FAR-ULTRAVIOLET DUST ALBEDO MEASUREMENTS IN THE UPPER SCORPIUS CLOUD USING THE SPINR SOUNDING ROCKET EXPERIMENT

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lewis, N. K.; Cook, T. A.; Wilton, K. P.

2009-11-20

The Spectrograph for Photometric Imaging with Numeric Reconstruction sounding rocket experiment was launched on 2000 August 4 to record far-ultraviolet (912-1450 A) spectral and spatial information for the giant reflection nebula in the Upper Scorpius region. The data were divided into three arbitrary bandpasses (912-1029 A, 1030-1200 A, and 1235-1450 A) for which stellar and nebular flux levels were derived. These flux measurements were used to constrain a radiative transfer model and to determine the dust albedo for the Upper Scorpius region. The resulting albedos were 0.28 +- 0.07 for the 912-1029 A bandpass, 0.33 +- 0.07 for the 1030-1200more » A bandpass, and 0.77 +- 0.13 for the 1235-1450 A bandpass.« less

VizieR Online Data Catalog: The Sco-Cen Rotation Catalogue - SCRC (Mellon+ 2017)

NASA Astrophysics Data System (ADS)

Mellon, S. N.; Mamajek, E. E.; Oberst, T. E.; Pecaut, M. J.

2017-09-01

We report the results of a study of archival SuperWASP light curves for stars in Scorpius-Centaurus (Sco-Cen), the nearest OB association. We use SuperWASP time-series photometry to extract rotation periods for candidate members of the Sco-Cen complex. Our final sample contains 157 well-characterized pre-MS stars. (4 data files).

HD 101088, AN ACCRETING 14 AU BINARY IN LOWER CENTAURUS CRUX WITH VERY LITTLE CIRCUMSTELLAR DUST

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bitner, Martin A.; Chen, Christine H.; Muzerolle, James

2010-05-10

We present high-resolution (R = 55, 000) optical spectra obtained with MIKE on the 6.5 m Magellan Clay Telescope as well as Spitzer MIPS photometry and Infrared Spectrometer low-resolution (R {approx} 60) spectroscopy of the close (14 AU separation) binary, HD 101088, a member of the {approx}12 Myr old southern region of the Lower Centaurus Crux subgroup of the Scorpius-Centaurus OB association. We find that the primary and/or secondary is accreting from a tenuous circumprimary and/or circumsecondary disk despite the apparent lack of a massive circumbinary disk. We estimate a lower limit to the accretion rate of M-dot > 1x10{supmore » -9} M{sub sun} yr{sup -1}, which our multiple observation epochs show varies over a timescale of months. The upper limit on the 70 {mu}m flux allows us to place an upper limit on the mass of dust grains smaller than several microns present in a circumbinary disk of 0.16 M{sub moon}. We conclude that the classification of disks into either protoplanetary or debris disks based on fractional infrared luminosity alone may be misleading.« less

The Zodiacal Exoplanets in Time (ZEIT) Survey

NASA Astrophysics Data System (ADS)

Mann, Andrew; Gaidos, Eric; Newton, Elisabeth R.; Rizzuto, Aaron C.; Vanderburg, Andrew; Mace, Gregory N.; Kraus, Adam L.

2017-01-01

Planets and their host stars evolve with time, and the first few hundred million years are thought to be the most formative. However, the majority of known exoplanets orbit stars older than the timescales of interest (>1 Gyr). We have launched the Zodiacal Exoplanets in Time (ZEIT) survey with the goal of identifying and characterizing young (<1 Gyr) transiting planets. To this end, we have utilized high-precision photometry of nearby young clusters and stellar associations taken as part of the K2 mission. Thus far we have discovered transiting planets in the Hyades and Praesepe clusters (˜800 Myr), and the Upper Scorpius OB association (˜11 Myr), but interestingly none in the Pleiades (˜125 Myr). These discoveries can be used to set limits on the migration timescale, estimate atmosphere loss around young planets, and provide independent tests of pre-main sequence stellar models. Here I overview some key science results from our survey and briefly discuss our plans to identify more young planetary systems.

The optical + infrared L dwarf spectral sequence of young planetary-mass objects in the Upper Scorpius association

NASA Astrophysics Data System (ADS)

Lodieu, N.; Zapatero Osorio, M. R.; Béjar, V. J. S.; Peña Ramírez, K.

2018-01-01

We present the results of photometric and spectroscopic follow-ups of the lowest mass member candidates in the nearest OB association, Upper Scorpius (∼5-10 Myr; 145 ± 17 pc), with the Gran Telescopio de Canarias (GTC) and European Southern Observatory (ESO) Very Large Telescope (VLT). We confirm the membership of the large majority (>80 per cent) of candidates originally selected photometrically and astrometrically based on their spectroscopic features, weak equivalent widths of gravity-sensitive doublets and radial velocities. Confirmed members follow a sequence over a wide magnitude range (J = 17.0-19.3 mag) in several colour-magnitude diagrams with optical, near- and mid-infrared photometry and have near-infrared spectral types in the L1-L7 interval with likely masses below 15 Jupiter masses. We find that optical spectral types tend to be earlier than near-infrared spectral types by a few subclasses for spectral types later than M9. We investigate the behaviour of spectral indices, defined in the literature as a function of spectral type and gravity, by comparison with values reported in the literature for young and old dwarfs. We also derive effective temperatures in the 1900-1600 K range from fits of synthetic model-atmosphere spectra to the observed photometry, but we caution that the procedure carries large uncertainties. We determine bolometric corrections for young L dwarfs with ages of ∼5-10 Myr (Upper Sco association) and find them to be similar in the J band but larger by 0.1-0.4 mag in the K band with respect to field L dwarfs. Finally, we discover two faint young L dwarfs, Visible and Infrared Survey Telescope for Astronomy (VISTA) J1607-2146 (L4.5) and VISTA J1611-2215 (L5), that have Hα emission and possible flux excesses at 4.5 μm, pointing to the presence of accretion from a disc on to the central objects of mass below ∼15MJup at an age of 5-10 Myr.

Directed search for gravitational waves from Scorpius X-1 with initial LIGO data

NASA Astrophysics Data System (ADS)

