notably, a new ice crystal nucleation scheme has been incorporated into the model. Parcel model with explicit microphysics, for developing and evaluating microphysical parameterizations. Single column model for testing bulk microphysics parameterizations

View-angle-dependent AIRS Cloudiness and Radiance Variance: Analysis and Interpretation

NASA Technical Reports Server (NTRS)

Gong, Jie; Wu, Dong L.

2013-01-01

Upper tropospheric clouds play an important role in the global energy budget and hydrological cycle. Significant view-angle asymmetry has been observed in upper-level tropical clouds derived from eight years of Atmospheric Infrared Sounder (AIRS) 15 um radiances. Here, we find that the asymmetry also exists in the extra-tropics. It is larger during day than that during night, more prominent near elevated terrain, and closely associated with deep convection and wind shear. The cloud radiance variance, a proxy for cloud inhomogeneity, has consistent characteristics of the asymmetry to those in the AIRS cloudiness. The leading causes of the view-dependent cloudiness asymmetry are the local time difference and small-scale organized cloud structures. The local time difference (1-1.5 hr) of upper-level (UL) clouds between two AIRS outermost views can create parts of the observed asymmetry. On the other hand, small-scale tilted and banded structures of the UL clouds can induce about half of the observed view-angle dependent differences in the AIRS cloud radiances and their variances. This estimate is inferred from analogous study using Microwave Humidity Sounder (MHS) radiances observed during the period of time when there were simultaneous measurements at two different view-angles from NOAA-18 and -19 satellites. The existence of tilted cloud structures and asymmetric 15 um and 6.7 um cloud radiances implies that cloud statistics would be view-angle dependent, and should be taken into account in radiative transfer calculations, measurement uncertainty evaluations and cloud climatology investigations. In addition, the momentum forcing in the upper troposphere from tilted clouds is also likely asymmetric, which can affect atmospheric circulation anisotropically.

Comet ISON Swoops Around the Sun

NASA Image and Video Library

2013-12-02

Comet ISON swoops around the sun and through Scorpius. This composite merges an SDO AIA 171 sun image (Nov. 28, 2214 UT), SOHO C2 (2036 UT) and C3 (2030 UT) images, and a DSS view of the sky in northern Scorpius. Credit: NASA/ESA/SOHO, NASA/SDO, DSS, and Francis Reddy NASA image use policy. NASA Goddard Space Flight Center enables NASA’s mission through four scientific endeavors: Earth Science, Heliophysics, Solar System Exploration, and Astrophysics. Goddard plays a leading role in NASA’s accomplishments by contributing compelling scientific knowledge to advance the Agency’s mission. Follow us on Twitter Like us on Facebook Find us on Instagram

New Low-mass Accretors in the Scorpius-Centaurus OB Association

NASA Astrophysics Data System (ADS)

Murphy, Simon J.; Lawson, Warrick A.; Bento, Joao

2016-01-01

We describe the serendipitous discovery of two new lithium-rich M5 members of the Scorpius-Centaurus OB Association (Sco-Cen). Both stars exhibit large 12 and 22 μm excesses and strong, variable Hα emission which we attribute to accretion from circumstellar discs. Such stars are thought to be incredibly rare at the ~16 Myr median age of much of Sco-Cen. The serendipitous discovery of two accreting stars hosting large quantities of circumstellar material may be indicative of a sizeable age spread in Sco-Cen, or further evidence that disc dispersal and planet formation time-scales are longer around lower-mass stars.

Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

PubMed

Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

1986-12-30

The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

A Thermal Infrared Imaging Study of Very Low Mass, Wide-separation Brown Dwarf Companions to Upper Scorpius Stars: Constraining Circumstellar Environments

NASA Astrophysics Data System (ADS)

Bailey, Vanessa; Hinz, Philip M.; Currie, Thayne; Su, Kate Y. L.; Esposito, Simone; Hill, John M.; Hoffmann, William F.; Jones, Terry; Kim, Jihun; Leisenring, Jarron; Meyer, Michael; Murray-Clay, Ruth; Nelson, Matthew J.; Pinna, Enrico; Puglisi, Alfio; Rieke, George; Rodigas, Timothy; Skemer, Andrew; Skrutskie, Michael F.; Vaitheeswaran, Vidhya; Wilson, John C.

2013-04-01

We present a 3-5 μm LBT/MMT adaptive optics imaging study of three Upper Scorpius stars with brown dwarf (BD) companions with very low masses/mass ratios (M BD <25 M Jup; M BD/M sstarf ≈ 1%-2%) and wide separations (300-700 AU): GSC 06214, 1RXS 1609, and HIP 78530. We combine these new thermal IR data with existing 1-4 μm and 24 μm photometry to constrain the properties of the BDs and identify evidence for circumprimary/circumsecondary disks in these unusual systems. We confirm that GSC 06214B is surrounded by a disk, further showing that this disk produces a broadband IR excess due to small dust near the dust sublimation radius. An unresolved 24 μm excess in the system may be explained by the contribution from this disk. 1RXS 1609B exhibits no 3-4 μm excess, nor does its primary; however, the system as a whole has a modest 24 μm excess, which may come from warm dust around the primary and/or BD. Neither object in the HIP 78530 system exhibits near- to mid-IR excesses. We additionally find that the 1-4 μm colors of HIP 78530B match a spectral type of M3 ± 2, inconsistent with the M8 spectral type assigned based on its near-IR spectrum, indicating that it may be a low-mass star rather than a BD. We present new upper limits on additional low-mass companions in the system (<5 M Jup beyond 175 AU). Finally, we examine the utility of circumsecondary disks as probes of the formation histories of wide BD companions, finding that the presence of a disk may disfavor BD formation near the primary with subsequent outward scattering. Observations reported here were obtained at the LBT and MMT Observatories. The MMT Observatory is a joint facility of the University of Arizona and the Smithsonian Institution. The LBT is an international collaboration among institutions in the United States, Italy, and Germany. LBT Corporation partners are: The University of Arizona on behalf of the Arizona university system; Istituto Nazionale di Astrofisica, Italy; LBT Beteiligungsgesellschaft, Germany, representing the Max-Planck Society, the Astrophysical Institute Potsdam, and Heidelberg University; The Ohio State University; and The Research Corporation, on behalf of The University of Notre Dame, University of Minnesota, and University of Virginia.

Venus winds at cloud level from VIRTIS during the Venus Express mission

NASA Astrophysics Data System (ADS)

Hueso, Ricardo; Peralta, Javier; Sánchez-Lavega, Agustín.; Pérez-Hoyos, Santiago; Piccioni, Giuseppe; Drossart, Pierre

2010-05-01

The Venus Express (VEX) mission has been in orbit to Venus for almost four years now. The VIRTIS instrument onboard VEX observes Venus in two channels (visible and infrared) obtaining spectra and multi-wavelength images of the planet. Images in the ultraviolet range are used to study the upper cloud at 66 km while images in the infrared (1.74 μm) map the opacity of the lower cloud deck at 48 km. Here we present our latest results on the analysis of the global atmospheric dynamics at these cloud levels using a large selection over the full VIRTIS dataset. We will show the atmospheric zonal superrotation at these levels and the mean meridional motions. The zonal winds are very stable in the lower cloud at mid-latitudes to the tropics while it shows different signatures of variability in the upper cloud where solar tide effects are manifest in the data. While the upper clouds present a net meridional motion consistent with the upper branch of a Hadley cell the lower cloud present almost null global meridional motions at all latitudes but with particular features traveling both northwards and southwards in a turbulent manner depending on the cloud morphology on the observations. A particular important atmospheric feature is the South Polar vortex which might be influencing the structure of the zonal winds in the lower cloud at latitudes from the vortex location up to 55°S. Acknowledgements This work has been funded by the Spanish MICIIN AYA2009-10701 with FEDER support and Grupos Gobierno Vasco IT-464-07.

Temporal variation of the cloud top height over the tropical Pacific observed by geostationary satellites

NASA Astrophysics Data System (ADS)

Nishi, N.; Hamada, A.

2012-12-01

Stratiform clouds (nimbostratus and cirriform clouds) in the upper troposphere accompanied with cumulonimbus activity cover large part of the tropical region and largely affect the radiation and water vapor budgets there. Recently new satellites (CloudSat and CALIPSO) can give us the information of cloud height and cloud ice amount even over the open ocean. However, their coverage is limited just below the satellite paths; it is difficult to capture the whole shape and to trace the lifecycle of each cloud system by using just these datasets. We made, as a complementary product, a dataset of cloud top height and visible optical thickness with one-hour resolution over the wide region, by using infrared split-window data of the geostationary satellites (AGU fall meeting 2011) and released on the internet (http://database.rish.kyoto-u.ac.jp/arch/ctop/). We made lookup tables for estimating cloud top height only with geostationary infrared observations by comparing them with the direct cloud observation by CloudSat (Hamada and Nishi, 2010, JAMC). We picked out the same-time observations by MTSAT and CloudSat and regressed the cloud top height observation of CloudSat back onto 11μm brightness temperature (Tb) and the difference between the 11μm Tb and 12μm Tb. We will call our estimated cloud top height as "CTOP" below. The area of our coverage is 85E-155W (MTSAT2) and 80E-160W(MTSAT1R), and 20S-20N. The accuracy of the estimation with the IR split-window observation is the best in the upper tropospheric height range. We analyzed the formation and maintenance of the cloud systems whose top height is in the upper troposphere with our CTOP analysis, CloudSat 2B-GEOPROF, and GSMaP (Global Satellite Mapping of Precipitation) precipitation data. Most of the upper tropospheric stratiform clouds have their cloud top within 13-15 km range. The cloud top height decreases slowly when dissipating but still has high value to the end. However, we sometimes observe that a little lower cloud top height (6-10 km) is kept within one-two days. A typical example is observed on 5 January 2011 in a dissipating cloud system with 1000-km scale. This cluster located between 0-10N just west of the International Date Line and moved westward with keeping relatively lower cloud top (6-10 km) over one day. This top height is lower than the ubiquitous upper-tropospheric stratiform clouds but higher than the so-called 'congestus cloud' whose top height is around 0C. CloudSat data show the presence of convective rainfall. It suggests that this cloud system continuously kept making new anvil clouds in a little lower height than usual. We examined the seasonal variation of the distribution of cloud systems with a little lower cloud top height (6-11 km) during 2010-11. The number of such cloud systems is not constant with seasons but frequently increased in some specific seasons. Over the equatorial ocean region (east of 150E), they were frequently observed during the northern winter.

Local time variations of the middle atmosphere of Venus: Solar-related structures

NASA Astrophysics Data System (ADS)

Zasova, L.; Khatountsev, I. V.; Ignatiev, N. I.; Moroz, V. I.

Three-dimensional fields (latitude — altitude — local time) of temperature and aerosol in the upper clouds, obtained from the Venera-15 IR spectrometry data, were studied to search for the solar-related structures. The temperature variation at the isobaric levels vs. solar longitude was presented as a superposition of the cosines with periods of 1, 1/2, 1/3 and 1/4 Venusian days. At low latitudes the diurnal tidal component reaches a maximum above 0.2 mb (92km) level. At high latitudes it dominates at P> 50 mb (68 km) in the cold collar, being roughly twice as much as the semidiurnal one and passing through the maximum of 13 K at 400 mb (57 km). The semidiurnal tidal amplitude exceeds the diurnal one below 90 km (where its maximum locates near 83 km), and also in the upper clouds, above 58 km. At low latitudes the 1/3 days component predominates at 10 - 50 mb (68-76 km). In the upper clouds, where most of the solar energy, absorbed in the middle atmosphere, deposits, all four tidal components, including wavenumbers 3 and 4, have significant amplitudes. A position of the upper boundary of the clouds depends on local time in such a way that the lowest height of the clouds is observed in the morning at all selected latitude ranges. At low latitudes the highest position of the upper boundary of the clouds (at 1218 cm -1) is found at 8 - 9 PM, whereas the lowest one is near the morning terminator. At high latitudes the lowest position of the upper boundary of the clouds shifts towards the dayside being at 10:30 AM at 75° in the cold collar and the highest one shifts to 4 PM. The zonal mean altitude of the upper boundary of the clouds decreases from 69 km at 15° to 59 km at 75°. The diurnal tidal component has the highest amplitude in the cold collar (1.5 km). At low latitudes both amplitudes, diurnal and semidiurnal, reach the values 0.8 - 1 km.

Impact of convection on stratospheric humidity and upper tropospheric clouds

NASA Astrophysics Data System (ADS)

Ueyama, R.; Schoeberl, M. R.; Jensen, E. J.; Pfister, L.; Avery, M. A.

2017-12-01

The role of convection on stratospheric water vapor and upper tropospheric cloud fraction is investigated using two sets of complementary transport and microphysical models driven by MERRA-2 and ERA-Interim meteorological analyses: (1) computationally efficient ensembles of forward trajectories with simplified cloud microphysics, and (2) one-dimensional simulations with detailed microphysics along back trajectories. Convective influence along the trajectories is diagnosed based on TRMM/GPM rainfall products and geostationary infrared satellite cloud-top measurements, with convective cloud-top height adjusted to match the CloudSat, CALIPSO, and CATS measurements. We evaluate and constrain the model results by comparison with satellite observations (e.g., Aura MLS, CALIPSO CALIOP) and high-altitude aircraft campaigns (e.g., ATTREX, POSIDON). Convection moistens the lower stratosphere by approximately 10-15% and increases the cloud fraction in the upper troposphere by 35-50%. Convective moistening is dominated by the saturating effect of parcels; convectively-lofted ice has a negligible impact on lower stratospheric humidity. We also find that the highest convective clouds have a disproportionately large impact on stratospheric water vapor because stratospheric relative humidity is low. Implications of these model results on the role of convection on present and future climate will be discussed.