Aasi, J.; Abbott, B. P.; Abbott, R.; Abbott, T.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Ain, A.; Ajith, P.; Alemic, A.; Allen, B.; Allocca, A.; Amariutei, D.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C.; Areeda, J. S.; Arnaud, N.; Ashton, G.; Ast, S.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Aylott, B. E.; Babak, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barbet, M.; Barclay, S.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Bartlett, J.; Barton, M. A.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Bauer, Th. S.; Baune, C.; Bavigadda, V.; Behnke, B.; Bejger, M.; Belczynski, C.; Bell, A. S.; Bell, C.; Benacquista, M.; Bergman, J.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, J.; Biscans, S.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackburn, L.; Blair, C. D.; Blair, D.; Bloemen, S.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, G.; Bojtos, P.; Bond, C.; Bondu, F.; Bonelli, L.; Bonnand, R.; Bork, R.; Born, M.; Boschi, V.; Bose, Sukanta; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Bridges, D. O.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Buchman, S.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Cadonati, L.; Cagnoli, G.; Calderón Bustillo, J.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chen, Y.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, S.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C.; Colombini, M.; Cominsky, L.; Constancio, M.; Conte, A.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Costa, C. A.; Coughlin, M. W.; Coulon, J.-P.; Countryman, S.; Couvares, P.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, L.; Cuoco, E.; Cutler, C.; Dahl, K.; Canton, T. Dal; Damjanic, M.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dartez, L.; Dattilo, V.; Dave, I.; Daveloza, H.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; DeBra, D.; Debreczeni, G.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Dhurandhar, S.; Díaz, M.; Di Fiore, L.; Di Lieto, A.; Di Palma, I.; Di Virgilio, A.; Dojcinoski, G.; Dolique, V.; Dominguez, E.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S.; Eberle, T.; Edo, T.; Edwards, M.; Edwards, M.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Essick, R.; Etzel, T.; Evans, M.; Evans, T.; Factourovich, M.; Fafone, V.; Fairhurst, S.; Fan, X.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Feldbaum, D.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fisher, R. P.; Flaminio, R.; Fournier, J.-D.; Franco, S.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fuentes-Tapia, S.; Fulda, P.; Fyffe, M.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S.; Garufi, F.; Gatto, A.; Gehrels, N.; Gemme, G.; Gendre, B.; Genin, E.; Gennai, A.; Gergely, L. Á.; Germain, V.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gleason, J.; Goetz, E.; Goetz, R.; Gondan, L.; González, G.; Gordon, N.; Gorodetsky, M. L.; Gossan, S.; Goßler, S.; Gouaty, R.; Gräf, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greenhalgh, R. J. S.; Gretarsson, A. M.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guido, C. J.; Guo, X.; Gushwa, K.; Gustafson, E. K.; Gustafson, R.; Hacker, J.; Hall, E. D.; Hammond, G.; Hanke, M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M.; Hartman, M. T.; Haster, C.-J.; Haughian, K.; Heidmann, A.; Heintze, M.; Heinzel, G.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Heptonstall, A. W.; Heurs, M.; Hewitson, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Hofman, D.; Hollitt, S. E.; Holt, K.; Hopkins, P.; Hosken, D. J.; Hough, J.; Houston, E.; Howell, E. J.; Hu, Y. M.; Huerta, E.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh, M.; Huynh-Dinh, T.; Idrisy, A.; Indik, N.; Ingram, D. R.; Inta, R.; Islas, G.; Isler, J. C.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacobson, M.; Jang, H.; Jaranowski, P.; Jawahar, S.; Ji, Y.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Haris, K.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, H.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kawazoe, F.; Kéfélian, F.; Keiser, G. M.; Keitel, D.; Kelley, D. B.; Kells, W.; Keppel, D. G.; Key, J. S.; Khalaidovski, A.; Khalili, F. Y.; Khazanov, E. A.; Kim, C.; Kim, K.; Kim, N. G.; Kim, N.; Kim, Y.-M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Klimenko, S.; Kline, J.; Koehlenbeck, S.; Kokeyama, K.; Kondrashov, V.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringel, V.; Krishnan, B.; Królak, A.; Krueger, C.; Kuehn, G.; Kumar, A.; Kumar, P.; Kuo, L.; Kutynia, A.; Landry, M.; Lantz, B.; Larson, S.; Lasky, P. D.; Lazzarini, A.; Lazzaro, C.; Lazzaro, C.; Le, J.; Leaci, P.; Leavey, S.; Lebigot, E.; Lebigot, E. O.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B.; Lewis, J.; Li, T. G. F.; Libbrecht, K.; Libson, A.; Lin, A. C.; Littenberg, T. B.; Lockerbie, N. A.; Lockett, V.; Logue, J.; Lombardi, A. L.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J.; Lubinski, M. J.; Lück, H.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macarthur, J.; MacDonald, T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña-Sandoval, F.; Magee, R.; Mageswaran, M.; Maglione, C.; Mailand, K.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandel, I.; Mandic, V.; Mangano, V.; Mangano, V.; Mansell, G. L.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R. M.; Martynov, D.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McLin, K.; McWilliams, S.; Meacher, D.; Meadors, G. D.; Meidam, J.; Meinders, M.; Melatos, A.; Mendell, G.; Mercer, R. A.; Meshkov, S.; Messenger, C.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moe, B.; Moggi, A.; Mohan, M.; Mohanty, S. D.; Mohapatra, S. R. P.; Moore, B.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Mukherjee, S.; Mullavey, A.; Munch, J.; Murphy, D.; Murray, P. G.; Mytidis, A.; Nagy, M. F.; Nardecchia, I.; Nash, T.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nedkova, K.; Nelemans, G.; Neri, I.; Neri, M.; Newton, G.; Nguyen, T.; Nielsen, A. B.; Nissanke, S.; Nitz, A. H.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oppermann, P.; Oram, R.; O'Reilly, B.; Ortega, W.; O'Shaughnessy, R.; Osthelder, C.; Ott, C. D.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Padilla, C.; Pai, A.; Pai, S.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Papa, M. A.; Paris, H.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patrick, Z.; Pedraza, M.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Phelps, M.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poeld, J.; Poggiani, R.; Post, A.; Poteomkin, A.; Powell, J.; Prasad, J.; Predoi, V.; Premachandra, S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qin, J.; Quetschke, V.; Quintero, E.; Quiroga, G.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Rácz, I.; Radkins, H.; Raffai, P.; Raja, S.; Rajalakshmi, G.; Rakhmanov, M.; Ramirez, K.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Reula, O.; Ricci, F.; Riles, K.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V.; Romano, R.; Romanov, G.; Romie, J. H.; Rosińska, D.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Saleem, M.; Salemi, F.; Sammut, L.; Sandberg, V.; Sanders, J. R.; Sannibale, V.; Santiago-Prieto, I.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Savage, R.; Sawadsky, A.; Scheuer, J.; Schilling, R.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schreiber, E.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Serna, G.; Sevigny, A.; Shaddock, D. A.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shao, Z.; Shapiro, B.; Shawhan, P.; Shoemaker, D. H.; Sidery, T. L.; Siellez, K.; Siemens, X.; Sigg, D.; Silva, A. D.; Simakov, D.; Singer, A.; Singer, L.; Singh, R.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, J. R.; Smith, M. R.; Smith, R. J. E.; Smith-Lefebvre, N. D.; Son, E. J.; Sorazu, B.; Souradeep, T.; Staley, A.; Stebbins, J.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Steplewski, S.; Stevenson, S.; Stone, R.; Strain, K. A.; Straniero, N.; Strigin, S.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sutton, P. J.; Swinkels, B.; Szczepanczyk, M.; Szeifert, G.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, R.; Tellez, G.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, V.; Tomlinson, C.; Tonelli, M.; Torres, C. V.; Torrie, C. I.; Travasso, F.; Traylor, G.; Tse, M.; Tshilumba, D.; Turconi, M.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; van den Broeck, C.; van der Sluys, M. V.; van Heijningen, J.; van Veggel, A. A.; Vass, S.; Vasúth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Viceré, A.; Vincent-Finley, R.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L.; Wade, M.; Walker, M.; Wallace, L.; Walsh, S.; Wang, H.; Wang, M.; Wang, X.; Ward, R. L.; Warner, J.; Was, M.; Was, M.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Wilkinson, C.; Williams, L.; Williams, R.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Worden, J.; Xie, S.; Yablon, J.; Yakushin, I.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yang, Q.; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zendri, J.-P.; Zhang, Fan; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhu, X. J.; Zucker, M. E.; Zuraw, S.; Zweizig, J.; LIGO Scientific Collaboration, Virgo Collaboration

2015-03-01

We present results of a search for continuously emitted gravitational radiation, directed at the brightest low-mass x-ray binary, Scorpius X-1. Our semicoherent analysis covers 10 days of LIGO S5 data ranging from 50-550 Hz, and performs an incoherent sum of coherent F -statistic power distributed amongst frequency-modulated orbital sidebands. All candidates not removed at the veto stage were found to be consistent with noise at a 1% false alarm rate. We present Bayesian 95% confidence upper limits on gravitational-wave strain amplitude using two different prior distributions: a standard one, with no a priori assumptions about the orientation of Scorpius X-1; and an angle-restricted one, using a prior derived from electromagnetic observations. Median strain upper limits of 1.3 ×10-24 and 8 ×10-25 are reported at 150 Hz for the standard and angle-restricted searches respectively. This proof-of-principle analysis was limited to a short observation time by unknown effects of accretion on the intrinsic spin frequency of the neutron star, but improves upon previous upper limits by factors of ˜1.4 for the standard, and 2.3 for the angle-restricted search at the sensitive region of the detector.

Large-Scale CO Maps of the Lupus Molecular Cloud Complex

NASA Astrophysics Data System (ADS)

Tothill, N. F. H.; Löhr, A.; Parshley, S. C.; Stark, A. A.; Lane, A. P.; Harnett, J. I.; Wright, G. A.; Walker, C. K.; Bourke, T. L.; Myers, P. C.

2009-11-01

Fully sampled degree-scale maps of the 13CO 2-1 and CO 4-3 transitions toward three members of the Lupus Molecular Cloud Complex—Lupus I, III, and IV—trace the column density and temperature of the molecular gas. Comparison with IR extinction maps from the c2d project requires most of the gas to have a temperature of 8-10 K. Estimates of the cloud mass from 13CO emission are roughly consistent with most previous estimates, while the line widths are higher, around 2 km s-1. CO 4-3 emission is found throughout Lupus I, indicating widespread dense gas, and toward Lupus III and IV. Enhanced line widths at the NW end and along the edge of the B 228 ridge in Lupus I, and a coherent velocity gradient across the ridge, are consistent with interaction between the molecular cloud and an expanding H I shell from the Upper-Scorpius subgroup of the Sco-Cen OB Association. Lupus III is dominated by the effects of two HAe/Be stars, and shows no sign of external influence. Slightly warmer gas around the core of Lupus IV and a low line width suggest heating by the Upper-Centaurus-Lupus subgroup of Sco-Cen, without the effects of an H I shell.

A DYNAMICAL STUDY OF SUSPECTED RUNAWAY STARS AS TRACES OF PAST SUPERNOVA EXPLOSIONS IN THE REGION OF THE SCORPIUS-CENTAURUS OB ASSOCIATION

DOE Office of Scientific and Technical Information (OSTI.GOV)

Jilinski, E.; Ortega, V. G.; Drake, N. A.

2010-09-20

We address the question of identifying possible past supernovae events taking place in the region of the Scorpius-Centaurus (Sco-Cen) OB association based on stars proposed by Hoogerwerf et al. With this purpose, we obtained a time series of high-resolution spectra of six stars (HIP 42038, HIP 46950, HIP 48943, HIP 69491, HIP 76013, and HIP 82868) which, according to Hoogerwerf et al., may have been runaway stars with origins in the region of the Sco-Cen association. This also includes the nearby young open clusters IC 2391 and IC 2602. If confirmed, such supernovae events could, in principle, have played amore » role in triggering the formation of some small stellar groups thought to be associated with the Sco-Cen association. Our analysis shows that, except for HIP 48943, the remaining stars are spectroscopic binary systems. For HIP 46950 and HIP 69491, this was already noted by other authors. Our high-resolution spectra allowed us to obtain the radial velocities for all the stars which, combined with their proper motions and parallaxes from Hipparcos, provide a means to investigate, by retracing their orbits, if the Sco-Cen region was, in fact, the origin of these stars. We find that none of these systems originated in the Sco-Cen region. Exploring the possibility that the birthplace of the studied stars occurred in the clusters IC 2391 and IC 2602, we noticed that at the epoch of 2-3 Myr ago these clusters were at a distance comparable with their tidal radii.« less

LARGE-SCALE CO MAPS OF THE LUPUS MOLECULAR CLOUD COMPLEX

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tothill, N. F. H.; Loehr, A.; Stark, A. A.

2009-11-01

Fully sampled degree-scale maps of the {sup 13}CO 2-1 and CO 4-3 transitions toward three members of the Lupus Molecular Cloud Complex-Lupus I, III, and IV-trace the column density and temperature of the molecular gas. Comparison with IR extinction maps from the c2d project requires most of the gas to have a temperature of 8-10 K. Estimates of the cloud mass from {sup 13}CO emission are roughly consistent with most previous estimates, while the line widths are higher, around 2 km s{sup -1}. CO 4-3 emission is found throughout Lupus I, indicating widespread dense gas, and toward Lupus III andmore » IV. Enhanced line widths at the NW end and along the edge of the B 228 ridge in Lupus I, and a coherent velocity gradient across the ridge, are consistent with interaction between the molecular cloud and an expanding H I shell from the Upper-Scorpius subgroup of the Sco-Cen OB Association. Lupus III is dominated by the effects of two HAe/Be stars, and shows no sign of external influence. Slightly warmer gas around the core of Lupus IV and a low line width suggest heating by the Upper-Centaurus-Lupus subgroup of Sco-Cen, without the effects of an H I shell.« less

Three-dimensional structure of the Upper Scorpius association with the Gaia first data release

NASA Astrophysics Data System (ADS)

Galli, Phillip A. B.; Joncour, Isabelle; Moraux, Estelle

2018-06-01

Using new proper motion data from recently published catalogues, we revisit the membership of previously identified members of the Upper Scorpius association. We confirmed 750 of them as cluster members based on the convergent point method, compute their kinematic parallaxes, and combined them with Gaia parallaxes to investigate the 3D structure and geometry of the association using a robust covariance method. We find a mean distance of 146 ± 3 ± 6 pc and show that the morphology of the association defined by the brightest (and most massive) stars yields a prolate ellipsoid with dimensions of 74 × 38 × 32 pc3, while the faintest cluster members define a more elongated structure with dimensions of 98 × 24 × 18 pc3. We suggest that the different properties of both populations are an imprint of the star formation history in this region.

NEW MEMBERS OF THE SCORPIUS-CENTAURUS COMPLEX AND AGES OF ITS SUB-REGIONS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Song, Inseok; Zuckerman, B.; Bessell, M. S.

2012-07-15

We have spectroscopically identified {approx}100 G-, K-, and M-type members of the Scorpius-Centaurus complex. To deduce the age of these young stars we compare their Li {lambda}6708 absorption line strengths against those of stars in the TW Hydrae association and {beta} Pictoris moving group. These line strengths indicate that Sco-Cen stars are younger than {beta} Pic stars whose ages of {approx}12 Myr have previously been derived from a kinematic traceback analysis. Our derived age, {approx}10 Myr, for stars in the Lower Centaurus Crux and Upper Centaurus Lupus subgroups of ScoCen is younger than previously published ages based on the movingmore » cluster method and upper main-sequence fitting. The discrepant ages are likely due to an incorrect (or lack of) cross-calibration between model-dependent and model-independent age-dating methods.« less

Very Low-mass Stars and Brown Dwarfs in Upper Scorpius Using Gaia DR1: Mass Function, Disks, and Kinematics

NASA Astrophysics Data System (ADS)

Cook, Neil J.; Scholz, Aleks; Jayawardhana, Ray

2017-12-01

Our understanding of the brown dwarf population in star-forming regions is dependent on knowing distances and proper motions and therefore will be improved through the Gaia space mission. In this paper, we select new samples of very low-mass objects (VLMOs) in Upper Scorpius using UKIDSS colors and optimized proper motions calculated using Gaia DR1. The scatter in proper motions from VLMOs in Upper Scorpius is now (for the first time) dominated by the kinematic spread of the region itself, not by the positional uncertainties. With age and mass estimates updated using Gaia parallaxes for early-type stars in the same region, we determine masses for all VLMOs. Our final most complete sample includes 453 VLMOs of which ˜125 are expected to be brown dwarfs. The cleanest sample is comprised of 131 VLMOs, with ˜105 brown dwarfs. We also compile a joint sample from the literature that includes 415 VLMOs, out of which 152 are likely brown dwarfs. The disk fraction among low-mass brown dwarfs (M< 0.05 {M}⊙ ) is substantially higher than in more massive objects, indicating that disks around low-mass brown dwarfs survive longer than in low-mass stars overall. The mass function for 0.01< M< 0.1 {M}⊙ is consistent with the Kroupa Initial Mass Function. We investigate the possibility that some “proper motion outliers” have undergone a dynamical ejection early in their evolution. Our analysis shows that the color-magnitude cuts used when selecting samples introduce strong bias into the population statistics due to varying levels of contamination and completeness.

ROTATION PERIODS OF YOUNG BROWN DWARFS: K2 SURVEY IN UPPER SCORPIUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Scholz, Alexander; Kostov, Veselin; Jayawardhana, Ray

2015-08-20

We report rotational periods for 16 young brown dwarfs in the nearby Upper Scorpius association, based on 72 days of high-cadence, high-precision photometry from the Keplerspace telescope’s K2 mission. The periods range from a few hours to two days (plus one outlier at five days), with a median just above one day, confirming that brown dwarfs, except at the very youngest ages, are fast rotators. Interestingly, four of the slowest rotators in our sample exhibit mid-infrared excess emission from disks; at least two also show signs of disk eclipses and accretion in the light curves. Comparing these new periods withmore » those for two other young clusters and simple angular momentum evolution tracks, we find little or no rotational braking in brown dwarfs between 1–10 Myr, in contrast to low-mass stars. Our findings show that disk braking, while still at work, is inefficient in the substellar regime, thus providing an important constraint on the mass dependence of the braking mechanism.« less

LITHIUM IN THE UPPER CENTAURUS LUPUS AND LOWER CENTAURUS CRUX SUBGROUPS OF SCORPIUS-CENTAURUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bubar, Eric J.; Schaeuble, Marc; King, Jeremy R.

2011-12-15

We utilize spectroscopically derived model atmosphere parameters and the Li I {lambda}6104 subordinate line and the {lambda}6708 doublet to derive lithium abundances for 12 members of the Upper Centaurus Lupus and Lower Centaurus Crux subgroups of the Scorpius-Centaurus OB Association. The results indicate any intrinsic Li scatter in our 0.9-1.4 M{sub Sun} stars is limited to {approx}0.15 dex, consistent with the lack of dispersion in {>=}1.0 M{sub Sun} stars in the 100 Myr Pleiades and 30-50 Myr IC 2391 and 2602 clusters. Both ab initio uncertainty estimates and the derived abundances themselves indicate that the {lambda}6104 line yields abundances withmore » equivalent or less scatter than is found from the {lambda}6708 doublet as a result of lower uncertainties for the subordinate feature, a result of low sensitivity to broadening in the subordinate feature. Because non-local thermodynamic equilibrium (NLTE) corrections are less susceptible to changes in surface gravity and/or metallicity for the 6104 A line, the subordinate Li feature is preferred for deriving lithium abundances in young Li-rich stellar association stars with T{sub eff} {>=} 5200 K. At these temperatures, we find no difference between the Li abundances derived from the two Li I lines. For cooler stars, having temperatures at which main-sequence dwarfs show abundance patterns indicating overexcitation and overionization, the {lambda}6104-based Li abundances are {approx}0.4 dex lower than those derived from the {lambda}6708 doublet. The trends of the abundances from each feature with T{sub eff} suggest that this difference is due to (near)UV photoionization, which in NLTE preferentially ionizes Li atoms in the subordinate 2p state relative to the 2s resonance line state due to opacity effects. Consequently, this overionization of Li in the 2p state, apparently not adequately accounted for in NLTE corrections, weakens the {lambda}6104 feature in cooler stars. Accordingly, the {lambda}6708-based abundances may give more reliable estimates of the mean Li abundance in cool young stars. Our mean Li abundance, log N(Li) =3.50 {+-} 0.07 is {approx}0.2 dex larger than the meteoritic value. While stellar models suggest that Li depletion of at least 0.4 dex, and possibly much larger, should have occurred in our lowest mass star(s), our Li abundances show no decline with decreasing mass indicative of such depletion.« less

Search for gravitational waves from Scorpius X-1 in the first Advanced LIGO observing run with a hidden Markov model

NASA Astrophysics Data System (ADS)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allen, G.; Allocca, A.; Almoubayyed, H.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Etienne, Z. B.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Essick, R. C.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y.-F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Weßels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; Suvorova, S.; Moran, W.; Evans, R. J.; LIGO Scientific Collaboration; Virgo Collaboration

2017-06-01

Results are presented from a semicoherent search for continuous gravitational waves from the brightest low-mass X-ray binary, Scorpius X-1, using data collected during the first Advanced LIGO observing run. The search combines a frequency domain matched filter (Bessel-weighted F -statistic) with a hidden Markov model to track wandering of the neutron star spin frequency. No evidence of gravitational waves is found in the frequency range 60-650 Hz. Frequentist 95% confidence strain upper limits, h095 %=4.0 ×1 0-25, 8.3 ×1 0-25, and 3.0 ×1 0-25 for electromagnetically restricted source orientation, unknown polarization, and circular polarization, respectively, are reported at 106 Hz. They are ≤10 times higher than the theoretical torque-balance limit at 106 Hz.

A new compact young moving group around V1062 Scorpii

NASA Astrophysics Data System (ADS)

Röser, Siegfried; Schilbach, Elena; Goldman, Bertrand; Henning, Thomas; Moor, Attila; Derekas, Aliz

2018-06-01

Aims: We are searching for new open clusters or moving groups in the solar neighbourhood. Methods: We used the Gaia-TGAS catalogue, cut it into narrow proper motion and parallax slices and searched for significant spatial over-densities of stars in each slice. We then examined stars forming over-densities in optical and near-infrared colour-magnitude diagrams to determine if they are compatible with isochrones of a cluster. Results: We detected a hitherto unknown moving group or cluster in the Upper Centaurus Lupus (UCL) section of the Scorpius-Centaurus OB association (Sco-Cen) at a distance of 175 pc from the Sun. It is a group of 63 comoving stars of less than 10 to about 25 Myr in age. For the brightest stars that are present in the Gaia-TGAS catalogue, the mean difference between kinematic and trigonometric distance moduli is - 0.01 mag with a standard deviation of 0.11 mag. Fainter cluster candidates are found in the HSOY catalogue, where no trigonometric parallaxes are available. For a subset of our candidate stars, we obtained radial velocity measurements at the MPG/ESO 2.2 m telescope in La Silla. Altogether we found 12 members with confirmed radial velocities and parallaxes, 31 with parallaxes or radial velocities, and 20 candidates from the convergent point method. The isochrone masses of our 63 members range from 2.6 to 0.7 M⊙.