The evaporatively driven cloud-top mixing layer

NASA Astrophysics Data System (ADS)

Mellado, Juan Pedro

2010-11-01

Turbulent mixing caused by the local evaporative cooling at the top cloud-boundary of stratocumuli will be discussed. This research is motivated by the lack of a complete understanding of several phenomena in that important region, which translates into an unacceptable variability of order one in current models, including those employed in climate research. The cloud-top mixing layer is a simplified surrogate to investigate, locally, particular aspects of the fluid dynamics at the boundary between the stratocumulus clouds and the upper cloud-free air. In this work, direct numerical simulations have been used to study latent heat effects. The problem is the following: When the cloud mixes with the upper cloud-free layer, relatively warm and dry, evaporation tends to cool the mixture and, if strong enough, the buoyancy reversal instability develops. This instability leads to a turbulent convection layer growing next to the upper boundary of the cloud, which is, in several aspects, similar to free convection below a cold horizontal surface. In particular, results show an approximately self-preserving behavior that is characterized by the molecular buoyancy flux at the inversion base, fact that helps to explain the difficulties found when doing large-eddy simulations of this problem using classical subgrid closures.

Cloud structure on Uranus as constrained by near IR 1.1-1.8 micron spectra.

NASA Astrophysics Data System (ADS)

Sromovsky, L. A.; Fry, P. M.

2005-08-01

Three uranian cloud layers were identified by West et al. (Uranus, Univ. Arizona Press, 1991): an optically thin stratospheric haze, an optically thicker methane haze (0.4 < τ < 1) primarily in the 1.2-1.3 bar region, and a cloud of unknown composition near 3 bars. Using improved methane band models of Irwin et al. (BAAS, this issue) we were able to test this paradigm using near-IR spectra covering 1.1-1.8 μ m, a range well suited for distinguishing the main cloud levels. We assumed a 2-cloud model in which the lower cloud is opaque and the upper cloud consists of broken opaque elements. The pressure and fractional coverage of the upper cloud and the pressure and albedo of the lower cloud were adjusted to fit the 1975 geometric albedo spectrum of Fink and Larsen (ApJ 233, 1021-40, 1979), with the following results (first two rows): Fit Range & Upper & Upper & Lower & Lower & (μ m) & P (bars) & Fraction(%) & P (bars) & Albedo (%) & χ2 1.175-1.34 & 2.2±0.15 & 2.8±0.4 & 6.6+1.2-0.7 & 6.5±0.8 & 206 1.450-1.70 & 1.8±0.10 & 2.2±0.3 & 5.2+0.8-0.4 & 3.3±0.3& 223 1.175-1.34 & 1.25 (fixed) & 0.15±0.08 & 3.1 (fixed) & 6.6±0.8 & 296 1.450-1.70 & 1.25 (fixed) & 0.66±0.05 & 3.1 (fixed) & 4.4±0.1 & 281 Fixing clouds at paradigm pressures of 1.25 bars and 3.1 bars yields a significant reduction in fit quality and a very small upper cloud contribution (last two rows). The paradigm-violating best-fit results are consistent with an analysis of seven-band Keck AO imaging observations (Sromovsky and Fry, in preparation), which concludes that the 1.2-bar cloud is at best a minor contributor to Uranus' reflectivity and that latitudinal variations in brightness are mainly controlled by deeper clouds. How prior results can be explained in the context of these new results remains to be determined. This research was supported by a grant from NASA's Planetary Astronomy Program.

HD 101088, AN ACCRETING 14 AU BINARY IN LOWER CENTAURUS CRUX WITH VERY LITTLE CIRCUMSTELLAR DUST

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bitner, Martin A.; Chen, Christine H.; Muzerolle, James

2010-05-10

We present high-resolution (R = 55, 000) optical spectra obtained with MIKE on the 6.5 m Magellan Clay Telescope as well as Spitzer MIPS photometry and Infrared Spectrometer low-resolution (R {approx} 60) spectroscopy of the close (14 AU separation) binary, HD 101088, a member of the {approx}12 Myr old southern region of the Lower Centaurus Crux subgroup of the Scorpius-Centaurus OB association. We find that the primary and/or secondary is accreting from a tenuous circumprimary and/or circumsecondary disk despite the apparent lack of a massive circumbinary disk. We estimate a lower limit to the accretion rate of M-dot > 1x10{supmore » -9} M{sub sun} yr{sup -1}, which our multiple observation epochs show varies over a timescale of months. The upper limit on the 70 {mu}m flux allows us to place an upper limit on the mass of dust grains smaller than several microns present in a circumbinary disk of 0.16 M{sub moon}. We conclude that the classification of disks into either protoplanetary or debris disks based on fractional infrared luminosity alone may be misleading.« less

Trends in Upper-Level Cloud Cover and Surface Divergence Over the Tropical Indo-Pacific Ocean Between 1952 And 1997

NASA Technical Reports Server (NTRS)

Norris, Joel R.

2005-01-01

This study investigated the spatial pattern of linear trends in surface-observed upper-level (combined mid-level and High-level) cloud cover, precipitation, and surface divergence over the tropical Indo-Pacific Ocean during 1952-1957. Cloud values were obtained from the Extended Edited Cloud Report Archive (EECRA), precipitation values were obtained from the Hulme/Climate Research Unit Data Set, and surface divergence was alternatively calculated from wind reported Comprehensive Ocean-Atmosphere Data Set and from Smith and Reynolds Extended Reconstructed sea level pressure data.

Microwave boundary conditions on the atmosphere and clouds of Venus

NASA Technical Reports Server (NTRS)

Rossow, W. B.; Sagan, C.

1975-01-01

The dielectric properties of H2O/H2SO4 mixtures are deduced from the Debye equations and, for a well-mixed atmosphere, the structure of H2O and H2O/H2SO4 clouds is calculated. Various data on the planet together set an upper limit on the mixing ratio by number for H2O of about 0.001 in the lower Venus atmosphere, and for H2SO4 of about 0.00001. The polarization value of the real part of the refractive index of the clouds, the spectroscopic limits on the abundance of water vapor above the clouds, and the microwave data together set corresponding upper limits on H2O of approximately 0.0002 and on H2SO4 of approximately 0.000009. Upper limits on the surface density of total cloud constituents and of cloud liquid water are, respectively, about 0.1 g/sq cm and about 0.01 g/sq cm. The infrared opacities of 90 bars of CO2, together with the derived upper limits to the amounts of water vapor and liquid H2O/H2SO4, may be sufficient to explain the high surface temperatures through the greenhouse effect.

Thermal dependence of cardiac function in arctic fish: implications of a warming world.

PubMed

Franklin, Craig E; Farrell, Anthony P; Altimiras, Jordi; Axelsson, Michael

2013-11-15

With the Arctic experiencing one of the greatest and most rapid increases in sea temperatures in modern time, predicting how Arctic marine organisms will respond to elevated temperatures has become crucial for conservation biology. Here, we examined the thermal sensitivity of cardiorespiratory performance for three closely related species of sculpins that inhabit the Arctic waters, two of which, Gymnocanthus tricuspis and Myoxocephalus scorpioides, have adapted to a restricted range within the Arctic, whereas the third species, Myoxocephalus scorpius, has a wider distribution. We tested the hypothesis that the fish restricted to Arctic cold waters would show reduced cardiorespiratory scope in response to an increase in temperature, as compared with the more eurythermal M. scorpius. As expected from their biogeography, M. scorpioides and G. tricuspis maximised cardiorespiratory performance at temperatures between 1 and 4°C, whereas M. scorpius maximised performance over a wider range of temperatures (1-10°C). Furthermore, factorial scope for cardiac output collapsed at elevated temperature for the two high-latitude species, negatively impacting their ability to support aerobically driven metabolic processes. Consequently, these results concurred with our hypothesis, suggesting that the sculpin species restricted to the Arctic are likely to be negatively impacted by increases in ocean temperatures.

Comparisons of Satellite-Deduced Overlapping Cloud Properties and CALIPSO CloudSat Data

NASA Technical Reports Server (NTRS)

Chang, Fu-Lung; Minnis, Patrick; Lin, Bing; Sun-Mack, Sunny

2010-01-01

Introduction to the overlapped cloud properties derived from polar-orbiting (MODIS) and geostationary (GOES-12, -13, Meteosat-8, -9, etc.) meteorological satellites, which are produced at the NASA Langley Research Center (LaRC) cloud research & development team (NASA lead scientist: Dr. Patrick Minnis). Comparison of the LaRC CERES MODIS Edition-3 overlapped cloud properties to the CALIPSO and the CloudSat active sensing data. High clouds and overlapped clouds occur frequently as deduced by CALIPSO (44 & 25%), CloudSat (25 & 4%), and MODIS (37 & 6%). Large fractions of optically-thin cirrus and overlapped clouds are deduced from CALIPSO, but much smaller fractions are from CloudSat and MODIS. For overlapped clouds, the averaged upper-layer CTHs are about 12.8 (CALIPSO), 10.9 (CloudSat) and 10 km (MODIS), and the averaged lower-layer CTHs are about 3.6 (CALIPSO), 3.2 (CloudSat) and 3.9 km (MODIS). Based on comparisons of upper and lower-layer cloud properties as deduced from the MODIS, CALIPSO and CloudSat data, more enhanced passive satellite methods for retrieving thin cirrus and overlapped cloud properties are needed and are under development.

Tropical High Cloud Fraction Controlled by Cloud Lifetime Rather Than Clear-sky Convergence

NASA Astrophysics Data System (ADS)

Seeley, J.; Jeevanjee, N.; Romps, D. M.

2016-12-01

Observations and simulations show a peak in cloud fraction below the tropopause. This peak is usually attributed to a roughly co-located peak in radiatively-driven clear-sky convergence, which is presumed to force convective detrainment and thus promote large cloud fraction. Using simulations of radiative-convective equilibrium forced by various radiative cooling profiles, we refute this mechanism by showing that an upper-tropospheric peak in cloud fraction persists even in simulations with no peak in clear-sky convergence. Instead, cloud fraction profiles seem to be controlled by cloud lifetimes — i.e., how long it takes for clouds to dissipate after they have detrained. A simple model of cloud evaporation shows that the small saturation deficit in the upper troposphere greatly extends cloud lifetimes there, while the large saturation deficit in the lower troposphere causes condensate to evaporate quickly. Since cloud mass flux must go to zero at the tropopause, a peak in cloud fraction emerges at a "sweet spot" below the tropopause where cloud lifetimes are long and there is still sufficient mass flux to be detrained.

Simulation of the Upper Clouds and Hazes of Venus Using a Microphysical Cloud Model

NASA Astrophysics Data System (ADS)

McGouldrick, K.

2012-12-01

Several different microphysical and chemical models of the clouds of Venus have been developed in attempts to reproduce the in situ observations of the Venus clouds made by Pioneer Venus, Venera, and Vega descent probes (Turco et al., 1983 (Icarus 53:18-25), James et al, 1997 (Icarus 129:147-171), Imamura and Hashimoto, 2001 (J. Atm. Sci. 58:3597-3612), and McGouldrick and Toon, 2007 (Icarus 191:1-24)). The model of McGouldrick and Toon has successfully reproduced observations within the condensational middle and lower cloud decks of Venus (between about 48 and 57 km altitude, experiencing conditions similar to Earth's troposphere) and it now being extended to also simulate the microphysics occurring in the upper cloud deck (between altitudes of about 57 km and 70 km, experiencing conditions similar to Earth's stratosphere). In the upper clouds, aerosols composed of a solution of sulfuric acid in water are generated from the reservoir of available water vapor and sulfuric acid vapor that is photochemically produced. The manner of particle creation (e.g., activation of cloud condensation nuclei, or homogeneous or heterogeneous nucleation) is still incompletely understood, and the atmospheric environment has been measured to be not inconsistent with frozen aerosol particles (either sulfuric acid monohydrate or water ice). The material phase, viscosity, and surface tension of the aerosols (which are strongly dependent up on the local temperature and water vapor concentration) can affect the coagulation efficiencies of the aerosol, leading to variations in the size distributions, and other microphysical and radiative properties. Here, I present recent work exploring the effects of nucleation rates and coalescence efficiencies on the simulated Venus upper clouds.

Convectively-generated gravity waves and clear-air turbulence (CAT)

NASA Astrophysics Data System (ADS)

Sharman, Robert; Lane, Todd; Trier, Stanley

2013-04-01

Upper-level turbulence is a well-known hazard to aviation that is responsible for numerous injuries each year, with occasional fatalities, and results in millions of dollars of operational costs to airlines each year. It has been widely accepted that aviation-scale turbulence that occurs in clear air (CAT) at upper levels (upper troposphere and lower stratosphere) has its origins in Kelvin-Helmholtz instabilities induced by enhanced shears and reduced Richardson numbers associated with the jet stream and upper level fronts. However, it is becoming increasingly apparent that gravity waves and gravity wave "breaking" also play a major role in instigating turbulence that affects aviation. Gravity waves and inertia-gravity waves may be produced by a variety of sources, but one major source that impacts aviation seems to be those produced by convection. The relation of convectively-induced gravity waves to turbulence outside the cloud (either above cloud or laterally away from cloud) is examined based on high resolution cloud-resolving simulations, both with and without cloud microphysics in the simulations. Results for both warm-season and cold-season cloud systems indicate that the turbulence in the clear air away from cloud is often caused by gravity wave production processes in or near the cloud which once initiated, are able to propagate away from the storm, and may eventually "break." Without microphysics of course this effect is absent and turbulence is not produced in the simulations. In some cases the convectively-induced turbulence may be many kilometers away from the active convection and can easily be misinterpreted as "clear-air turbulence" (CAT). This is a significant result, and may be cause for a reassessment of the working definition of CAT ("turbulence encountered outside of convective clouds", FAA Advisory Circular AC 00-30B, 1997).

Cloud/climate sensitivity experiments

NASA Technical Reports Server (NTRS)

Roads, J. O.; Vallis, G. K.; Remer, L.