A Transient Transit Signature Associated with the Young Star RIK-210

DOE Office of Scientific and Technical Information (OSTI.GOV)

David, Trevor J.; Hillenbrand, Lynne A.; Howard, Andrew W.

We find transient transit-like dimming events within the K2 time series photometry of the young star RIK-210 in the Upper Scorpius OB association. These dimming events are variable in depth, duration, and morphology. High spatial resolution imaging revealed that the star is single and radial velocity monitoring indicated that the dimming events cannot be due to an eclipsing stellar or brown dwarf companion. Archival and follow-up photometry suggest the dimming events are transient in nature. The variable morphology of the dimming events suggests they are not due to a single spherical body. The ingress of each dimming event is alwaysmore » shallower than egress, as one would expect for an orbiting body with a leading tail. The dimming events are periodic and synchronous with the stellar rotation. However, we argue it is unlikely the dimming events could be attributed to anything on the stellar surface based on the observed depths and durations. Variable obscuration by a protoplanetary disk is unlikely on the basis that the star is not actively accreting and lacks the infrared excess associated with an inner disk. Rather, we explore the possibilities that the dimming events are due to magnetospheric clouds, a transiting protoplanet surrounded by circumplanetary dust and debris, eccentric orbiting bodies undergoing periodic tidal disruption, or an extended field of dust or debris near the corotation radius.« less

Searches for continuous gravitational waves from Scorpius X-1 and XTE J1751-305 in LIGO's sixth science run

NASA Astrophysics Data System (ADS)

Meadors, G. D.; Goetz, E.; Riles, K.; Creighton, T.; Robinet, F.

2017-02-01

Scorpius X-1 (Sco X-1) and x-ray transient XTE J1751-305 are low-mass x-ray binaries (LMXBs) that may emit continuous gravitational waves detectable in the band of ground-based interferometric observatories. Neutron stars in LMXBs could reach a torque-balance steady-state equilibrium in which angular momentum addition from infalling matter from the binary companion is balanced by angular momentum loss, conceivably due to gravitational-wave emission. Torque balance predicts a scale for detectable gravitational-wave strain based on observed x-ray flux. This paper describes a search for Sco X-1 and XTE J1751-305 in LIGO science run 6 data using the TwoSpect algorithm, based on searching for orbital modulations in the frequency domain. While no detections are claimed, upper limits on continuous gravitational-wave emission from Sco X-1 are obtained, spanning gravitational-wave frequencies from 40 to 2040 Hz and projected semimajor axes from 0.90 to 1.98 light-seconds. These upper limits are injection validated, equal any previous set in initial LIGO data, and extend over a broader parameter range. At optimal strain sensitivity, achieved at 165 Hz, the 95% confidence level random-polarization upper limit on dimensionless strain h0 is approximately 1.8 ×10-24. The closest approach to the torque-balance limit, within a factor of 27, is also at 165 Hz. Upper limits are set in particular narrow frequency bands of interest for J1751-305. These are the first upper limits known to date on r -mode emission from this XTE source. The TwoSpect method will be used in upcoming searches of Advanced LIGO and Virgo data.

Upper Limits on Gravitational Waves from Scorpius X-1 from a Model-based Cross-correlation Search in Advanced LIGO Data

NASA Astrophysics Data System (ADS)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Chatziioannou, K.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M., Jr.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Galloway, D. K.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lousto, C. O.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y.-F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration; Steeghs, D.; Wang, L.

2017-09-01

We present the results of a semicoherent search for continuous gravitational waves from the low-mass X-ray binary Scorpius X-1, using data from the first Advanced LIGO observing run. The search method uses details of the modeled, parametrized continuous signal to combine coherently data separated by less than a specified coherence time, which can be adjusted to trade off sensitivity against computational cost. A search was conducted over the frequency range 25-2000 {Hz}, spanning the current observationally constrained range of binary orbital parameters. No significant detection candidates were found, and frequency-dependent upper limits were set using a combination of sensitivity estimates and simulated signal injections. The most stringent upper limit was set at 175 {Hz}, with comparable limits set across the most sensitive frequency range from 100 to 200 {Hz}. At this frequency, the 95% upper limit on the signal amplitude h 0 is 2.3× {10}-25 marginalized over the unknown inclination angle of the neutron star’s spin, and 8.0× {10}-26 assuming the best orientation (which results in circularly polarized gravitational waves). These limits are a factor of 3-4 stronger than those set by other analyses of the same data, and a factor of ˜7 stronger than the best upper limits set using data from Initial LIGO science runs. In the vicinity of 100 {Hz}, the limits are a factor of between 1.2 and 3.5 above the predictions of the torque balance model, depending on the inclination angle; if the most likely inclination angle of 44° is assumed, they are within a factor of 1.7.

Squeezed between shells? The origin of the Lupus I molecular cloud. II. APEX CO and GASS H I observations

NASA Astrophysics Data System (ADS)

Gaczkowski, B.; Roccatagliata, V.; Flaischlen, S.; Kröll, D.; Krause, M. G. H.; Burkert, A.; Diehl, R.; Fierlinger, K.; Ngoumou, J.; Preibisch, T.

2017-12-01

Context. Lupus I cloud is found between the Upper Scorpius (USco) and Upper Centaurus-Lupus (UCL) subgroups of the Scorpius-Centaurus OB association, where the expanding USco H I shell appears to interact with a bubble currently driven by the winds of the remaining B stars of UCL. Aims: We investigate whether the Lupus I molecular could have formed in a colliding flow, and in particular, how the kinematics of the cloud might have been influenced by the larger scale gas dynamics. Methods: We performed APEX 13CO(2-1)and C18O(2-1) line observations of three distinct parts of Lupus I that provide kinematic information on the cloud at high angular and spectral resolution. We compare those results to the atomic hydrogen data from the GASS H I survey and our dust emission results presented in the previous paper. Based on the velocity information, we present a geometric model for the interaction zone between the USco shell and the UCL wind bubble. Results: We present evidence that the molecular gas of Lupus Iis tightly linked to the atomic material of the USco shell. The CO emission in Lupus Iis found mainly at velocities between vLSR = 3-6 km s-1, which is in the same range as the H I velocities. Thus, the molecular cloud is co-moving with the expanding USco atomic H I shell. The gas in the cloud shows a complex kinematic structure with several line-of-sight components that overlay each other. The nonthermal velocity dispersion is in the transonic regime in all parts of the cloud and could be injected by external compression. Our observations and the derived geometric model agree with a scenario in which Lupus Iis located in the interaction zone between the USco shell and the UCL wind bubble. Conclusions: The kinematics observations are consistent with a scenario in which the Lupus Icloud formed via shell instabilities. The particular location of Lupus I between USco and UCL suggests that counterpressure from the UCL wind bubble and pre-existing density enhancements, perhaps left over from the gas stream that formed the stellar subgroups, may have played a role in its formation. This publication is based on data acquired with the Atacama Pathfinder Experiment (APEX), which is a collaboration between the Max-Planck-Institut fur Radioastronomie, the European Southern Observatory, and the Onsala Space Observatory.The 13CO(2-1) and C18O(2-1) spectral cubes are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/608/A102

Identification of young stellar variables with KELT for K2 - II. The Upper Scorpius association

NASA Astrophysics Data System (ADS)

Ansdell, Megan; Oelkers, Ryan J.; Rodriguez, Joseph E.; Gaidos, Eric; Somers, Garrett; Mamajek, Eric; Cargile, Phillip A.; Stassun, Keivan G.; Pepper, Joshua; Stevens, Daniel J.; Beatty, Thomas G.; Siverd, Robert J.; Lund, Michael B.; Kuhn, Rudolf B.; James, David; Gaudi, B. Scott

2018-01-01

High-precision photometry from space-based missions such as K2 and Transiting Exoplanet Survey Satellite enables detailed studies of young star variability. However, because space-based observing campaigns are often short (e.g. 80 d for K2), complementary long-baseline photometric surveys are critical for obtaining a complete understanding of young star variability, which can change on time-scales of minutes to years. We therefore present and analyse light curves of members of the Upper Scorpius association made over 5.5 yr by the ground-based Kilodegree Extremely Little Telescope (KELT), which complement the high-precision observations of this region taken by K2 during its Campaigns 2 and 15. We show that KELT data accurately identify the periodic signals found with high-precision K2 photometry, demonstrating the power of ground-based surveys in deriving stellar rotation periods of young stars. We also use KELT data to identify sources exhibiting variability that is likely related to circumstellar material and/or stellar activity cycles; these signatures are often unseen in the short-term K2 data, illustrating the importance of long-term monitoring surveys for studying the full range of young star variability. We provide the KELT light curves as electronic tables in an ongoing effort to establish legacy time series data sets for young stellar clusters.

Squeezed between shells? The origin of the Lupus I molecular cloud. APEX/LABOCA, Herschel, and Planck observations

NASA Astrophysics Data System (ADS)

Gaczkowski, B.; Preibisch, T.; Stanke, T.; Krause, M. G. H.; Burkert, A.; Diehl, R.; Fierlinger, K.; Kroell, D.; Ngoumou, J.; Roccatagliata, V.