1982-01-01

A study of the relationships between large-scale cloud fields and large scale circulation patterns is presented. The basic tool is a multi-level numerical model comprising conservation equations for temperature, water vapor and cloud water and appropriate parameterizations for evaporation, condensation, precipitation and radiative feedbacks. Incorporating an equation for cloud water in a large-scale model is somewhat novel and allows the formation and advection of clouds to be treated explicitly. The model is run on a two-dimensional, vertical-horizontal grid with constant winds. It is shown that cloud cover increases with decreased eddy vertical velocity, decreased horizontal advection, decreased atmospheric temperature, increased surface temperature, and decreased precipitation efficiency. The cloud field is found to be well correlated with the relative humidity field except at the highest levels. When radiative feedbacks are incorporated and the temperature increased by increasing CO2 content, cloud amounts decrease at upper-levels or equivalently cloud top height falls. This reduces the temperature response, especially at upper levels, compared with an experiment in which cloud cover is fixed.

Modeled Impact of Cirrus Cloud Increases Along Aircraft Flight Paths

NASA Technical Reports Server (NTRS)

Rind, David; Lonergan, P.; Shah, K.

1999-01-01

The potential impact of contrails and alterations in the lifetime of background cirrus due to subsonic airplane water and aerosol emissions has been investigated in a set of experiments using the GISS GCM connected to a q-flux ocean. Cirrus clouds at a height of 12-15km, with an optical thickness of 0.33, were input to the model "x" percentage of clear-sky occasions along subsonic aircraft flight paths, where x is varied from .05% to 6%. Two types of experiments were performed: one with the percentage cirrus cloud increase independent of flight density, as long as a certain minimum density was exceeded; the other with the percentage related to the density of fuel expenditure. The overall climate impact was similar with the two approaches, due to the feedbacks of the climate system. Fifty years were run for eight such experiments, with the following conclusions based on the stable results from years 30-50 for each. The experiments show that adding cirrus to the upper troposphere results in a stabilization of the atmosphere, which leads to some decrease in cloud cover at levels below the insertion altitude. Considering then the total effect on upper level cloud cover (above 5 km altitude), the equilibrium global mean temperature response shows that altering high level clouds by 1% changes the global mean temperature by 0.43C. The response is highly linear (linear correlation coefficient of 0.996) for high cloud cover changes between 0. 1% and 5%. The effect is amplified in the Northern Hemisphere, more so with greater cloud cover change. The temperature effect maximizes around 10 km (at greater than 40C warming with a 4.8% increase in upper level clouds), again more so with greater warming. The high cloud cover change shows the flight path influence most clearly with the smallest warming magnitudes; with greater warming, the model feedbacks introduce a strong tropical response. Similarly, the surface temperature response is dominated by the feedbacks, and shows little geographical relationship to the high cloud input. Considering whether these effects would be observable, changing upper level cloud cover by as little as 0.4% produces warming greater than 2 standard deviations in the Microwave Sounding Unit (MSU) channels 4, 2 and 2r, in flight path regions and in the subtropics. Despite the simplified nature of these experiments, the results emphasize the sensitivity of the modeled climate to high level cloud cover changes, and thus the potential ability of aircraft to influence climate by altering clouds in the upper troposphere.

Saharan dust, convective lofting, aerosol enhancement zones, and potential impacts on ice nucleation in the tropical upper troposphere

NASA Astrophysics Data System (ADS)

Twohy, C. H.; Anderson, B. E.; Ferrare, R. A.; Sauter, K. E.; L'Ecuyer, T. S.; van den Heever, S. C.; Heymsfield, A. J.; Ismail, S.; Diskin, G. S.

2017-08-01

Dry aerosol size distributions and scattering coefficients were measured on 10 flights in 32 clear-air regions adjacent to tropical storm anvils over the eastern Atlantic Ocean. Aerosol properties in these regions were compared with those from background air in the upper troposphere at least 40 km from clouds. Median values for aerosol scattering coefficient and particle number concentration >0.3 μm diameter were higher at the anvil edges than in background air, showing that convective clouds loft particles from the lower troposphere to the upper troposphere. These differences are statistically significant. The aerosol enhancement zones extended 10-15 km horizontally and 0.25 km vertically below anvil cloud edges but were not due to hygroscopic growth since particles were measured under dry conditions. Number concentrations of particles >0.3 μm diameter were enhanced more for the cases where Saharan dust layers were identified below the clouds with airborne lidar. Median number concentrations in this size range increased from 100 l-1 in background air to 400 l-1 adjacent to cloud edges with dust below, with larger enhancements for stronger storm systems. Integration with satellite cloud frequency data indicates that this transfer of large particles from low to high altitudes by convection has little impact on dust concentrations within the Saharan Air Layer itself. However, it can lead to substantial enhancement in large dust particles and, therefore, heterogeneous ice nuclei in the upper troposphere over the Atlantic. This may induce a cloud/aerosol feedback effect that could impact cloud properties in the region and downwind.

Analysis of the GOES 6.7 micrometer channel observations during FIRE 2

NASA Technical Reports Server (NTRS)

Soden, B. J.; Ackerman, S. A.; Starr, David

1993-01-01

Clouds form in moist environments. FIRE Phase II Cirrus Implementation Plan (August, 1990) noted the need for mesoscale measurements of upper tropospheric water vapor content. These measurements are needed for initializing and verifying numerical weather prediction models and for describing the environment in which cirrus clouds develop and dissipate. Various instruments where deployed to measure the water vapor amounts of the upper troposphere during FIRE II (e.g. Raman lidar, CLASS sonds and new cryogenic frost hygrometer on-board aircraft). The formation, maintenance and dissipation of cirrus clouds involve the time variation of the water budget of the upper troposphere. The GOES 6.7 mu m radiance observations are sensitive to the upper tropospheric relative humidity, and therefore proved extremely valuable in planning aircraft missions during the field phase of FIRE II. Warm 6.7 mu m equivalent black body temperatures indicate a relatively dry upper troposphere and were associated with regions generally free of cirrus clouds. Regions that were colder, implying more moisture was available may or may not have had cirrus clouds present. Animation of a time sequence of 6.7 mu m images was particularly useful in planning various FIRE missions. The 6.7 mu m observations can also be very valuable in the verification of model simulations and describing the upper tropospheric synoptic conditions. A quantitative analysis of the 6.7 mu m measurement is required to successfully incorporate these satellite observations into describing the upper tropospheric water vapor budget. Recently, Soden and Bretherton (1993) have proposed a method of deriving an upper tropospheric humidity based on observations from the GOES 6.7 mu m observations. The method is summarized in the next section. In their paper they compare their retrieval method to radiance simulations. Observations were also compared to ECMWF model output to assess the model performance. The FIRE experiment provides a unique opportunity to further verify the GOES upper tropospheric relative humidity retrieval scheme by providing (1) aircraft observations to cross-validate the calibration of the GOES 6.7 mu m channel, (2) accurate upper tropospheric water vapor concentrations for verification, and (3) veritical variability of upper tropospheric water vapor.

"Cloud Slicing" : A New Technique to Derive Tropospheric Ozone Profile Information from Satellite Measurements

NASA Technical Reports Server (NTRS)

Ziemke, J. R.; Chandra, S.; Bhartia, P. K.; Einaudi, Franco (Technical Monitor)

2000-01-01

A new technique denoted cloud slicing has been developed for estimating tropospheric ozone profile information. All previous methods using satellite data were only capable of estimating the total column of ozone in the troposphere. Cloud slicing takes advantage of the opaque property of water vapor clouds to ultraviolet wavelength radiation. Measurements of above-cloud column ozone from the Nimbus 7 total ozone mapping spectrometer (TOMS) instrument are combined together with Nimbus 7 temperature humidity and infrared radiometer (THIR) cloud-top pressure data to derive ozone column amounts in the upper troposphere. In this study tropical TOMS and THIR data for the period 1979-1984 are analyzed. By combining total tropospheric column ozone (denoted TCO) measurements from the convective cloud differential (CCD) method with 100-400 hPa upper tropospheric column ozone amounts from cloud slicing, it is possible to estimate 400-1000 hPa lower tropospheric column ozone and evaluate its spatial and temporal variability. Results for both the upper and lower tropical troposphere show a year-round zonal wavenumber 1 pattern in column ozone with largest amounts in the Atlantic region (up to approx. 15 DU in the 100-400 hPa pressure band and approx. 25-30 DU in the 400-1000 hPa pressure band). Upper tropospheric ozone derived from cloud slicing shows maximum column amounts in the Atlantic region in the June-August and September-November seasons which is similar to the seasonal variability of CCD derived TCO in the region. For the lower troposphere, largest column amounts occur in the September-November season over Brazil in South America and also southern Africa. Localized increases in the tropics in lower tropospheric ozone are found over the northern region of South America around August and off the west coast of equatorial Africa in the March-May season. Time series analysis for several regions in South America and Africa show an anomalous increase in ozone in the lower troposphere around the month of March which is not observed in the upper troposphere. The eastern Pacific indicates weak seasonal variability of upper, lower, and total tropospheric ozone compared to the western Pacific which shows largest TCO amounts in both hemispheres around spring months. Ozone variability in the western Pacific is expected to have greater variability caused by strong convection, pollution and biomass burning, land/sea contrast and monsoon developments.

Simulations of the effect of a warmer climate on atmospheric humidity

NASA Technical Reports Server (NTRS)

Del Genio, Anthony D.; Lacis, Andrew A.; Ruedy, Reto A.

1991-01-01

Increases in the concentration of water vapor constitute the single largest positive feedback in models of global climate warming caused by greenhouse gases. It has been suggested that sinking air in the regions surrounding deep cumulus clouds will dry the upper troposphere and eliminate or reverse the direction of water vapor feedback. This hypothesis has been tested by performing an idealized simulation of climate change with two different versions of a climate model which both incorporate drying due to subsidence of clear air but differ in their parameterization of moist convection and stratiform clouds. Despite increased drying of the upper troposphere by cumulus clouds, upper-level humidity increases in the warmer climate because of enhanced upward moisture transport by the general circulation and increased accumulation of water vapor and ice at cumulus cloud tops.

Evaluating Lightning-generated NOx (LNOx) Parameterization based on Cloud Top Height at Resolutions with Partially-resolved Convection for Upper Tropospheric Chemistry Studies

NASA Astrophysics Data System (ADS)

Wong, J.; Barth, M. C.; Noone, D. C.

2012-12-01

Lightning-generated nitrogen oxides (LNOx) is an important precursor to tropospheric ozone production. With a meteorological time-scale variability similar to that of the ozone chemical lifetime, it can nonlinearly perturb tropospheric ozone concentration. Coupled with upper-air circulation patterns, LNOx can accumulate in significant amount in the upper troposphere with other precursors, thus enhancing ozone production (see attached figure). While LNOx emission has been included and tuned extensively in global climate models, its inclusions in regional chemistry models are seldom tested. Here we present a study that evaluates the frequently used Price and Rind parameterization based on cloud-top height at resolutions that partially resolve deep convection using the Weather Research and Forecasting model with Chemistry (WRF-Chem) over the contiguous United States. With minor modifications, the parameterization is shown to generate integrated flash counts close to those observed. However, the modeled frequency distribution of cloud-to-ground flashes do not represent well for storms with high flash rates, bringing into question the applicability of the intra-cloud/ground partitioning (IC:CG) formulation of Price and Rind in some studies. Resolution dependency also requires attention when sub-grid cloud-tops are used instead of the originally intended grid-averaged cloud-top. LNOx passive tracers being gathered by monsoonal upper tropospheric anticyclone.

Stationary waves and slowly moving features in the night upper clouds of Venus

NASA Astrophysics Data System (ADS)

Peralta, J.; Hueso, R.; Sánchez-Lavega, A.; Lee, Y. J.; Muñoz, A. García; Kouyama, T.; Sagawa, H.; Sato, T. M.; Piccioni, G.; Tellmann, S.; Imamura, T.; Satoh, T.

2017-08-01

At the cloud top level of Venus (65-70 km altitude) the atmosphere rotates 60 times faster than the underlying surface—a phenomenon known as superrotation1,2. Whereas on Venus's dayside the cloud top motions are well determined3,4,5,6 and Venus general circulation models predict the mean zonal flow at the upper clouds to be similar on both the day and nightside2, the nightside circulation remains poorly studied except for the polar region7,8. Here, we report global measurements of the nightside circulation at the upper cloud level. We tracked individual features in thermal emission images at 3.8 and 5.0 μm obtained between 2006 and 2008 by the Visible and Infrared Thermal Imaging Spectrometer-Mapper onboard Venus Express and in 2015 by ground-based measurements with the Medium-Resolution 0.8-5.5 Micron Spectrograph and Imager at the National Aeronautics and Space Administration Infrared Telescope Facility. The zonal motions range from -110 to -60 m s-1, which is consistent with those found for the dayside but with larger dispersion6. Slow motions (-50 to -20 m s-1) were also found and remain unexplained. In addition, abundant stationary wave patterns with zonal speeds from -10 to +10 m s-1 dominate the night upper clouds and concentrate over the regions of higher surface elevation.

14 CFR Appendix G to Part 417 - Natural and Triggered Lightning Flight Commit Criteria

Code of Federal Regulations, 2013 CFR

2013-01-01

... all clouds in the specified volume, computed as follows: (i) The cloud base to be averaged is the..., height-integrated radar reflectivity (VAHIRR) of clouds, are used with the lightning flight commit... the purpose of this appendix: Anvil cloud means a stratiform or fibrous cloud formed by the upper...

14 CFR Appendix G to Part 417 - Natural and Triggered Lightning Flight Commit Criteria

Code of Federal Regulations, 2012 CFR

2012-01-01

... all clouds in the specified volume, computed as follows: (i) The cloud base to be averaged is the..., height-integrated radar reflectivity (VAHIRR) of clouds, are used with the lightning flight commit... the purpose of this appendix: Anvil cloud means a stratiform or fibrous cloud formed by the upper...

14 CFR Appendix G to Part 417 - Natural and Triggered Lightning Flight Commit Criteria

Code of Federal Regulations, 2014 CFR

2014-01-01

... all clouds in the specified volume, computed as follows: (i) The cloud base to be averaged is the..., height-integrated radar reflectivity (VAHIRR) of clouds, are used with the lightning flight commit... the purpose of this appendix: Anvil cloud means a stratiform or fibrous cloud formed by the upper...

Tropical cloud buoyancy is the same in a world with or without ice

NASA Astrophysics Data System (ADS)

Seeley, Jacob T.; Romps, David M.

2016-04-01

When convective clouds grow above the melting line, where temperatures fall below 0°C, condensed water begins to freeze and water vapor is deposited. These processes release the latent heat of fusion, which warms cloud air, and many previous studies have suggested that this heating from fusion increases cloud buoyancy in the upper troposphere. Here we use numerical simulations of radiative-convective equilibrium with and without ice processes to argue that tropical cloud buoyancy is not systematically higher in a world with fusion than in a world without it. This insensitivity results from the fact that the environmental temperature profile encountered by developing tropical clouds is itself determined by convection. We also offer a simple explanation for the large reservoir of convective available potential energy in the tropical upper troposphere that does not invoke ice.

A physics-based model for the ionization of samarium by the MOSC chemical releases in the upper atmosphere

NASA Astrophysics Data System (ADS)

Bernhardt, Paul A.; Siefring, Carl L.; Briczinski, Stanley J.; Viggiano, Albert; Caton, Ronald G.; Pedersen, Todd R.; Holmes, Jeffrey M.; Ard, Shaun; Shuman, Nicholas; Groves, Keith M.

2017-05-01

Atomic samarium has been injected into the neutral atmosphere for production of electron clouds that modify the ionosphere. These electron clouds may be used as high-frequency radio wave reflectors or for control of the electrodynamics of the F region. A self-consistent model for the photochemical reactions of Samarium vapor cloud released into the upper atmosphere has been developed and compared with the Metal Oxide Space Cloud (MOSC) experimental observations. The release initially produces a dense plasma cloud that that is rapidly reduced by dissociative recombination and diffusive expansion. The spectral emissions from the release cover the ultraviolet to the near infrared band with contributions from solar fluorescence of the atomic, molecular, and ionized components of the artificial density cloud. Barium releases in sunlight are more efficient than Samarium releases in sunlight for production of dense ionization clouds. Samarium may be of interest for nighttime releases but the artificial electron cloud is limited by recombination with the samarium oxide ion.

Relationships of Upper Tropospheric Water Vapor, Clouds and SST: MLS Observations, ECMWF Analyses and GCM Simulations

NASA Technical Reports Server (NTRS)

Su, Hui; Waliser, Duane E.; Jiang, Jonathan H.; Li, Jui-lin; Read, William G.; Waters, Joe W.; Tompkins, Adrian M.

2006-01-01

The relationships of upper tropospheric water vapor (UTWV), cloud ice and sea surface temperature (SST) are examined in the annual cycles of ECMWF analyses and simulations from 15 atmosphere-ocean coupled models which were contributed to the IPCC AR4. The results are compared with the observed relationships based on UTWV and cloud ice measurements from MLS on Aura. It is shown that the ECMWF analyses produce positive correlations between UTWV, cloud ice and SST, similar to the MLS data. The rate of the increase of cloud ice and UTWV with SST is about 30% larger than that for MLS. For the IPCC simulations, the relationships between UTWV, cloud ice and SST are qualitatively captured. However, the magnitudes of the simulated cloud ice show a considerable disagreement between models, by nearly a factor of 10. The amplitudes of the approximate linear relations between UTWV, cloud ice and SST vary by a factor up to 4.

Coupled Sulfur and Chlorine Chemistry in Venus' Upper Cloud Layer

NASA Astrophysics Data System (ADS)

Mills, Franklin P.

2006-09-01

Venus' atmosphere likely contains a rich variety of sulfur and chlorine compounds because HCl, SO2, and OCS have all been observed. Photodissociation of CO2 and SO2 in the upper cloud layer produces oxygen which can react directly or indirectly with SO2 to form SO3 and eventually H2SO4. Photodissociation of HCl within and above the upper cloud layer produces chlorine which can react with CO and O2 to form ClCO and ClC(O)OO. These two species have been identified as potentially critical intermediaries in the production of CO2. Much less work has been done on the potential coupling between sulfur and chlorine chemistry that may occur within the upper cloud layer. Several aspects have been examined in recent modeling: (1) linkage of the CO2 and sulfur oxidation cycles (based on ideas from Yung and DeMore, 1982), (2) reaction of Cl with SO2 to form ClSO2 (based on ideas from DeMore et al., 1985), and (3) the chemistry of SmCln for m,n = 1,2 (based on preliminary work in Mills, 1998). Initial results suggest the chemistry of SmCln may provide a pathway for accelerated production of polysulfur, Sx, if the oxygen abundance in the upper cloud layer is as small as is implied by the observational limit on O2 (Trauger and Lunine, 1983). Initial results also suggest that ClSO2 can act as a buffer which helps increase the scale height of SO2 and decrease the rate of production of H2SO4. This presentation will describe the results from this modeling; discuss their potential implications for the CO2, sulfur oxidation, and polysulfur cycles; and outline key observations from Venus Express that can help resolve existing questions concerning the chemistry of Venus' upper cloud. Partial funding for this research was provided by the Australian Research Council.

Astronomers Trace Microquasar's Path Back in Time

NASA Astrophysics Data System (ADS)

2003-01-01

Astronomers have traced the orbit through our Milky Way Galaxy of a voracious neutron star and a companion star it is cannibalizing, and conclude that the pair joined more than 30 million years ago and probably were catapulted out of a cluster of stars far from the Galaxy's center. Path of Microquasar and Sun Path of Microquasar (red) and Sun (yellow) through the Milky Way Galaxy for the past 230 million years. Animations: GIF Version MPEG Version CREDIT: Mirabel & Rodrigues, NRAO/AUI/NSF The pair of stars, called Scorpius X-1, form a "microquasar," in which material sucked from the "normal" star forms a rapidly-rotating disk around the superdense neutron star. The disk becomes so hot it emits X-rays, and also spits out "jets" of subatomic particles at nearly the speed of light. Using precise positional data from the National Science Foundation's Very Long Baseline Array (VLBA) and from optical telescopes, Felix Mirabel, an astrophysicist at the Institute for Astronomy and Space Physics of Argentina and French Atomic Energy Commission, and Irapuan Rodrigues, also of the French Atomic Energy Commission, calculated that Scorpius X-1 is not orbiting the Milky Way's center in step with most other stars, but instead follows an eccentric path far above and below the Galaxy's plane. Scorpius X-1, discovered with a rocket-borne X-ray telescope in 1962, is about 9,000 light-years from Earth. It is the brightest continuous source of X-rays beyond the Solar System. The 1962 discovery and associated work earned a share of the 2002 Nobel Prize in physics for Riccardo Giacconi. Mirabel and Rodrigues used a number of published observations to calculate the path of Scorpius X-1 over the past few million years. "This is the most accurate determination we have made of the path of an X-ray binary," said Mirabel. By tracing the object's path backward in time, the scientists were able to conclude that the neutron star and its companion have been traveling together for more than 30 million years. They also speculated on the birthplace of Scorpius X-1. "The neutron star, which is the remnant left over from the supernova explosion of an even more massive star, either came from the Milky Way's disk, or from a globular cluster at a considerable distance from the disk," said Rodrigues. Globular clusters are clumps of millions of stars in the outskirts of the Galaxy. If it came from the Galaxy's disk, the scientists say, it would have had to receive a powerful one-sided "kick" from the supernova explosion to get into its present eccentric orbit. While this is possible, they conclude that a more likely scenario is that the neutron star came from a globular cluster. "Probably, this neutron star picked up its companion and was thrown out of its globular cluster by a close encounter with other stars at the cluster's core," Mirabel said. The scientists published their results in the January 30 issue of the journal Astronomy and Astrophysics. The same pair of researchers traced a similar path of a black hole and its companion star in 2001. Also that year, other astronomers produced a "movie" showing motions in the jet of material ejected from the disk around Scorpius X-1's neutron star. The National Radio Astronomy Observatory is a facility of the National Science Foundation, operated under cooperative agreement by Associated Universities, Inc.

Zodical Exoplanets in Time: Are These Worlds Flat?

NASA Astrophysics Data System (ADS)

Mann, Andrew; Rizzuto, Aaron; Newton, Elisabeth; Gaidos, Eric; Kraus, Adam; Dalba, Paul

2016-08-01

Over the past decade, Spitzer has helped to revolutionize our understanding of exoplanet atmospheres. By extending the reach of transmission spectroscopy (change in transit depth with wavelength) past 3 microns, Spitzer has provided unique constraints on the composition of the atmospheres of transiting planets. Such studies of super-Earth and Neptune size planets with both the Hubble Space Telescope and Spitzer have generally found featureless atmospheres, consistent with high clouds or a haze layer. This finding motivates more questions; how and when do these atmospheres form, how do they sustain themselves, and how long do they persist? Some answers could be found by comparing the atmospheres of similar planets with a range of ages from infancy (0-20 Myr) to adolescence (100-1000 Myr) to maturity (more than 1 Gyr). The mature part of this comparison is starting to become complete with many older super-Earth to Neptune size systems undergoing detailed study. However, even among the known young and adolescent systems, few were known to transit and none were amenable to transmission spectroscopy. Observations of young stars by the K2 mission has changed the landscape. From this data our team has identified and confirmed two transiting planets that will promote studies of exoplanet evolution. The first, K2-25b, orbits an M4.5 in the Hyades cluster (650 Myr), and the second, K2-33b, orbits an M3.5 pre-main sequence star in the Upper Scorpius OB association (11 Myr). We propose to observe 6 transits of the former and 5 of the latter with Spitzer/IRAC 3.6 and 4.5 micron bands. In combination with our K2 and ground-based data we can construct low-resolution transmission spectra of each planet in the key regions of atmospheric differentiation. This will provide the first insight into the atmospheres of young, small planets, determine when featureless atmospheres first appear, and provide constraints on the evolution of planetary atmospheres.

Cloud Condensation in Titan's Lower Stratosphere

NASA Technical Reports Server (NTRS)

Romani, Paul N.; Anderson, Carrie M.

2011-01-01

A 1-D condensation model is developed for the purpose of reproducing ice clouds in Titan's lower stratosphere observed by the Composite Infrared Spectrometer (CIRS) onboard Cassini. Hydrogen cyanide (HCN), cyanoacetylene (HC3N), and ethane (C2H6) vapors are treated as chemically inert gas species that flow from an upper boundary at 500 km to a condensation sink near Titan's tropopause (-45 km). Gas vertical profiles are determined from eddy mixing and a downward flux at the upper boundary. The condensation sink is based upon diffusive growth of the cloud particles and is proportional to the degree of supersaturation in the cloud formation regIOn. Observations of the vapor phase abundances above the condensation levels and the locations and properties of the ice clouds provide constraints on the free parameters in the model. Vapor phase abundances are determined from CIRS mid-IR observations, whereas cloud particle sizes, altitudes, and latitudinal distributions are derived from analyses of CIRS far-IR observations of Titan. Specific cloud constraints include: I) mean particle radii of2-3 J.lm inferred from the V6 506 cm- band of HC3N, 2) latitudinal abundance distributions of condensed nitriles, inferred from a composite emission feature that peaks at 160/cm , and 3) a possible hydrocarbon cloud layer at high latitudes, located near an altitude of 60 km, which peaks between 60 and 80 cm l . Nitrile abundances appear to diminish substantially at high northern latitudes over the time period 2005 to 2010 (northern mid winter to early spring). Use of multiple gas species provides a consistency check on the eddy mixing coefficient profile. The flux at the upper boundary is the net column chemical production from the upper atmosphere and provides a constraint on chemical pathways leading to the production of these compounds. Comparison of the differing lifetimes, vapor phase transport, vapor phase loss rate, and particle sedimentation, sheds light on temporal stability of the clouds.

Cloud and radiative heating profiles associated with the boreal summer intraseasonal oscillation

NASA Astrophysics Data System (ADS)

Kim, Jinwon; Waliser, Duane E.; Cesana, Gregory V.; Jiang, Xianan; L'Ecuyer, Tristan; Neena, J. M.

2018-03-01

The cloud water content (CW) and radiative heating rate (QR) structures related to northward propagating boreal summer intraseasonal oscillations (BSISOs) are analyzed using data from A-train satellites in conjunction with the ERA-Interim reanalysis. It is found that the northward movement of CW- and QR anomalies are closely synchronized with the northward movement of BSISO precipitation maxima. Commensurate with the northward propagating BSISO precipitation maxima, the CW anomalies exhibit positive ice (liquid) CW maxima in the upper (middle/low) troposphere with a prominent tilting structure in which the low-tropospheric (upper-tropospheric) liquid (ice) CW maximum leads (lags) the BSISO precipitation maximum. The BSISO-related shortwave heating (QSW) heats (cools) the upper (low) troposphere; the longwave heating (QLW) cools (heats) the upper (middle/low) troposphere. The resulting net radiative heating (QRN), being dominated by QLW, cools (heats) the atmosphere most prominently above the 200 hPa level (below the 600 hPa level). Enhanced clouds in the upper and middle troposphere appears to play a critical role in increasing low-level QLW and QRN. The vertically-integrated QSW, QLW and QRN are positive in the region of enhanced CW with the maximum QRN near the latitude of the BSISO precipitation maximum. The bottom-heavy radiative heating anomaly resulting from the cloud-radiation interaction may act to strengthen convection.

First Look at the Upper Tropospheric Ozone Mixing Ratio from OMI Estimated using the Cloud Slicing Technique

NASA Technical Reports Server (NTRS)

Bhartia, Pawan K.; Ziemke, Jerry; Chandra, Sushil; Joiner, Joanna; Vassilkov, Alexandra; Taylor, Steven; Yang, Kai; Ahn, Chang-Woo

2004-01-01

The Cloud Slicing technique has emerged as a powerful tool for the study of ozone in the upper troposphere. In this technique one looks at the variation with cloud height of the above-cloud column ozone derived from the backscattered ultraviolet instruments, such as TOMS, to determine the ozone mixing ratio. For this technique to work properly one needs an instrument with relatively good horizontal resolution with very good signal to noise in measuring above-cloud column ozone. In addition, one needs the (radiatively) effective cloud pressure rather than the cloud-top pressure, for the ultraviolet photons received by a satellite instrument are scattered from inside the cloud rather than from the top. For this study we use data from the OMI sensor, which was recently launched on the EOS Aura satellite. OMI is a W-Visible backscattering instrument with a nadir pixel size of 13 x 24 km. The effective cloud pressure is derived from a new algorithm based on Rotational Raman Scattering and O2-O2, absorption in the 340-400 nm band of OMI.