2015-12-01

Context. The Lupus I cloud is found between the Upper Scorpius (USco) and the Upper Centaurus-Lupus (UCL) subgroups of the Scorpius-Centaurus OB association, where the expanding USco H I shell appears to interact with a bubble currently driven by the winds of the remaining B-stars of UCL. Aims: We want to study how collisions of large-scale interstellar gas flows form and influence new dense clouds in the ISM. Methods: We performed LABOCA continuum sub-mm observations of Lupus I that provide for the first time a direct view of the densest, coldest cloud clumps and cores at high angular resolution. We complemented these data with Herschel and Planck data from which we constructed column density and temperature maps. From the Herschel and LABOCA column density maps we calculated probability density functions (PDFs) to characterize the density structure of the cloud. Results: The northern part of Lupus I is found to have, on average, lower densities, higher temperatures, and no active star formation. The center-south part harbors dozens of pre-stellar cores where density and temperature reach their maximum and minimum, respectively. Our analysis of the column density PDFs from the Herschel data show double-peak profiles for all parts of the cloud, which we attribute to an external compression. In those parts with active star formation, the PDF shows a power-law tail at high densities. The PDFs we calculated from our LABOCA data trace the denser parts of the cloud showing one peak and a power-law tail. With LABOCA we find 15 cores with masses between 0.07 and 1.71 M⊙ and a total mass of ≈8 M⊙. The total gas and dust mass of the cloud is ≈164 M⊙ and hence ~5% of the mass is in cores. From the Herschel and Planck data we find a total mass of ≈174 M⊙ and ≈171 M⊙, respectively. Conclusions: The position, orientation, and elongated shape of Lupus I, the double-peak PDFs and the population of pre-stellar and protostellar cores could be explained by the large-scale compression from the advancing USco H I shell and the UCL wind bubble. The Atacama Pathfinder Experiment (APEX) is a collaboration between the Max-Planck-Institut für Radioastronomie (MPIfR), the European Southern Observatory (ESO), and the Onsala Space Observatory (OSO).Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.Final APEX cube and Herschel N and T maps as FITS files are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/584/A36

Localizing Effects of Leptin on Upper Airway and Respiratory Control during Sleep.

PubMed

Yao, Qiaoling; Pho, Huy; Kirkness, Jason; Ladenheim, Ellen E; Bi, Sheng; Moran, Timothy H; Fuller, David D; Schwartz, Alan R; Polotsky, Vsevolod Y

2016-05-01

Obesity hypoventilation and obstructive sleep apnea are common complications of obesity linked to defects in respiratory pump and upper airway neural control. Leptin-deficient ob/ob mice have impaired ventilatory control and inspiratory flow limitation during sleep, which are both reversed with leptin. We aimed to localize central nervous system (CNS) site(s) of leptin action on respiratory and upper airway neuroventilatory control. We localized the effect of leptin to medulla versus hypothalamus by administering intracerbroventricular leptin (10 μg/2 μL) versus vehicle to the lateral (n = 14) versus fourth ventricle (n = 11) of ob/ob mice followed by polysomnographic recording. Analyses were stratified for effects on respiratory (nonflow-limited breaths) and upper airway (inspiratory flow limitation) functions. CNS loci were identified by (1) leptin-induced signal transducer and activator of transcription 3 (STAT3) phosphorylation and (2) projections of respiratory and upper airway motoneurons with a retrograde transsynaptic tracer (pseudorabies virus). Both routes of leptin administration increased minute ventilation during nonflow-limited breathing in sleep. Phrenic motoneurons were synaptically coupled to the nucleus of the solitary tract, which also showed STAT3 phosphorylation, but not to the hypothalamus. Inspiratory flow limitation and obstructive hypopneas were attenuated by leptin administration to the lateral but not to the fourth cerebral ventricle. Upper airway motoneurons were synaptically coupled with the dorsomedial hypothalamus, which exhibited STAT3 phosphorylation. Leptin relieves upper airway obstruction in sleep apnea by activating the forebrain, possibly in the dorsomedial hypothalamus. In contrast, leptin upregulates ventilatory control through hindbrain sites of action, possibly in the nucleus of the solitary tract. © 2016 Associated Professional Sleep Societies, LLC.

Search for Wide Planetary-Mass Companions in Young Star-Forming Regions with UKIDSS and Pan-STARRS

NASA Astrophysics Data System (ADS)

Aller, Kimberly M.; Kraus, A. L.; Liu, M. C.; Bowler, B. P.

2013-01-01

Over the past decade, planetary-mass (<15 MJup) companions have been discovered in very wide orbits (>100 AU) around young stars. It is unclear whether these objects formed like planets or like stars. If these are planets, then modifications to core accretion or disk instability models are needed to allow formation at such wide orbits, or planet scattering must be an important mechanism. On the other hand, if these objects formed like stars, we need to understand the frequency of these extremely low mass ratio binary companions which challenge brown dwarf formation models. Regardless of their origins, these wide companions are easier to observe than close-in planets and can be used as benchmarks to understand the properties of young planets. We have combined optical and NIR photometry from UKIDSS and Pan-STARRS-1 to search the young star-forming region of Upper Scorpius and Taurus for new planetary-mass objects, going ≈3 mag deeper than previous work with 2MASS. We identified several candidates with very wide separations (≈400-4000 AU) from known members using a combination of color selection and spectral energy distribution (SED) fitting to templates of known low-mass stars and brown dwarfs. Furthermore, we have obtained followup NIR spectra of several Upper Scorpius candidates to spectroscopically identify three new wide very low-mass companions (≈15-25 MJup spectral type of M8-L0).

Copious amounts of hot and cold dust orbiting the main sequence a-type stars HD 131488 and HD 121191

DOE Office of Scientific and Technical Information (OSTI.GOV)

Melis, Carl; Zuckerman, B.; Rhee, Joseph H.

2013-11-20

We report two new dramatically dusty main sequence stars: HD 131488 (A1 V) and HD 121191 (A8 V). HD 131488 is found to have substantial amounts of dust in its terrestrial planet zone (L {sub IR}/L {sub bol} ≈ 4 × 10{sup –3}), cooler dust farther out in its planetary system, and an unusual mid-infrared spectral feature. HD 121191 shows terrestrial planet zone dust (L {sub IR}/L {sub bol} ≈ 2.3 × 10{sup –3}), hints of cooler dust, and shares the unusual mid-infrared spectral shape identified in HD 131488. These two stars belong to sub-groups of the Scorpius-Centaurus OB associationmore » and have ages of ∼10 Myr. HD 131488 and HD 121191 are the dustiest main sequence A-type stars currently known. Early-type stars that host substantial inner planetary system dust are thus far found only within the age range of 5-20 Myr.« less

The Exoplant Migration Timescale from K2 Young Clusters

NASA Astrophysics Data System (ADS)

Rizzuto, Aaron C.; Mann, Andrew; Kraus, Adam L.; Ireland, Michael

2017-01-01

Planetary Migration models for close-in exoplanets(a < 0.1 AU, P < 20 days) can be loosely divided into three categories: Disk-driven migration, binary-star planet interaction, and planet-planet interaction. Disk migration, occurs over the lifetime of the protoplanetary disk (<5 Myr), while migration involving dynamical multi-body interactions operate on timescales of ~100’s of Myr to ~1Gyr, a lengthier process than disk migration. It is unclear which of these is the dominating mechanism.The K2 mission has measured planet formation timescales and migration pathways by sampling groups of stars at key pre-main-sequence ages: Over the past 10 campaigns, multiple groups of young stars have been observed by K2, ranging from the 10 Myr Upper Scorpius OB association, through the ˜120 Myr Pleiades, the ˜600-800 Myr Hyades and Praesepe moving groups, to the original Kepler Field. The frequency, orbital and compositional properties of the exoplanet population in these samples of different age, with careful treatment of detection completeness, will be sufficient to address the question of exoplanet migration as their host stars are settling onto the main sequence.We will present the initial results of a program to directly address the question of planet migration with a uniform injection-recovery tests on a new K2 detrending pipeline that is optimized for the particular case of young, rotationally variable stars in K2 to robustly measure the detectability of planets of differing size and orbit. Initial results point towards a migration timescale of 200-700 Myr, which is consistent with the slower planet-planet scattering or Kozai migration models.

Tuning into Scorpius X-1: adapting a continuous gravitational-wave search for a known binary system

NASA Astrophysics Data System (ADS)

Meadors, Grant David; Goetz, Evan; Riles, Keith

2016-05-01

We describe how the TwoSpect data analysis method for continuous gravitational waves (GWs) has been tuned for directed sources such as the low-mass X-ray binary (LMXB), Scorpius X-1 (Sco X-1). A comparison of five search algorithms generated simulations of the orbital and GW parameters of Sco X-1. Whereas that comparison focused on relative performance, here the simulations help quantify the sensitivity enhancement and parameter estimation abilities of this directed method, derived from an all-sky search for unknown sources, using doubly Fourier-transformed data. Sensitivity is shown to be enhanced when the source sky location and period are known, because we can run a fully templated search, bypassing the all-sky hierarchical stage using an incoherent harmonic sum. The GW strain and frequency, as well as the projected semi-major axis of the binary system, are recovered and uncertainty estimated, for simulated signals that are detected. Upper limits for GW strain are set for undetected signals. Applications to future GW observatory data are discussed. Robust against spin-wandering and computationally tractable despite an unknown frequency, this directed search is an important new tool for finding gravitational signals from LMXBs.