Skyscape of an Amazonian Diaspora: Arawak Astronomy in Historical Comparative Perspective

NASA Astrophysics Data System (ADS)

Jara, Fabiola

The title of this article "Arawak Astronomy" suggests that the research matter concerns the astronomy of an already well-defined ethnographic entity. This however does not do justice to the complexities of Arawak (pre)history. This contribution aims to discuss and connect the available historical and ethnographic data on Arawak astronomies as gathered by the author (Jara 2000), with the most recent research on the archeology and comparative linguistics of the Arawak diaspora. The article argues that Arawak astronomy has to be related to the cultural and sociopolitical continuities and discontinuities of the Arawak diaspora throughout the lowlands of tropical South America. This article recognizes the need to consider Arawak astronomy has an object to be discovered and explained within its local and regional contexts. Notwithstanding these remarks, based on a sustained examination of ethnohistorical and ethnographic sources, this article proposes that Arawak astronomy can be characterized by at least four elements: firstly, a horizon system of observation which combines the observation of the solar solstices and equinoxes with the near heliacal and near cosmic rising or setting of at least seven star groups - the Pleiades, the Hyades, the upper stars of the constellation of Scorpius (including α Sco), Corvus, the Belt of Orion, several stars near Sirius, and the Milky Way. Secondly, the association of the rising and setting of these star groups with the seasonal cycle, mainly with the start and/or of the end of rainy and dry seasons. Thirdly, the widespread association of the stars of the year (most commonly the Pleiades but sometimes Orion or the head of Scorpius) with the beginning of the agricultural cycle and consequently with the end of the heavy rains announcing the time to plant the new fields. The last and fourth commonality are the inscriptions or markings of the origin of the stars in the local landscape, lakes, mountains, and other salient landscape features.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bony, Sandrine; Stevens, Bjorn; Coppin, David

General circulation models show that as the surface temperature increases, the convective anvil clouds shrink. By analyzing radiative–convective equilibrium simulations, our work shows that this behavior is rooted in basic energetic and thermodynamic properties of the atmosphere: As the climate warms, the clouds rise and remain at nearly the same temperature, but find themselves in a more stable atmosphere; this enhanced stability reduces the convective outflow in the upper troposphere and decreases the anvil cloud fraction. By warming the troposphere and increasing the upper-tropospheric stability, the clustering of deep convection also reduces the convective outflow and the anvil cloud fraction.more » When clouds are radiatively active, this robust coupling between temperature, high clouds, and circulation exerts a positive feedback on convective aggregation and favors the maintenance of strongly aggregated atmospheric states at high temperatures. This stability iris mechanism likely contributes to the narrowing of rainy areas as the climate warms. Whether or not it influences climate sensitivity requires further investigation.« less

Photographer : JPL Range : 3.4 million km This pair of images shows two of the long-lived white oval

NASA Technical Reports Server (NTRS)

1979-01-01

Photographer : JPL Range : 3.4 million km This pair of images shows two of the long-lived white oval clouds which have resided in the Jovian southern hemisphere for nearly 40 years. The upper picture shows the cloud that is at a longitude west of the Great Red Spot, and the lower frame, the cloud at a longitude east of this feature. The third oval is currently just south of the Great Red Spot. The clouds show very similar internal structures. To the east of each of them, recirculation currents are clearly seen. In the lower frame, a similar structure is seen to the west of the cloud. Although a recirculation current is associated with the upper western region of the cloud, it is further away from this feature and not seen in the image. This photo was taken by Voyager 2.

Thermodynamic control of anvil cloud amount

PubMed Central

Bony, Sandrine; Stevens, Bjorn; Coppin, David; Becker, Tobias; Reed, Kevin A.; Voigt, Aiko

2016-01-01

General circulation models show that as the surface temperature increases, the convective anvil clouds shrink. By analyzing radiative–convective equilibrium simulations, we show that this behavior is rooted in basic energetic and thermodynamic properties of the atmosphere: As the climate warms, the clouds rise and remain at nearly the same temperature, but find themselves in a more stable atmosphere; this enhanced stability reduces the convective outflow in the upper troposphere and decreases the anvil cloud fraction. By warming the troposphere and increasing the upper-tropospheric stability, the clustering of deep convection also reduces the convective outflow and the anvil cloud fraction. When clouds are radiatively active, this robust coupling between temperature, high clouds, and circulation exerts a positive feedback on convective aggregation and favors the maintenance of strongly aggregated atmospheric states at high temperatures. This stability iris mechanism likely contributes to the narrowing of rainy areas as the climate warms. Whether or not it influences climate sensitivity requires further investigation. PMID:27412863

Thermodynamic control of anvil cloud amount

DOE PAGES

Bony, Sandrine; Stevens, Bjorn; Coppin, David; ...

2016-07-13

General circulation models show that as the surface temperature increases, the convective anvil clouds shrink. By analyzing radiative–convective equilibrium simulations, our work shows that this behavior is rooted in basic energetic and thermodynamic properties of the atmosphere: As the climate warms, the clouds rise and remain at nearly the same temperature, but find themselves in a more stable atmosphere; this enhanced stability reduces the convective outflow in the upper troposphere and decreases the anvil cloud fraction. By warming the troposphere and increasing the upper-tropospheric stability, the clustering of deep convection also reduces the convective outflow and the anvil cloud fraction.more » When clouds are radiatively active, this robust coupling between temperature, high clouds, and circulation exerts a positive feedback on convective aggregation and favors the maintenance of strongly aggregated atmospheric states at high temperatures. This stability iris mechanism likely contributes to the narrowing of rainy areas as the climate warms. Whether or not it influences climate sensitivity requires further investigation.« less

Improved simulation of aerosol, cloud, and density measurements by shuttle lidar

NASA Technical Reports Server (NTRS)

Russell, P. B.; Morley, B. M.; Livingston, J. M.; Grams, G. W.; Patterson, E. W.

1981-01-01

Data retrievals are simulated for a Nd:YAG lidar suitable for early flight on the space shuttle. Maximum assumed vertical and horizontal resolutions are 0.1 and 100 km, respectively, in the boundary layer, increasing to 2 and 2000 km in the mesosphere. Aerosol and cloud retrievals are simulated using 1.06 and 0.53 microns wavelengths independently. Error sources include signal measurement, conventional density information, atmospheric transmission, and lidar calibration. By day, tenuous clouds and Saharan and boundary layer aerosols are retrieved at both wavelengths. By night, these constituents are retrieved, plus upper tropospheric, stratospheric, and mesospheric aerosols and noctilucent clouds. Density, temperature, and improved aerosol and cloud retrievals are simulated by combining signals at 0.35, 1.06, and 0.53 microns. Particlate contamination limits the technique to the cloud free upper troposphere and above. Error bars automatically show effect of this contamination, as well as errors in absolute density nonmalization, reference temperature or pressure, and the sources listed above. For nonvolcanic conditions, relative density profiles have rms errors of 0.54 to 2% in the upper troposphere and stratosphere. Temperature profiles have rms errors of 1.2 to 2.5 K and can define the tropopause to 0.5 km and higher wave structures to 1 or 2 km.

The Zodiacal Exoplanets in Time (ZEIT) Survey

NASA Astrophysics Data System (ADS)

Mann, Andrew; Gaidos, Eric; Newton, Elisabeth R.; Rizzuto, Aaron C.; Vanderburg, Andrew; Mace, Gregory N.; Kraus, Adam L.

2017-01-01

Planets and their host stars evolve with time, and the first few hundred million years are thought to be the most formative. However, the majority of known exoplanets orbit stars older than the timescales of interest (>1 Gyr). We have launched the Zodiacal Exoplanets in Time (ZEIT) survey with the goal of identifying and characterizing young (<1 Gyr) transiting planets. To this end, we have utilized high-precision photometry of nearby young clusters and stellar associations taken as part of the K2 mission. Thus far we have discovered transiting planets in the Hyades and Praesepe clusters (˜800 Myr), and the Upper Scorpius OB association (˜11 Myr), but interestingly none in the Pleiades (˜125 Myr). These discoveries can be used to set limits on the migration timescale, estimate atmosphere loss around young planets, and provide independent tests of pre-main sequence stellar models. Here I overview some key science results from our survey and briefly discuss our plans to identify more young planetary systems.

Initial studies of middle and upper tropospheric stratiform clouds

NASA Technical Reports Server (NTRS)

Cox, S. K.

1982-01-01

The spatial and temporal occurrence of cloud layers, the development of a physical-numerical model to simulate the life cycles of tropospheric cloud layers, and the design of an observational program to study the properties of these layers are described.

Observing Ice in Clouds from Space

NASA Technical Reports Server (NTRS)

Ackerman, S.; Star, D. O'C.; Skofronick-Jackson, G.; Evans, F.; Wang, J. R.; Norris, P.; daSilva, A.; Soden, B.

2006-01-01

There are many satellite observations of cloud top properties and the liquid and rain content of clouds, however, we do not yet quantitatively understand the processes that control the water budget of the upper troposphere where ice is the predominant phase, and how these processes are linked to precipitation processes and the radiative energy budget. The ice in clouds in the upper troposphere either melts into rain or is detrained, and persists, as cirrus clouds affecting the hydrological and energy cycle, respectively. Fully modeling the Earth's climate and improving weather and climate forecasts requires accurate satellite measurements of various cloud properties at the temporal and spatial scales of cloud processes. These properties include cloud horizontal and vertical structure, cloud water content and some measure of particle sizes and shapes. The uncertainty in knowledge of these ice characteristics is reflected in the large discrepancies in model simulations of the upper tropospheric water budget. Model simulations are sensitive to the partition of ice between precipitation and outflow processes, i.e., to the parameterization of ice clouds and ice processes. One barrier to achieving accurate global ice cloud properties is the lack of adequate observations at millimeter and submillimeter wavelengths (183-874 GHz). Recent advances in instrumentation have allowed for the development and implementation of an airborne submillimeter-wave radiometer. The brightness temperatures at these frequencies are especially sensitive to cirrus ice particle sizes (because they are comparable to the wavelength). This allows for more accurate ice water path estimates when multiple channels are used to probe into the cloud layers. Further, submillimeter wavelengths offer simplicity in the retrieval algorithms because they do not probe into the liquid and near surface portions of clouds, thus requiring only one term of the radiative transfer equation (ice scattering) to relate brightness temperatures to ice. The next step is a satellite mission designed to acquire global Earth radiance measurements in the submillimeter-wave region, thus bridging the measurement gap between microwave sounders and shorter-wavelength infrared and visible sensors. This presentation provides scientific justification and an approach to measuring ice water path and particle size from a satellite platform that spans a range encompassing both the hydrologically active and radiatively active components of cloud systems.

The Study of Spherical Cores with a Toroidal Magnetic Field Configuration

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gholipour, Mahmoud

Observational studies of the magnetic fields in molecular clouds have significantly improved the theoretical models developed for the structure and evolution of dense clouds and for the star formation process as well. The recent observational analyses on some cores indicate that there is a power-law relationship between magnetic field and density in the molecular clouds. In this study, we consider the stability of spherical cores with a toroidal magnetic field configuration in the molecular clouds. For this purpose, we model a spherical core that is in magnetostatic equilibrium. Herein, we propose an equation of density structure, which is a modifiedmore » form of the isothermal Lane–Emden equation in the presence of the toroidal magnetic field. The proposed equation describes the effect of the toroidal magnetic field on the cloud structure and the mass cloud. Furthermore, we found an upper limit for this configuration of magnetic field in the molecular clouds. Then, the virial theorem is used to consider the cloud evolution leading to an equation in order to obtain the lower limit of the field strength in the molecular cloud. However, the results show that the field strength of the toroidal configuration has an important effect on the cloud structure, whose upper limit is related to the central density and field gradient. The obtained results address some regions of clouds where the cloud decomposition or star formation can be seen.« less

Evaluation of and Suggested Improvements to the WSM6 Microphysics in WRF- ARW Using Synthetic and Observed GOES-13 Imagery

DOE Office of Scientific and Technical Information (OSTI.GOV)

Grasso, Lewis; Lindsey, Daniel T.; Lim, Kyo-Sun

Synthetic satellite imagery can be employed to evaluate simulated cloud fields. Past studies have revealed that the Weather Research and Forecasting (WRF) WRF Single-Moment 6-class (WSM6) microphysics in WRF-ARW produces less upper level ice clouds within synthetic images compared to observations. Synthetic Geostationary Operational Environmental Satellite (GOES)-13 imagery at 10.7 μm of simulated cloud fields from the 4 km National Severe Storms Laboratory (NSSL) WRF-ARW is compared to observed GOES-13 imagery. Histograms suggest that too few points contain upper level simulated ice clouds. In particular, side-by-side examples are shown of synthetic and observed convective anvils. Such images illustrate the lackmore » of anvil cloud associated with convection produced by the NSSL WRF-ARW. A vertical profile of simulated hydrometeors suggests that too much cloud water mass may be converted into graupel mass, effectively reducing the main source of ice mass in a simulated anvil. Further, excessive accretion of ice by snow removes ice from an anvil by precipitation settling. Idealized sensitivity tests reveal that a 50% reduction of the conversion of cloud water mass to graupel and a 50% reduction of the accretion rate of ice by snow results in a significant increase in anvil ice of a simulated storm. Such results provide guidance as to which conversions could be reformulated, in a more physical manner, to increase simulated ice mass in the upper troposphere.« less

LITHIUM IN THE UPPER CENTAURUS LUPUS AND LOWER CENTAURUS CRUX SUBGROUPS OF SCORPIUS-CENTAURUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bubar, Eric J.; Schaeuble, Marc; King, Jeremy R.