Rotation in USco and rho Oph with K2

NASA Astrophysics Data System (ADS)

Rebull, Luisa; Stauffer, John; K2 Clusters Team

2018-01-01

K2 observed Upper Scorpius and rho Oph as part of their Campaign 2 in 2014. At ~8 and ~1 Myr respectively, the stars in Upper Sco and rho Oph exhibit greater diversity of light curve shapes than are found in older clusters observed with K2 such as Pleiades or Praesepe. Nonetheless, we are able to derive rotation periods for 85% (971/1136) of the USco members and 80% (71/88) of the rho Oph members. About 25% of the periodic stars have evidence for multiple periods. These light curves sample smaller amplitudes to lower masses and with a far better cadence, than has even been probed before. We can compare USco with similar stars in Praesepe (~700 Myr) and the Pleiades (~125 Myr), all with K2 light curves.

The Exoplanet Migration Timescale from K2 Young Clusters

NASA Astrophysics Data System (ADS)

Rizzuto, Aaron

A significant fraction of exoplanets orbit within 0.1 AU of their host star, with periods of <20 days. The discovery of these close-in planets has defied conventional models of planet formation and evolution based on our own solar system. It is widely accepted that these close-in planets did not form in such close proximity to their host stars (both rocky planets and hot Jupiters), but rather that dynamical or interactive processes caused them to migrate inwards from larger orbital semimajor axes and periods. There are multiple planet migration scenarios proposed in the literature, though it is unclear how much of the known planet population is attributable to each mechanism. Planetary migration models can be loosely divided into two categories: disk-driven migration and dynamical migration. Disk migration occurs over the lifetime of the protoplanetary disk (<5 Myr), while migration involving dynamical multi-body interactions operates on timescales of 100 Myr to 1Gyr, a lengthier process than disk migration. The K2 mission has measured planet formation timescales and migration pathways by sampling groups of stars at key ages. Over the past 10 campaigns, multiple groups of young stars have been observed by K2, ranging from the 10 Myr Upper Scorpius OB association, through the <120 Myr Pleiades cluster, to the ,600-800 Myr Hyades and Praesepe clusters. Upcoming data from more recent campaigns include the 2Myr Taurus region and significantly more Upper Scorpius members in C13 and 15. The frequency, orbital properties, and compositions of the exoplanet population in these samples of different age, with careful treatment of detection completeness, distinguish these scenarios of exoplanet migration as their host stars are settling onto the main sequence. We have pioneered efforts to identify transiting exoplanets in the K2 data for young clusters and moving groups, and have developed a new, highly complete, detrending algorithm for rotational induced variability that is commonly seen in the light curves of young, active stars (Rizzuto et al. in prep). We have identified 11 candidate planets in Praesepe, Hyades, Upper Sco, and the Pleiades using these methods, the first of which has now been published with follow-up (Mann et al. 2016abc; Gaidos et al. 2016). This sample of detected planet candidates gives a promising first indication of the timescale over which planet migration occurs, favoring dynamical multi-body processes. However, because rotational activity in young stars makes detection of exoplanet transits more difficult for the younger clusters (e.g, Upper Sco, Pleiades), to robustly prove that these frequencies are true representations of the short-period planet occurrence rate at different PMS ages will require robust determination of detection limits in these highly variable young-star lightcurves. We propose to address the question of planet migration with a uniform injection-recovery test of young cluster members, to robustly measure the detectability of planets of differing size and orbit. This will involve detrending the light curve data of instrumental and rotational systematics, injecting a synthetic transit signature from a grid of planetary and orbital parameters, reversing the detrending, and then executing our transit search pipeline (which is tuned for highly active young stars) and mapping the recovery rate as a function of planet parameters for every individual light curve. With this map of detectability as a function of planet properties for each light curve and a full program of detected exoplanet follow-up, we can then directly confirm any change in the occurrence rates of close-in (P<20 day) planets with cluster age and identify the most significant migration mechanism.

VizieR Online Data Catalog: VLM stars and BDs in Upper Sco using Gaia DR1 (Cook+, 2017)

NASA Astrophysics Data System (ADS)

Cook, N. J.; Scholz, A.; Jayawardhana, R.

2018-04-01

We used literature samples (Dawson et al. (2011MNRAS.418.1231D, Cat. J/MNRAS/418/1231), Lodieu et al. (2011MNRAS.418.2604L), Dawson et al. (2013MNRAS.429..903D, Cat. J/MNRAS/429/903), Lodieu (2013MNRAS.431.3222L, Cat. J/MNRAS/431/3222), Lodieu (2013MNRAS.435.2474L, Cat. J/MNRAS/435/2474) and Dawson et al. (2014MNRAS.442.1586D)) and UKIDSS photometric data (Lawrence et al. (2007MNRAS.379.1599L, Cat. II/314) along with new proper motion data (using data from Gaia DR1 i.e. Altmann et al. (2017A&A...600L...4A, Cat. I/339), Tian et al. (2017ApJS..232....4T)) to construct catalogues of objects in Upper Scorpius. (8 data files).

Recent Seismic Experiments of OBS in the South China Sea

NASA Astrophysics Data System (ADS)

Ruan, A.; Li, J.; Wu, Z.

2012-12-01

Since 2006 some research institutions of China have carried out some important seismic experiments by using ocean bottom seismometer(OBS) in the South China Sea (SCS) and obtained many concrete progresses in modeling the crustal structure of SCS and also in understanding of its formation and evolution as well. In 2006 three wide-angle profiles were completed in the northern margin, named OBS2006-1 across the northwestern sub-basin, OBS2006-2 parallel to the sea basin boundary and OBS2006-3 across the Dongsha Rise and Chaoshan Depression respectively. In 2010 two wide- angle profiles were completed, named OBS2010-1 and OBS 2010-2 both perpendicular to the northern off-shore faulting system. During 2009-2011 four wide-angle profiles were completed in the southern margin, named OBS973-1 from southern margin to the southwestern sub-basin, OBS973-2 from Liyue Bank to the southwestern sub-basin and OBS973-3 from Xisha to the southwestern sub-basin, OBS2011-2 from Xisha to Hainan Island respectively. In 2011 two 3D seismic array of OBS were completed in the Zhongnan-Changlong sea mount chain and Huangyan-Zhenbei sea mount chain respectively. Here we present some primary but important results as follows. (1) The velocity model of OBS2006-1 indicates that the crust under the continental slope decreases from 21km to 11km, and to 7.7km in the northwestern sub-basin with Moho depth ascends from 21km to 11km. The tectonic geometry and velocity structure of the northwestern sub-basin and its margins on both sides shows symmetrical and conjugate and indicates pure shear mode of continental margin rifting mechanism. (2) The velocity model of OBS2006-3 reveals remarkable thickness with maximum 8 km of the Mesozoic sediment in Chaoshan Depression in which velocity increases downward from 4.4 km/s at top to 5.3 km/s at the bottom. The buried depth of Moho decreases from 24-25 km under Dongsha Rise to 17 km in the lower slope and an obviously velocity abnormal is detected in the upper crust of the Dongsha Rise and its velocity raises to 6.9 km/s due to the mantle underplating and magma activities. A high velocity layer (HVL) of 3-12 km thick is found in the lower crust, and its velocity is 7.1-7.4 km/s. (3) The wide angle seismic profile-OBS973-2 that extends in NW-SE direction 369km long from the northeastern Liyue Bank to the central sub-basin. It indicates that there are some small volcanoes on the top of crust in Liyue Bank and P wave velocities downward increase from 5.5~6.4km/s in the upper crust (9~10km thick) to 6.6~7.1km/s in the lower crust (11km thick). In the transition zone and sea basin P wave velocities downward increase from 5.9~6.1km/s in the upper curst (4~5km thick) to 6.6~6.9km/s in the lower crust (2~4km thick). The buried depth of Moho is 23km in Liyue Bank and 8~12km in the sea basin. The comparison of profile OBS973-2 with profile OBS2006-1 in the northern margin shows remarkable similarity between them and suggests a possibility of conjugation relationship between Liyue Bank and Zhongsha Massif. Acknowledgements This work was supported by the National Natural Science Foundation of China (91028006,40876035,41106053 and 41176046) and the National Basic Research Program of China (2007CB411701) .

Zodiacal Exoplanets in Time (ZEIT). V. A Uniform Search for Transiting Planets in Young Clusters Observed by K2

NASA Astrophysics Data System (ADS)

Rizzuto, Aaron C.; Mann, Andrew W.; Vanderburg, Andrew; Kraus, Adam L.; Covey, Kevin R.

2017-12-01

Detection of transiting exoplanets around young stars is more difficult than for older systems owing to increased stellar variability. Nine young open cluster planets have been found in the K2 data, but no single analysis pipeline identified all planets. We have developed a transit search pipeline for young stars that uses a transit-shaped notch and quadratic continuum in a 12 or 24 hr window to fit both the stellar variability and the presence of a transit. In addition, for the most rapid rotators ({P}{rot}< 2 days) we model the variability using a linear combination of observed rotations of each star. To maximally exploit our new pipeline, we update the membership for four stellar populations observed by K2 (Upper Scorpius, Pleiades, Hyades, Praesepe) and conduct a uniform search of the members. We identify all known transiting exoplanets in the clusters, 17 eclipsing binaries, one transiting planet candidate orbiting a potential Pleiades member, and three orbiting unlikely members of the young clusters. Limited injection recovery testing on the known planet hosts indicates that for the older Praesepe systems we are sensitive to additional exoplanets as small as 1-2 R ⊕, and for the larger Upper Scorpius planet host (K2-33) our pipeline is sensitive to ˜4 R ⊕ transiting planets. The lack of detected multiple systems in the young clusters is consistent with the expected frequency from the original Kepler sample, within our detection limits. With a robust pipeline that detects all known planets in the young clusters, occurrence rate testing at young ages is now possible.