2011-12-15

We utilize spectroscopically derived model atmosphere parameters and the Li I {lambda}6104 subordinate line and the {lambda}6708 doublet to derive lithium abundances for 12 members of the Upper Centaurus Lupus and Lower Centaurus Crux subgroups of the Scorpius-Centaurus OB Association. The results indicate any intrinsic Li scatter in our 0.9-1.4 M{sub Sun} stars is limited to {approx}0.15 dex, consistent with the lack of dispersion in {>=}1.0 M{sub Sun} stars in the 100 Myr Pleiades and 30-50 Myr IC 2391 and 2602 clusters. Both ab initio uncertainty estimates and the derived abundances themselves indicate that the {lambda}6104 line yields abundances withmore » equivalent or less scatter than is found from the {lambda}6708 doublet as a result of lower uncertainties for the subordinate feature, a result of low sensitivity to broadening in the subordinate feature. Because non-local thermodynamic equilibrium (NLTE) corrections are less susceptible to changes in surface gravity and/or metallicity for the 6104 A line, the subordinate Li feature is preferred for deriving lithium abundances in young Li-rich stellar association stars with T{sub eff} {>=} 5200 K. At these temperatures, we find no difference between the Li abundances derived from the two Li I lines. For cooler stars, having temperatures at which main-sequence dwarfs show abundance patterns indicating overexcitation and overionization, the {lambda}6104-based Li abundances are {approx}0.4 dex lower than those derived from the {lambda}6708 doublet. The trends of the abundances from each feature with T{sub eff} suggest that this difference is due to (near)UV photoionization, which in NLTE preferentially ionizes Li atoms in the subordinate 2p state relative to the 2s resonance line state due to opacity effects. Consequently, this overionization of Li in the 2p state, apparently not adequately accounted for in NLTE corrections, weakens the {lambda}6104 feature in cooler stars. Accordingly, the {lambda}6708-based abundances may give more reliable estimates of the mean Li abundance in cool young stars. Our mean Li abundance, log N(Li) =3.50 {+-} 0.07 is {approx}0.2 dex larger than the meteoritic value. While stellar models suggest that Li depletion of at least 0.4 dex, and possibly much larger, should have occurred in our lowest mass star(s), our Li abundances show no decline with decreasing mass indicative of such depletion.« less

Exploring The Relation Between Upper Tropospheric (UT) Clouds and Convection

NASA Astrophysics Data System (ADS)

Stephens, G. L.; Stubenrauch, C.

2017-12-01

The importance of knowing the vertical transports of water vapor and condensate by atmospheric moist convection cannot be overstated. Vertical convective transports have wide-ranging influences on the Earth system, shaping weather, climate, the hydrological cycle and the composition of the atmosphere. These transports also influence the upper tropospheric cloudiness that exerts profound effects on climate. Although there are presently no direct observations to quantify these transports on the large scale, and there are no observations to constrain model assumptions about them, it might be possible to derive useful observations proxies of these transports and their influence. This talk will present results derived from a large community effort that has developed important observations data records that link clouds and convection. Steps to use these observational metrics to examine the relation between convection, UT clouds in both cloud and global scale models are exemplified and important feedbacks between high clouds, radiation and convection will be elucidated.

A Study of Cirrus Clouds and Aerosols in the Upper Troposphere using Models and Satellite Data

NASA Technical Reports Server (NTRS)

Bergstrom, Robert W.

2004-01-01

This report is the final report for the Cooperative Agreement NCC2-1213. It is a compilation of publications produced under this Cooperative Agreement and conference presentations. The tasks for the Aerosol Physical Chemistry Model for the Upper Troposphere include: Task 1: To compare APCM predictions against the SUCCESS data and other aircraft campaigns and to investigate the role of aerosol composition on cirrus cloud nucleation; Task 2: To study the seasonal evolution and spatial distribution of upper-tropospheric tropical and polar cirrus; Task 3: To investigate CLAES cirrus data with other complementary (TOGA-COARE and CEPEX) data. Tasks for Upper Tropospheric Cirrus Clouds include: Task 1: Assemble 3-hourly (or more frequent) meteorological satellite data fiom geostationary satellites to obtain a global, or nearly global, dataset of infiared brightness temperatures as a function of time for airborne experimental periods; Task 2: Explore methods to improve the cloud top altitude distributions calculated fiom meteorological satellite data. This will focus on linlung the 6.5 micron channel geostationary brightness temperatures and the 10.5 micron brightness temperatures; Task 3: Explore methods to differentiate convective fiom stratiform cloudiness; Task 4: Perform trajectory analyses using an existing trajectory modeling package that links the cloud data with air mass histories; Task 5: Apply techniques from tasks 1 through 4 to provide meteorological support to the CRYSTAL-FACE mission, both in its preparation and deployment phases. The report include four published articles and two slide presentations.

Predicting Hail Size Using Model Vertical Velocities

DTIC Science & Technology

2008-03-01

updrafts from a simple cloud model using forecasted soundings . The models used MM5 model data coinciding with severe hail events collected from the...updrafts from a simple cloud model using forecasted soundings . The models used MM5 model data coinciding with severe hail events collected from the...determine their accuracy. Plus they are based primary on observed upper air soundings . Obtaining upper air soundings in proximity to convective

Kimberley, Orange Free State, South Africa

NASA Image and Video Library

1996-01-20

STS072-727-059 (11-20 Jan. 1996) --- Plains of the Orange Free State, South Africa are featured in this 70mm frame exposed from the Space Shuttle Endeavour. If the photograph is oriented with the largest clouds at the top edge, so that the cloud shadows fall to the upper right of each cloud, then north is to the top. The Vaal River flows along the top and through the upper left of the photograph; the reservoir of the Bloemhofdam on the Sand River can be seen between clouds at the upper right of the photograph. Kimberley can be seen as a gray smudge southeast of a contorted set of bends in the Vaal river (upper left center). With high magnification four dark dots, large open-pit mine shafts, can be seen within the gray smudge of the city. Kimberley, the capital of Northern Cape Province, was founded in 1878 after the discovery of diamonds in 1969 - 71, and reached by railway in 1885. Diamond mining and gem cutting remain prominent in the economy. The reddish soil and scattered salt pans (playa lakes) across the plateau suggest the semi-arid climate, suitable for cattle ranching. Reservoirs on most streams now provide water for the towns as well as irrigation for agriculture.

Detecting long-duration cloud contamination in hyper-temporal NDVI imagery

NASA Astrophysics Data System (ADS)

Ali, Amjad; de Bie, C. A. J. M.; Skidmore, A. K.

2013-10-01

Cloud contamination impacts on the quality of hyper-temporal NDVI imagery and its subsequent interpretation. Short-duration cloud impacts are easily removed by using quality flags and an upper envelope filter, but long-duration cloud contamination of NDVI imagery remains. In this paper, an approach that goes beyond the use of quality flags and upper envelope filtering is tested to detect when and where long-duration clouds are responsible for unreliable NDVI readings, so that a user can flag those data as missing. The study is based on MODIS Terra and the combined Terra-Aqua 16-day NDVI product for the south of Ghana, where persistent cloud cover occurs throughout the year. The combined product could be assumed to have less cloud contamination, since it is based on two images per day. Short-duration cloud effects were removed from the two products through using the adaptive Savitzky-Golay filter. Then for each 'cleaned' product an unsupervised classified map was prepared using the ISODATA algorithm, and, by class, plots were prepared to depict changes over time of the means and the standard deviations in NDVI values. By comparing plots of similar classes, long-duration cloud contamination appeared to display a decline in mean NDVI below the lower limit 95% confidence interval with a coinciding increase in standard deviation above the upper limit 95% confidence interval. Regression analysis was carried out per NDVI class in two randomly selected groups in order to statistically test standard deviation values related to long-duration cloud contamination. A decline in seasonal NDVI values (growing season) were below the lower limit of 95% confidence interval as well as a concurrent increase in standard deviation values above the upper limit of the 95% confidence interval were noted in 34 NDVI classes. The regression analysis results showed that differences in NDVI class values between the Terra and the Terra-Aqua imagery were significantly correlated (p < 0.05) with the corresponding standard deviation values of the Terra imagery in case of all NDVI classes of two selected NDVI groups. The method successfully detects long-duration cloud contamination that results in unreliable NDVI values. The approach offers scientists interested in time series analysis a method of masking by area (class) the periods when pre-cleaned NDVI values remain affected by clouds. The approach requires no additional data for execution purposes but involves unsupervised classification of the imagery to carry out the evaluation of class-specific mean NDVI and standard deviation values over time.

Synoptic-scale variability of arctic gravity wave activity during summer and potential impacts on the high latitude middle atmosphere

NASA Astrophysics Data System (ADS)

Gerrard, Andrew John

Although the role of gravity waves in the global atmospheric circulation is generally understood, discussion of synoptic gravity wave activity, especially pertaining to high latitude summer environments, is lacking in the literature. Tropospherically generated gravity waves greatly contribute to the zonal drag necessary to induce meridional outflow and subsequent upwelling observed in the adiabatically cooled summer mesosphere, ultimately resulting in an environment conducive to mesospheric cloud formation. However, the very gravity wave activity responsible for this induced cooling is also believed to be a major source of variability on mesospheric clouds over shorter time scales, and this topic should be of considerable interest if such clouds are to be used as tracers of the global climate. It is therefore the purpose of this thesis to explore high latitude synoptic gravity wave activity and ultimately seek an understanding of the associated influence on overlaying summer mesospheric clouds. Another goal is to better understand and account for potential variability in high latitude middle and upper atmospheric measurements that can be directly associated with "weather conditions" at lower altitudes. These endeavors are addressed through Rayleigh/aerosol lidar data obtained from the ARCtic LIdar TEchnology (ARCLITE) facility located at Sondrestrom, Greenland (67°N, 310°E), global tropospheric and stratospheric analyses and forecasts, and the Gravity-wave Regional Or Global RAy Tracer (GROGRAT) model. In this study we are able to show that (a) the upper stratospheric gravity wave strength and the brightness of overlaying mesospheric clouds, as measured by representative field proxies, are negatively correlated over time scales of less than a day, (b) such upper stratospheric gravity wave variability is inversely related to mesospheric cloud variability on time scales of ˜1 to 4 hours, (c) gravity wave hindcasts faithfully reproduce experimental lidar observations taken over the month of August 1996, (d) the observed upper stratospheric gravity wave activity is shown to originate from regionalized, non-orographic sources in the troposphere, (e) such gravity wave activity can propagate through the middle atmosphere, potentially impacting overlaying mesospheric clouds, and (f) the forecasting of such upper stratospheric gravity wave activity, and therefore the corresponding mesospheric cloud activity, is feasible. In conclusion, the results herein provide additional evidence of gravity wave influence on mesospheric clouds, a step towards the forecasting of regional gravity wave activity, and ultimately a better understanding of synoptic gravity wave activity at high latitudes.

Cloud Detection Using Measured and Modeled State Parameters

NASA Technical Reports Server (NTRS)

Yi, Y.; Minnis, P.; Huang, J.; Ayers, J. K.; Doelling, D. R.; Khaiyer, M. M.; Nordeen, M. L.

2004-01-01

In this study, hourly RUC analyses were used to examine the differences between RH and temperature values from RUC reanalysis data and from radiosonde atmospheric profiles obtained at the ARM SCF. The results show that the temperature observations from the SONDE and RUC are highly correlated. The RHs are also well-correlated, but the SONDE values generally exceed those from RUC. Inside cloud layers, the RH from RUC is 2-14% lower than the RH from SONDE for all RUC layers. Although the layer mean RH within clouds is much greater than the layer mean RH outside cloud or in the clear-sky, RH thresholds chosen as a function of temperature can more accurately diagnose cloud occurrence for either dataset. For overcast clouds, it was found that the 50% probability RH threshold for diagnosing a cloud, within a given upper tropospheric layer is roughly 90% for the Vaisala RS80-15LH radisonde and 80% for RUC data. While for the partial cloud (cloud amount is less than 90%), the RH thresholds of SONDE are close to RUC for a given probability in upper tropospheric layers. The probabilities of detecting clouds at a given RH and temperature should be useful for a variety of application such as the development of new cloud parameterizations or for estimating the vertical profile of cloudiness underneath a given cloud observed from the satellite to construct a 3-D cloud data set for computing atmospheric radiative heating profiles or determining potential aircraft icing conditions.

An upper limit to the abundance of lightning-produced amino acids in the Jovian water clouds

NASA Astrophysics Data System (ADS)

Bar-Nun, A.; Noy, N.; Podolak, M.

1984-08-01

The effect of excess hydrogen on the synthesis of amino acids by high-temperature shock waves in a hydrogen/methane/ammonia/water vapor mixture was studied experimentally. The energy efficiency results, together with the best estimate of the lightning energy dissipation rate on Jupiter from the Voyage data, were used to calculate an upper limit to the rate of amino acid production by lightning in Jovian water clouds. Using reasonable values for the eddy diffusion coefficients within and below the water clouds, the column abundance of lightning-produced amino acids in the clouds was estimated to be 6.2 x 10 to the -6th cm-am. Hence, concentration of amino acids in water droplets would be 8 x 10 to the -8th mole/liter.

Jabbah and Associates

NASA Image and Video Library

2011-11-25

This view from NASA Wide-field Infrared Survey Explorer takes in an area of the sky in the constellation of Scorpius surrounding Jabbah Arabic name means the forehead of the scorpion which is larger than a grid of eight by eight full moons.

Developing Normal Turns-Amplitude Clouds for Upper and Lower Limbs.