Young Binaries and Early Stellar Evolution

NASA Astrophysics Data System (ADS)

Brandner, Wolfgang

1996-07-01

Most main-sequence stars are members of binary or multiple systems. The same is true for pre-main-sequence (PMS) stars, as recent surveys have shown. Therefore studying star formation means to a large extent studying the formation of binary systems. Similarly, studying early stellar evolution primarily involves PMS binary systems. In this thesis I have studied the binary frequency among ROSAT selected T Tauri stars in the Chamaeleon T association and the Scorpius-Centaurus OB association, and the evolutionary status of Hα-selected PMS binaries in the T associations of Chamaeleon, Lupus, and ρ Ophiuchi. The direct imaging and spectroscopic observations in the optical have been carried out under subarcsec seeing conditions at the ESO New Technology Telescope (NTT) at La Silla. Furthermore, high-spatial resolution images of selected PMS stars in the near infrared were obtained with the ESO adaptive optics system COME-ON+/ADONIS. Among 195 T Tauri stars observed using direct imaging 31 binaries could be identified, 12 of them with subarcsec separation. Based on statistical arguments alone I conclude that almost all of them are indeed physical (i.e. gravitationally bound) binary or multiple systems. Using astrometric measurements of some binaries I showed that the components of these binaries are common proper motion pairs, very likely in a gravitationally bound orbit around each other. The overall binary frequency among T Tauri stars with a range of separations between 120 and 1800 AU is in agreement with the binary frequency observed among main-sequence stars in the solar neighbourhood. However, within individual regions the spatial distribution of binaries is non-uniform. In particular, in Upper Scorpius, weak-line T Tauri stars in the vicinity of early type stars seem to be almost devoid of multiple systems, whereas in another area in Upper Scorpius half of all weak-line T Tauri stars have a companion in a range of separation between 0.''7 and 3.''0. For a sample of 14 spatially resolved PMS binaries (separations 0.''6 to 1.prime'7) located in the above mentioned T associations both photometric and spectroscopic information has been analyzed. All binaries (originally unresolved) were identified as PMS stars based on their strong Hα emission and their association with dark clouds. Using the spectral A index, which measures the strength of the CaH band at 697.5nm relative to the nearby continuum as a luminosity class indicator, I showed that the classical T Tauri stars in the sample tend to be close to luminosity class V. Eight out of the 14 pairs could be placed on an H--R diagram. When comparing with theoretical PMS evolutionary tracks the individual components of all pairs appear to be coeval within the observational errors. This result is similar to Hartigan et al. (1994) who found two thirds of the wider pairs with separations from 400 AU to 6000 AU to be coeval. However, unlike Hartigan et al.'s finding for the wider pairs, I find no non-coeval pairs. One of the presumed binaries in our sample (ESO Hα 281) turned out to be a likely chance projection with the ``primary'' showing neither Hα emission nor Li absorption. Finally, using adaptive optics at the ESO 3.6m telescope, diffraction-limited JHK images of the region around the Herbig AeBe star NX Pup were obtained. The close companion (sep. 0.''128) to NX Pup -- originally discovered by HST -- was clearly resolved and its JHK magnitudes were determined. A third object at a separation of 7.''0 from NX Pup was identified as a classical T Tauri star so that NX Pup may in fact form a hierarchical triple system. I discuss the evolutionary status of these stars and derive estimates for their spectral types, luminosities, masses, and ages. My conclusions are that binarity is established very early in stellar evolution, that the orbital parameters of wide binaries (a >= 120AU) remain virtually unchanged during their PMS evolution, and that the components of the wide binaries were formed at the same time --- perhaps either through collisional fragmentation or fragmentation of rotating filaments. (Copies of the thesis (written in German) and related pre-/reprints are available from the author upon request.)

The New 30 Doradus

NASA Astrophysics Data System (ADS)

Walborn, N. R.; Barbá, R. H.

A groundbased, blue-violet spectral classification study of the 30 Doradus stellar content has revealed five spatially and/or temporally distinct components: (1) the central ionizing cluster including R136 (corresponding to the Carina phase of OB cluster evolution with an age of 2-3 Myr); (2) a younger generation in or near the bright nebular filaments west and northeast of R136, containing heavily embedded early-O dwarfs and IR sources, the formation of which was likely triggered by the central cluster (Orion phase, <1 Myr); (3) an older population of late-O and early-B supergiants throughout the central field whose structural relationship, if any, to the younger groups is unclear (Scorpius OB1 phase, 4-6 Myr); (4) a previously known, older still compact cluster 3' northwest of R136, containing A and M supergiants and evidently affecting the nebular dynamics substantially (h and chi Persei phase, 10 Myr); and (5) a newly recognized Sco OB1-phase association surrounding the recently discovered Luminous Blue Variable R143 in the southern part of the Nebula. Evidently, star formation has occurred in discrete events at different epochs in 30 Dor, and there are clear implications for the interpretation of more distant starbursts. This presentation emphasizes the second component above, a new stellar generation currently being formed in 30 Doradus. Groundbased IR images by Rubio et al. and H2 observations by Probst and Rubio show many sources, with detailed relationships to the embedded optical O stars as well as to the nebular microstructures visible in HST/WFPC2 images. Recent observations of these fields with HST/NICMOS reveal an even greater wealth of structural detail, including compact IR multiple systems and clusters, and probable jets associated with two of the embedded early-O systems; one of the latter may also be related to an H2O maser source. These and future IR data will provide new insights into the evolution of starbursts on the scale of 30 Doradus, as well as the early evolution of individual massive stars and compact groups.

Zodical Exoplanets in Time: Are These Worlds Flat?

NASA Astrophysics Data System (ADS)

Mann, Andrew; Rizzuto, Aaron; Newton, Elisabeth; Gaidos, Eric; Kraus, Adam; Dalba, Paul

2016-08-01

Over the past decade, Spitzer has helped to revolutionize our understanding of exoplanet atmospheres. By extending the reach of transmission spectroscopy (change in transit depth with wavelength) past 3 microns, Spitzer has provided unique constraints on the composition of the atmospheres of transiting planets. Such studies of super-Earth and Neptune size planets with both the Hubble Space Telescope and Spitzer have generally found featureless atmospheres, consistent with high clouds or a haze layer. This finding motivates more questions; how and when do these atmospheres form, how do they sustain themselves, and how long do they persist? Some answers could be found by comparing the atmospheres of similar planets with a range of ages from infancy (0-20 Myr) to adolescence (100-1000 Myr) to maturity (more than 1 Gyr). The mature part of this comparison is starting to become complete with many older super-Earth to Neptune size systems undergoing detailed study. However, even among the known young and adolescent systems, few were known to transit and none were amenable to transmission spectroscopy. Observations of young stars by the K2 mission has changed the landscape. From this data our team has identified and confirmed two transiting planets that will promote studies of exoplanet evolution. The first, K2-25b, orbits an M4.5 in the Hyades cluster (650 Myr), and the second, K2-33b, orbits an M3.5 pre-main sequence star in the Upper Scorpius OB association (11 Myr). We propose to observe 6 transits of the former and 5 of the latter with Spitzer/IRAC 3.6 and 4.5 micron bands. In combination with our K2 and ground-based data we can construct low-resolution transmission spectra of each planet in the key regions of atmospheric differentiation. This will provide the first insight into the atmospheres of young, small planets, determine when featureless atmospheres first appear, and provide constraints on the evolution of planetary atmospheres.

A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius.

PubMed

Cutfield, S M; Cutfield, J F

1993-09-01

The peptide hormone glucagon has been isolated from the islet tissue (Brockmann bodies) of the teleost Cottus scorpius (daddy sculpin) and sequenced. The sequence is HSEGTSNDYSKYLEDRKAQDFVQWLMNN differing at four positions from the glucagon found earlier in the same species by Conlon and coworkers (1987b, Eur. J. Biochem, 164, 117-122). Thus sculpin, in common with anglerfish, possesses two distinct glucagons. Comparative sequence data are presented as a phylogenetic tree.

Sensitive survey for 13CO, CN, H2CO, and SO in the disks of T Tauri and Herbig Ae stars. II. Stars in ρ Ophiuchi and upper Scorpius

NASA Astrophysics Data System (ADS)

Reboussin, L.; Guilloteau, S.; Simon, M.; Grosso, N.; Wakelam, V.; Di Folco, E.; Dutrey, A.; Piétu, V.