PubMed

Jabre, Joe F; Nikolayev, Sergey G; Babayev, Michael B; Chindilov, Denis V; Muravyov, Anatoly Y

2016-10-01

Turns and amplitude analysis (T&A) is a frequently used method for automatic EMG interference pattern analysis. The T&A normal values have only been developed for a limited number of muscles. Our objective was to obtain normal T&A clouds for upper and lower extremity muscles for which no normal values exist in the literature. The T&A normative data using concentric needle electrodes were obtained from 68 men and 56 women aged 20 to 60 years. Normal upper and lower extremity T&A clouds were obtained and presented in this article. The T&A normal values collected in this study maybe used to detect neurogenic and myopathic abnormalities in men and women at low-to-moderate muscle contractions. The effect of turns-amplitude data obtained at high force level of muscle contraction and its potential to falsely show neurogenic abnormalities are discussed.

Vertical Structures of Anvil Clouds of Tropical Mesoscale Convective Systems Observed by CloudSat

NASA Technical Reports Server (NTRS)

Hence, Deanna A.; Houze, Robert A.

2011-01-01

A global study of the vertical structures of the clouds of tropical mesoscale convective systems (MCSs) has been carried out with data from the CloudSat Cloud Profiling Radar. Tropical MCSs are found to be dominated by cloud-top heights greater than 10 km. Secondary cloud layers sometimes occur in MCSs, but outside their primary raining cores. The secondary layers have tops at 6 8 and 1 3 km. High-topped clouds extend outward from raining cores of MCSs to form anvil clouds. Closest to the raining cores, the anvils tend to have broader distributions of reflectivity at all levels, with the modal values at higher reflectivity in their lower levels. Portions of anvil clouds far away from the raining core are thin and have narrow frequency distributions of reflectivity at all levels with overall weaker values. This difference likely reflects ice particle fallout and therefore cloud age. Reflectivity histograms of MCS anvil clouds vary little across the tropics, except that (i) in continental MCS anvils, broader distributions of reflectivity occur at the uppermost levels in the portions closest to active raining areas; (ii) the frequency of occurrence of stronger reflectivity in the upper part of anvils decreases faster with increasing distance in continental MCSs; and (iii) narrower-peaked ridges are prominent in reflectivity histograms of thick anvil clouds close to the raining areas of connected MCSs (superclusters). These global results are consistent with observations at ground sites and aircraft data. They present a comprehensive test dataset for models aiming to simulate process-based upper-level cloud structure around the tropics.

Vertical Structures of Anvil Clouds of Tropical Mesoscale Convective Systems Observed by CloudSat

NASA Technical Reports Server (NTRS)

Yuan, J.; Houze, R. A., Jr.; Heymsfield, A.

2011-01-01

A global study of the vertical structures of the clouds of tropical mesoscale convective systems (MCSs) has been carried out with data from the CloudSat Cloud Profiling Radar. Tropical MCSs are found to be dominated by cloud-top heights greater than 10 km. Secondary cloud layers sometimes occur in MCSs, but outside their primary raining cores. The secondary layers have tops at 6--8 and 1--3 km. High-topped clouds extend outward from raining cores of MCSs to form anvil clouds. Closest to the raining cores, the anvils tend to have broader distributions of reflectivity at all levels, with the modal values at higher reflectivity in their lower levels. Portions of anvil clouds far away from the raining core are thin and have narrow frequency distributions of reflectivity at all levels with overall weaker values. This difference likely reflects ice particle fallout and therefore cloud age. Reflectivity histograms of MCS anvil clouds vary little across the tropics, except that (i) in continental MCS anvils, broader distributions of reflectivity occur at the uppermost levels in the portions closest to active raining areas; (ii) the frequency of occurrence of stronger reflectivity in the upper part of anvils decreases faster with increasing distance in continental MCSs; and (iii) narrower-peaked ridges are prominent in reflectivity histograms of thick anvil clouds close to the raining areas of connected MCSs (superclusters). These global results are consistent with observations at ground sites and aircraft data. They present a comprehensive test dataset for models aiming to simulate process-based upper-level cloud structure around the tropics.

Light in condensed matter in the upper atmosphere as the origin of homochirality: circularly polarized light from Rydberg matter.

PubMed

Holmlid, Leif

2009-01-01

Clouds of the condensed excited Rydberg matter (RM) exist in the atmospheres of comets and planetary bodies (most easily observed at Mercury and the Moon), where they surround the entire bodies. Vast such clouds are recently proposed to exist in the upper atmosphere of Earth (giving rise to the enormous features called noctilucent clouds, polar mesospheric clouds, and polar mesospheric summer radar echoes). It has been shown in experiments with RM that linearly polarized visible light scattered from an RM layer is transformed to circularly polarized light with a probability of approximately 50%. The circular Rydberg electrons in the magnetic field in the RM may be chiral scatterers. The magnetic and anisotropic RM medium acts as a circular polarizer probably by delaying one of the perpendicular components of the light wave. The delay process involved is called Rabi-flopping and gives delays of the order of femtoseconds. This strong effect thus gives intense circularly polarized visible and UV light within RM clouds. Amino acids and other chiral molecules will experience a strong interaction with this light field in the upper atmospheres of planets. The interaction will vary with the stereogenic conformation of the molecules and in all probability promote the survival of one enantiomer. Here, this strong effect is proposed to be the origin of homochirality. The formation of amino acids in the RM clouds is probably facilitated by the catalytic effect of RM.

Light in Condensed Matter in the Upper Atmosphere as the Origin of Homochirality: Circularly Polarized Light from Rydberg Matter

NASA Astrophysics Data System (ADS)

Holmlid, Leif

2009-08-01

Clouds of the condensed excited Rydberg matter (RM) exist in the atmospheres of comets and planetary bodies (most easily observed at Mercury and the Moon), where they surround the entire bodies. Vast such clouds are recently proposed to exist in the upper atmosphere of Earth (giving rise to the enormous features called noctilucent clouds, polar mesospheric clouds, and polar mesospheric summer radar echoes). It has been shown in experiments with RM that linearly polarized visible light scattered from an RM layer is transformed to circularly polarized light with a probability of approximately 50%. The circular Rydberg electrons in the magnetic field in the RM may be chiral scatterers. The magnetic and anisotropic RM medium acts as a circular polarizer probably by delaying one of the perpendicular components of the light wave. The delay process involved is called Rabi-flopping and gives delays of the order of femtoseconds. This strong effect thus gives intense circularly polarized visible and UV light within RM clouds. Amino acids and other chiral molecules will experience a strong interaction with this light field in the upper atmospheres of planets. The interaction will vary with the stereogenic conformation of the molecules and in all probability promote the survival of one enantiomer. Here, this strong effect is proposed to be the origin of homochirality. The formation of amino acids in the RM clouds is probably facilitated by the catalytic effect of RM.

Effects of variation in coagulation and photochemistry parameters on the particle size distributions in the Venus clouds

NASA Astrophysics Data System (ADS)

McGouldrick, Kevin

2017-12-01

This paper explores the effects that variation in the coalescence efficiency of the Venus cloud particles can have on the structure of the Venus cloud. It is motivated by the acknowledgment of uncertainties in the measured parameters—and the assumptions made to account for them—that define our present knowledge of the particle characteristics. Specifically, we explore the consequence of allowing the coalescence efficiency of supercooled sulfuric acid in the upper clouds to tend to zero. This produces a cloud that occasionally exhibits an enhancement of small particles at altitude (similar to the upper hazes observed by Pioneer Venus and subsequently shown to be somewhat transient). This simulated cloud occasionally exhibits a rapid growth of particle size near cloud base, exhibiting characteristics similar to those seen in the controversial Mode 3 particles. These results demonstrate that a subset of the variations observed as near-infrared opacity variations in the lower and middle clouds of Venus can be explained by microphysical, in addition to dynamical, variations. Furthermore, the existence of a population of particles exhibiting less efficient coalescence efficiencies would support the likelihood of conditions suitable for charge exchange, hence lightning, in the Venus clouds. We recommend future laboratory studies on the coalescence properties of sulfuric acid under the range of conditions experienced in the Venus clouds. We also recommend future in situ measurements to better characterize the properties of the cloud particles themselves, especially composition and particle habits (shapes).[Figure not available: see fulltext.

The Impact of the Aerosol Direct Radiative Forcing on Deep Convection and Air Quality in the Pearl River Delta Region

NASA Astrophysics Data System (ADS)

Liu, Z.; Yim, Steve H. L.; Wang, C.; Lau, N. C.

2018-05-01

Literature has reported the remarkable aerosol impact on low-level cloud by direct radiative forcing (DRF). Impacts on middle-upper troposphere cloud are not yet fully understood, even though this knowledge is important for regions with a large spatial heterogeneity of emissions and aerosol concentration. We assess the aerosol DRF and its cloud response in June (with strong convection) in Pearl River Delta region for 2008-2012 at cloud-resolving scale using an air quality-climate coupled model. Aerosols suppress deep convection by increasing atmospheric stability leading to less evaporation from the ground. The relative humidity is reduced in middle-upper troposphere due to induced reduction in both evaporation from the ground and upward motion. The cloud reduction offsets 20% of the aerosol DRF. The weaker vertical mixing further increases surface aerosol concentration by up to 2.90 μg/m3. These findings indicate the aerosol DRF impact on deep convection and in turn regional air quality.

Cirrus cloud spectra and layers observed during the FIRE and GASP projects

NASA Technical Reports Server (NTRS)

Flatau, Piotr J.; Gultepe, I.; Nastrom, G.; Cotton, William R.; Heymsfield, A. J.

1990-01-01

A general characterization is developed for cirrus clouds in terms of their spectra, shapes, optical thicknesses, and radiative properties for use in numerical models. Data sets from the Global Atmospheric Sampling Project (GASP) of the upper troposphere and the First ISCCP Regional Experiment (FIRE) are combined and analyzed to study general traits of cirrus clouds. A definition is given for 2D turbulence, and the GASP and FIRE data sets are examined with respect to cirrus layers and entrainment and to dominant turbulent scales. The approach employs conditional sampling in cloudy and clear air, power-spectral analysis, and mixing-line-type diagrams. Evidence is given for a well mixed cloud deck and for the tendency of cirrus to be formed in multilayer structures. The results are of use in mesoscale and global circulation models which predict cirrus, in small-scale cirrus modeling, and in studying the role of gravity waves in the horizontal structure of upper tropospheric clouds.

Model of the vertical structure of the optical parameters of the Neptune atmosphere.

NASA Astrophysics Data System (ADS)

Morozhenko, A. V.

Analyzes the wavelength dependence of the geometric albedo of Neptune's disk and estimates some parameters of the planet's atmosphere by the method based on the determination of deviations of the vertical structure of the cloud layer from the homogeneity condition. The ratio between the methane and gas scale heights is found to be about 0.4. For the upper atmosphere, components of methane, aerosol, the mean geometric radius of particles, the turbulent mixing coefficient are determined. Two solutions were found for deeper atmospheric layers. The first one suggests a rather dense cloud; in the second solution the lower cloud layer is an extension of the upper aerosol layer.

Cloud layer thicknesses from a combination of surface and upper-air observations

NASA Technical Reports Server (NTRS)

Poore, Kirk D.; Wang, Junhong; Rossow, William B.

1995-01-01

Cloud layer thicknesses are derived from base and top altitudes by combining 14 years (1975-1988) of surface and upper-air observations at 63 sites in the Northern Hemisphere. Rawinsonde observations are employed to determine the locations of cloud-layer top and base by testing for dewpoint temperature depressions below some threshold value. Surface observations serve as quality checks on the rawinsonde-determined cloud properties and provide cloud amount and cloud-type information. The dataset provides layer-cloud amount, cloud type, high, middle, or low height classes, cloud-top heights, base heights and layer thicknesses, covering a range of latitudes from 0 deg to 80 deg N. All data comes from land sites: 34 are located in continental interiors, 14 are near coasts, and 15 are on islands. The uncertainties in the derived cloud properties are discussed. For clouds classified by low-, mid-, and high-top altitudes, there are strong latitudinal and seasonal variations in the layer thickness only for high clouds. High-cloud layer thickness increases with latitude and exhibits different seasonal variations in different latitude zones: in summer, high-cloud layer thickness is a maximum in the Tropics but a minimum at high latitudes. For clouds classified into three types by base altitude or into six standard morphological types, latitudinal and seasonal variations in layer thickness are very small. The thickness of the clear surface layer decreases with latitude and reaches a summer minimum in the Tropics and summer maximum at higher latitudes over land, but does not vary much over the ocean. Tropical clouds occur in three base-altitude groups and the layer thickness of each group increases linearly with top altitude. Extratropical clouds exhibit two groups, one with layer thickness proportional to their cloud-top altitude and one with small (less than or equal to 1000 m) layer thickness independent of cloud-top altitude.

The clouds are hazes of Venus

NASA Technical Reports Server (NTRS)

Esposito, L. W.; Knollenberg, R. G.; Marov, M. IA.; Toon, O. B.; Turco, R. P.

1983-01-01

Pioneer Venus and Venera probe data for the clouds of Venus are considered. These clouds consist of a main cloud deck at 45-70 km altitude, with thinner hazes above and below, although the microphysical properties of the main cloud are further subdivided into upper, middle and lower cloud levels. Much of the cloud exhibits a multimodal particle size distribution, with the mode most visible from the earth being H2SO4 droplets having 2-3 micron diameters. Despite variations, the vertical structure of the clouds indicates persistent features at sites separated by years and by great distances. The clouds are more strongly affected by radiation than by latent heat release, and the small particle size and weak convective activity observed are incompatible with lightning of cloud origin.

Aerosol Enhancements in the Upper Troposphere Over The Amazon Forest: Do Amazonian Clouds Produce Aerosols?

NASA Astrophysics Data System (ADS)

Andreae, M. O.; Afchine, A.; Albrecht, R. I.; Artaxo, P.; Borrmann, S.; Cecchini, M. A.; Costa, A.; Dollner, M.; Fütterer, D.; Järvinen, E.; Klimach, T.; Konemann, T.; Kraemer, M.; Krüger, M. L.; Machado, L.; Mertes, S.; Pöhlker, C.; Poeschl, U.; Sauer, D. N.; Schnaiter, M.; Schneider, J.; Schulz, C.; Spanu, A.; Walser, A.; Weinzierl, B.; Wendisch, M.

2015-12-01

The German-Brazilian cooperative aircraft campaign ACRIDICON-CHUVA (Aerosol, Cloud, Precipitation, and Radiation Interactions and Dynamics of Convective Cloud Systems) on the German research aircraft HALO took place over the Amazon Basin in September/October 2014, with the objective of studying tropical deep convective clouds over the Amazon rainforest and their interactions with trace gases, aerosol particles, and atmospheric radiation. The aircraft was equipped with about 30 remote sensing and in-situ instruments for meteorological, trace gas, aerosol, cloud, precipitation, and solar radiation measurements. Fourteen research flights were conducted during this campaign. Observations during ACRIDICON-CHUVA showed high aerosol concentrations in the upper troposphere (UT) over the Amazon Basin, with concentrations after normalization to standard conditions often exceeding those in the boundary layer (BL). This behavior was consistent between several aerosol metrics, including condensation nuclei (CN), cloud condensation nuclei (CCN), and chemical species mass concentrations. These UT aerosols were different in their composition and size distribution from the aerosol in the BL, making convective transport of particles unlikely as a source. The regions in the immediate outflow of deep convective clouds were found to be depleted in aerosol particles, whereas enhanced aerosol number and mass concentrations were found in UT regions that had experienced outflow from deep convection in the preceding 24-48 hours. This suggests that aerosol production takes place in the UT based on volatile and condensable material brought up by deep convection. Subsequently, downward mixing and transport of upper tropospheric aerosol may be a source of particles to the BL, where they increase in size by the condensation of biogenic volatile organic carbon (BVOC) oxidation products. This may be an important source of aerosol particles in the Amazonian BL, where aerosol nucleation and new particle formation has not been observed.

Gravitational waves from Scorpius X-1: A comparison of search methods and prospects for detection with advanced detectors

NASA Astrophysics Data System (ADS)

Messenger, C.; Bulten, H. J.; Crowder, S. G.; Dergachev, V.; Galloway, D. K.; Goetz, E.; Jonker, R. J. G.; Lasky, P. D.; Meadors, G. D.; Melatos, A.; Premachandra, S.; Riles, K.; Sammut, L.; Thrane, E. H.; Whelan, J. T.; Zhang, Y.

2015-07-01

The low-mass X-ray binary Scorpius X-1 (Sco X-1) is potentially the most luminous source of continuous gravitational-wave radiation for interferometers such as LIGO and Virgo. For low-mass X-ray binaries this radiation would be sustained by active accretion of matter from its binary companion. With the Advanced Detector Era fast approaching, work is underway to develop an array of robust tools for maximizing the science and detection potential of Sco X-1. We describe the plans and progress of a project designed to compare the numerous independent search algorithms currently available. We employ a mock-data challenge in which the search pipelines are tested for their relative proficiencies in parameter estimation, computational efficiency, robustness, and most importantly, search sensitivity. The mock-data challenge data contains an ensemble of 50 Scorpius X-1 (Sco X-1) type signals, simulated within a frequency band of 50-1500 Hz. Simulated detector noise was generated assuming the expected best strain sensitivity of Advanced LIGO [1] and Advanced VIRGO [2] (4 ×10-24 Hz-1 /2 ). A distribution of signal amplitudes was then chosen so as to allow a useful comparison of search methodologies. A factor of 2 in strain separates the quietest detected signal, at 6.8 ×10-26 strain, from the torque-balance limit at a spin frequency of 300 Hz, although this limit could range from 1.2 ×10-25 (25 Hz) to 2.2 ×10-26 (750 Hz) depending on the unknown frequency of Sco X-1. With future improvements to the search algorithms and using advanced detector data, our expectations for probing below the theoretical torque-balance strain limit are optimistic.

Metal residues, histopathology and presence of parasites in the liver and gills of fourhorn sculpin (Myoxocephalus quadricornis) and shorthorn sculpin (Myoxocephalus scorpius) near a former lead-zinc mine in East Greenland

DOE Office of Scientific and Technical Information (OSTI.GOV)

Dang, Mai

Fourhorn sculpins (Myoxocephalus quadricornis) and shorthorn sculpins (Myoxocephalus scorpius) have been considered suitable local bioindicators for environmental monitoring studies in the Arctic. Because these species share many characteristics, data from the two species have previously been pooled when assessing marine metal contamination. A chemical and histological study was conducted on fourhorn and shorthorn sculpins collected around a contaminated lead-zinc mine at East Greenland to investigate whether there were any differences in the residues of metals, histopathology and parasites in liver and gills between the two sculpin species. The results demonstrated that concentrations of copper (Cu), zinc (Zn), mercury (Hg) andmore » lead (Pb) were significantly higher in the fourhorn sculpins (p<0.001) while there were no significant differences for arsenic (As) or cadmium (Cd). Furthermore, density of blood vessel fibrosis (p=0.028), prevalence and density of chondroplasia (p=0.002 and p=0.005, respectively), number of mucin-containing mucous cells (p<0.001) and chloride cells (p<0.001) and mean intensity of colonial Peritricha (p<0.001) were significantly higher in fourhorn sculpin. Based on these results we suggest that pooling the two species when conducting environmental assessments is not recommended as it can lead to incorrect conclusions. We propose that a larger study investigating the biological effects of zinc-lead mining in Greenland is needed. - Highlights: • Fourhorn sculpins (Myoxocephalus quadricornis) more sensitive to pollution than shorthorn sculpins (Myoxocephalus scorpius). • Metal residues, histological changes and presence of parasites were species-specific. • Different sculpin species should not be pooled together as pollution biomarkers.« less

Tropical Convective Responses to Microphysical and Radiative Processes: A Sensitivity Study With a 2D Cloud Resolving Model

NASA Technical Reports Server (NTRS)

Li, Xiao-Fan; Sui, C.-H.; Lau, K.-M.; Tao, W.-K.

2004-01-01

Prognostic cloud schemes are increasingly used in weather and climate models in order to better treat cloud-radiation processes. Simplifications are often made in such schemes for computational efficiency, like the scheme being used in the National Centers for Environment Prediction models that excludes some microphysical processes and precipitation-radiation interaction. In this study, sensitivity tests with a 2D cloud resolving model are carried out to examine effects of the excluded microphysical processes and precipitation-radiation interaction on tropical thermodynamics and cloud properties. The model is integrated for 10 days with the imposed vertical velocity derived from the Tropical Ocean Global Atmosphere Coupled Ocean-Atmosphere Response Experiment. The experiment excluding the depositional growth of snow from cloud ice shows anomalous growth of cloud ice and more than 20% increase of fractional cloud cover, indicating that the lack of the depositional snow growth causes unrealistically large mixing ratio of cloud ice. The experiment excluding the precipitation-radiation interaction displays a significant cooling and drying bias. The analysis of heat and moisture budgets shows that the simulation without the interaction produces more stable upper troposphere and more unstable mid and lower troposphere than does the simulation with the interaction. Thus, the suppressed growth of ice clouds in upper troposphere and stronger radiative cooling in mid and lower troposphere are responsible for the cooling bias, and less evaporation of rain associated with the large-scale subsidence induces the drying in mid and lower troposphere.

An Analysis of Two Thunderstorms Producing Five Negative Sprites on 12 September 2014

NASA Astrophysics Data System (ADS)

Boggs, L.; Liu, N.; Splitt, M. E.; Lazarus, S. M.; Cummer, S. A.; Rassoul, H.

2015-12-01

We present a detailed analysis of the thunderstorms and the parent lightning discharge morphologies of five confirmed negative sprites taking place in two different thunderstorms. These two thunderstorms took place in east-central and south Florida on 12 September 2014. We utilized several lightning location networks, remote magnetic field measurements, dual polarization radar, and balloon borne soundings in our analysis. Each parent discharge was immediately preceded by intra-cloud (IC) discharges between the mid-level negative and upper positive charge regions. This either allowed a second upward negative leader to escape the upper positive charge region, or encouraged a downward negative leader to be initiated and connect with ground. The discharges found in this study support the findings of Lu et al., 2012 [JGR,117, D04212, 2012] that negative sprite-parent lightning consists primarily of hybrid intra-cloud negative cloud-to-ground (IC-NCG) and bolt-from-the-blue (BFB) lightning. Our work finds these unique discharges form in thunderstorms that have an excess of mid-level negative charge and weakened upper positive charge. Due to this charge structure, these unusual discharges transfer more charge to the ground than typical negative cloud-to-ground discharges. Our study suggests that the key difference separating bolt-from-the-blue and gigantic jet discharges is an asymmetric charge structure. This acts to bring the negative leader exiting the thundercloud closer to the lateral positive screening layer, encouraging the negative leader to turn towards ground. This investigation reveals IC discharges that involve multiple convective cells and come to ground as a negative CG discharge, a breed of hybrid IC-NCG discharges, also transfer more negative charge to ground than typical negative CG discharges and are able to initiate negative sprites. From this work, the charge structures mentioned above resulted from tall, intense convective cells with low CG flash rates with high wind shear in the mid to upper regions of the cloud. This acted to create a large reservoir of mid-level negative charge and create a general asymmetry to the charge structure. The wind shear in the upper regions also acted to weaken the upper positive charge by turbulent mixing with the upper negative screening charge layer.

Characteristics of middle and upper tropospheric clouds as deduced from rawinsonde data

NASA Technical Reports Server (NTRS)

Starr, D. D. O.; Cox, S. K.

1982-01-01

The static environment of middle and upper tropospheric clouds is characterized. Computed relative humidity with respect to ice is used to diagnose the presence of cloud layer. The deduced seasonal mean cloud cover estimates based on this technique are shown to be reasonable. The cases are stratified by season and pressure thickness, and the dry static stability, vertical wind speed shear, and Richardson number are computed for three layers for each case. Mean values for each parameter are presented for each stratification and layer. The relative frequency of occurrence of various structures is presented for each stratification. The observed values of each parameter and the observed structure of each parameter are quite variable. Structures corresponding to any of a number of different conceptual models may be found. Moist adiabatic conditions are not commonly observed and the stratification based on thickness yields substantially different results for each group.

Vertical structure of tropospheric winds on gas giants

NASA Astrophysics Data System (ADS)

Scott, R. K.; Dunkerton, T. J.

2017-04-01

Zonal mean zonal velocity profiles from cloud-tracking observations on Jupiter and Saturn are used to infer latitudinal variations of potential temperature consistent with a shear stable potential vorticity distribution. Immediately below the cloud tops, density stratification is weaker on the poleward and stronger on the equatorward flanks of midlatitude jets, while at greater depth the opposite relation holds. Thermal wind balance then yields the associated vertical shears of midlatitude jets in an altitude range bounded above by the cloud tops and bounded below by the level where the latitudinal gradient of static stability changes sign. The inferred vertical shear below the cloud tops is consistent with existing thermal profiling of the upper troposphere. The sense of the associated mean meridional circulation in the upper troposphere is discussed, and expected magnitudes are given based on existing estimates of the radiative timescale on each planet.

Revisiting the birth locations of pulsars B1929+10, B2020+28, and B2021+51

NASA Astrophysics Data System (ADS)

Kirsten, Franz; Vlemmings, Wouter; Campbell, Robert M.; Kramer, Michael; Chatterjee, Shami

2015-05-01

We present new proper motion and parallax measurements obtained with the European VLBI Network (EVN) at 5GHz for the three isolated pulsars B1929+10, B2020+28, and B2021+51. For B1929+10 we combined our data with earlier VLBI measurements and confirm the robustness of the astrometric parameters of this pulsar. For pulsars B2020+28 and B2021+51 our observations indicate that both stars are almost a factor of two closer to the solar system than previously thought, placing them at a distance of 1.39-0.06+0.05 and 1.25-0.17+ 0.14kpc. Using our new astrometry, we simulated the orbits of all three pulsars in the Galactic potential with the aim to confirm or reject previously proposed birth locations. Our observations ultimately rule out a claimed binary origin of B1929+10 and the runaway star ζ Ophiuchi in Upper Scorpius. A putative common binary origin of B2020+28 and B2021+51 in the Cygnus Superbubble is also very unlikely.

High-resolution soft X-ray spectra of Scorpius X-1 - The structure of circumsource accreting material

NASA Technical Reports Server (NTRS)

Kahn, S. M.; Seward, F. D.; Chlebowski, T.

1984-01-01

Four observations of Scorpius X-1 with the Objective Grating Spectrometer of the Einstein Observatory have provided high-resolution spectra (lambda/Delta lambda = approximately 20-50) in the wavelength range 7-46 A. The spectra reveal the presence of absorption structure due to oxygen, nitrogen, and iron, and variable emission structure associated with ionized iron and nitrogen. The strengths of these features suggest that the N/O abundance ratio in the absorbing and line emitting gas is anomalously high, which might indicate that these spectral components are associated with processed material, probably accreting matter transferred from the surface of an evolved companion. Constraints on the inclination of the system, however, imply that this cool, dense, accreting material must be well out of the plane of the binary system. Possible models for the origin and nature of this circumsource medium are discussed. An extensive discussion of the calibration of the Objective Grating Spectrometer and of the analysis of spectra acquired by that instrument is also provided.

Evaluating stratiform cloud base charge remotely

NASA Astrophysics Data System (ADS)

Harrison, R. Giles; Nicoll, Keri A.; Aplin, Karen L.

2017-06-01

Stratiform clouds acquire charge at their upper and lower horizontal boundaries due to vertical current flow in the global electric circuit. Cloud charge is expected to influence microphysical processes, but understanding is restricted by the infrequent in situ measurements available. For stratiform cloud bases below 1 km in altitude, the cloud base charge modifies the surface electric field beneath, allowing a new method of remote determination. Combining continuous cloud height data during 2015-2016 from a laser ceilometer with electric field mill data, cloud base charge is derived using a horizontal charged disk model. The median daily cloud base charge density found was -0.86 nC m-2 from 43 days' data. This is consistent with a uniformly charged region 40 m thick at the cloud base, now confirming that negative cloud base charge is a common feature of terrestrial layer clouds. This technique can also be applied to planetary atmospheres and volcanic plumes.