2015-06-01

Aims: We attempt to determine the molecular composition of disks around young low-mass stars in the ρ Oph region and to compare our results with a similar study performed in the Taurus-Auriga region. Methods: We used the IRAM 30 m telescope to perform a sensitive search for CN N = 2-1 in 29 T Tauri stars located in the ρ Oph and upper Scorpius regions. 13CO J = 2-1 is observed simultaneously to provide an indication of the level of confusion with the surrounding molecular cloud. The bandpass also contains two transitions of ortho-H2CO, one of SO, and the C17O J = 2-1 line, which provides complementary information on the nature of the emission. Results: Contamination by molecular cloud in 13CO and even C17O is ubiquitous. The CN detection rate appears to be lower than for the Taurus region, with only four sources being detected (three are attributable to disks). H2CO emission is found more frequently, but appears in general to be due to the surrounding cloud. The weaker emission than in Taurus may suggest that the average disk size in the ρ Oph region is smaller than in the Taurus cloud. Chemical modeling shows that the somewhat higher expected disk temperatures in ρ Oph play a direct role in decreasing the CN abundance. Warmer dust temperatures contribute to convert CN into less volatile forms. Conclusions: In such a young region, CN is no longer a simple, sensitive tracer of disks, and observations with other tracers and at high enough resolution with ALMA are required to probe the gas disk population. Based on observations carried out with the IRAM 30-m telescope. IRAM is supported by INSU/CNRS (France), MPG (Germany) and IGN (Spain).Appendix A is available in electronic form at http://www.aanda.org

Directed searches for continuous gravitational waves from spinning neutron stars in binary systems

NASA Astrophysics Data System (ADS)

Meadors, Grant David

2014-09-01

Gravitational wave detectors such as the Laser Interferometer Gravitational-wave Observatory (LIGO) seek to observe ripples in space predicted by General Relativity. Black holes, neutron stars, supernovae, the Big Bang and other sources can radiate gravitational waves. Original contributions to the LIGO effort are presented in this thesis: feedforward filtering, directed binary neutron star searches for continuous waves, and scientific outreach and education, as well as advances in quantum optical squeezing. Feedforward filtering removes extraneous noise from servo-controlled instruments. Filtering of the last science run, S6, improves LIGO's astrophysical range (+4.14% H1, +3.60% L1: +12% volume) after subtracting noise from auxiliary length control channels. This thesis shows how filtering enhances the scientific sensitivity of LIGO's data set during and after S6. Techniques for non-stationarity and verifying calibration and integrity may apply to Advanced LIGO. Squeezing is planned for future interferometers to exceed the standard quantum limit on noise from electromagnetic vacuum fluctuations; this thesis discusses the integration of a prototype squeezer at LIGO Hanford Observatory and impact on astrophysical sensitivity. Continuous gravitational waves may be emitted by neutron stars in low-mass X-ray binary systems such as Scorpius X-1. The TwoSpect directed binary search is designed to detect these waves. TwoSpect is the most sensitive of 4 methods in simulated data, projecting an upper limit of 4.23e-25 in strain, given a year-long data set at an Advanced LIGO design sensitivity of 4e-24 Hz. (-1/2). TwoSpect is also used on real S6 data to set 95% confidence upper limits (40 Hz to 2040 Hz) on strain from Scorpius X-1. A millisecond pulsar, X-ray transient J1751-305, is similarly considered. Search enhancements for Advanced LIGO are proposed. Advanced LIGO and fellow interferometers should detect gravitational waves in the coming decade. Methods in these thesis will benefit both the instrumental and analytical sides of observation.

Upper air teleconnections to Ob River flows and tree rings

NASA Astrophysics Data System (ADS)

Meko, David; Panyushkina, Irina; Agafonov, Leonid

2015-04-01

The Ob River, one of the world's greatest rivers, with a catchment basin about the size of Western Europe, contributes 12% or more of the annual freshwater inflow to the Arctic Ocean. The input of heat and fresh water is important to the global climate system through effects on sea ice, salinity, and the thermohaline circulation of the ocean. As part of a tree-ring project to obtain multi-century long information on variability of Ob River flows, a network of 18 sites of Pinus, Larix, Populus and Salix has been collected along the Ob in the summers of 2013 and 2014. Analysis of collections processed so far indicates a significant relationship of tree-growth to river discharge. Moderation of the floodplain air temperature regime by flooding appears to be an important driver of the tree-ring response. In unraveling the relationship of tree-growth to river flows, it is important to identify atmospheric circulation features directly linked to observed time series variations of flow and tree growth. In this study we examine statistical links between primary teleconnection modes of Northern Hemisphere upper-air (500 mb) circulation, Ob River flow, and tree-ring chronologies. Annual discharge at the mouth of the Ob River is found to be significantly positively related to the phase of the East Atlantic (EA) pattern, the second prominent mode of low-frequency variability over the North Atlantic. The EA pattern, consisting of a north-south dipole of pressure-anomaly centers spanning the North Atlantic from east to west, is associated with a low-pressure anomaly centered over the Ob River Basin, and with a pattern of positive precipitation anomaly of the same region. The positive correlation of discharge and EA is consistent with these know patterns, and is contrasted with generally negative (though smaller) correlations between EA and tree-ring chronologies. The signs of correlations are consistent with a conceptual model of river influence on tree growth through air temperature. Future work aims at combining the tree-ring samples from living trees and remnant wood to reconstruction to quantitiative reconstruction of annual flow over the past millennium.

Inverse-Ray Imaging of Gas Hydrates Along a MCS/OBS Profile at the Continental Slope Offshore SW Taiwan

NASA Astrophysics Data System (ADS)

Wang, T. K.; Chen, C.; Yang, B.; Lee, C.

2006-12-01

Prevalence of gas hydrates offshore SW Taiwan has been proposed due to lots of bottom-simulated reflectors (BSR) appeared on the seismic data. In this paper, we analyze a MCS/OBS profile with intensive BSR signals at the continental slope of the northern South China Sea. Firstly, MCS data with 160 channels collected by R/V Maurice-Ewing in September 1995 is re-processed through vertical velocity analysis, horizon velocity analysis, and prestack depth migration. Then, OBS data collected by the first Micro-OBS survey from NTOU team in August 2005 is analyzed through travel-time inversion of reflected and refracted arrivals for which the initial model is constructed from the MCS result. Finally, a novel technique of inverse reflected rays by considering both MCS and OBS data is applied for layer-stripping imaging of sedimentary layers. Velocity models imaged from three methods are confirmed the prevalence of BSR at 100-400 m depth below the sea floor along the whole profile. Relatively smooth sedimentary layers are observed below the lower slope of the continent whereas several mud diapers are imaged below the upper slope of the continent. Above the mud diapers, we find gas hydrates with high velocity of about 1.9-2.1 km/s and thickness of about 100 m immediately above the strong BSR. Similarly, near the mud diapers, free gas with low velocity of about 1.4-1.7 km/s and thickness of about 200 m is imaged. Migration of free gas through diapirism may result in lots of gas hydrates accumulated below the upper slope of the continent offshore SW Taiwan.

SCORPIUS, A New Generation of Responsive, Low Cost Expendable Launch Vehicles

NASA Astrophysics Data System (ADS)

Conger, R. E.; Chakroborty, S. P.; Wertz, J. R.

2002-01-01

The Scorpius vehicle family extends from one and two stage sub-orbital vehicles for target and science applications to small, medium and heavy lift orbital vehicles. These new liquid fueled vehicles have LEO and GTO capabilities. Microcosm and the Scorpius Space Launch Company (SSLC) are well into the development of this all-new generation of expendable launch vehicles to support commercial and government missions. This paper presents the projected performance of the family of vehicles, status of the development program and projected launch service prices. The paper will discuss the new low cost ablative engines and low cost pressure-fed LOX/Jet-A propulsion systems. Schedules, payload volumes, dispensers, attach fittings, and planned dual manifest capabilities will be presented. The unique configuration of the wide base first stage allows fairings that may extend beyond the current 4-meters. The Scorpius family is designed to facilitate encapsulated payloads and launch-on-demand. The implications of these new operational procedures will be addressed, including the techniques that will be used to drive down the cost of access to space while improving reliability. The Scorpius family of low cost vehicles addresses the full range of payloads from 700 lbs. in the Sprite Mini-Lift to over 50,000 lbs. to LEO in the Heavy-Lift, and over 18,000 lbs. to GTO. Two sub-orbital vehicles have been developed and successfully launched, with the latest vehicle (SR-XM) launched in March of 2001 from White Sands Missile Range. Development of the family of vehicles commenced in 1993 under contracts with the Air Force Research Laboratory Space Vehicle Directorate after a number of years of independent studies and system engineering. The Sprite Mini-Lift Small Expendable Launch Vehicle (SELV) that utilizes the SR-XM technologies is planned for an initial launch in mid 2005 with larger, scaled-up vehicles to follow.

Determining Ocean-Bottom Seismometer Orientations from the RHUM-RUM experiment from P-wave and Rayleigh wave polarizations

NASA Astrophysics Data System (ADS)

Scholz, John-Robert; Barruol, Guilhem; Fontaine, Fabrice R.; Sigloch, Karin

2016-04-01

To image the upper mantle structure beneath La Réunion hotspot, a large-scale seismic network has been deployed on land and at sea in the frame of the RHUM-RUM project (Réunion Hotspot and Upper Mantle - Réunions Unterer Mantel). This French-German passive seismic experiment was designed to investigate and image the deep structure beneath La Réunion, from crust to core, to precise the shape and depth origin of a mantle plume, if any, and to precise the horizontal and vertical mantle flow associated to a possible plume upwelling, to its interaction with the overlying plate and with the neighboring Indian ridges. For this purpose, 57 Ocean-Bottom Seismometers (OBS) were installed around La Réunion and along the Central and Southwest Indian ridges. Broad-band instruments were deployed with the French R/V Marion Dufresne in late 2012 (cruise MD192), and recovered 13 months later by the German R/V Meteor (cruise M101). The pool of OBS was complemented by ~60 terrestrial stations, installed on different islands in the western Indian Ocean, such as La Réunion, Madagascar, Mauritius, Seychelles, Mayotte and the Îles Éparses in the Mozambique channel. The OBS installation is a free-fall down to the seafloor, where they landed in an unknown orientation. Since seismologic investigations of crustal and upper mantle structure (e.g., receiver functions) and azimuthal anisotropy (e.g., SKS-splitting and Rayleigh waves) rely on the knowledge of the correct OBS orientation with respect to the geographic reference frame, it is of importance to determine the orientations of the OBS while recording on the seafloor. In an isotropic, horizontally homogeneous and non-dipping layered globe, the misorientation of each station refers to the offset between theoretical and recorded back-azimuth angle of a passive seismic event. Using large earthquakes (MW > 5.0), it is possible to establish multiple successful measurements per station and thus to determine with good confidence the sensor orientations. In this study, we analyzed particle motions of P-waves (P-pol) and of Rayleigh waves (R-pol) to quantify the orientation of each of the 57 OBS. We performed 213 polarization measurements based on 35 earthquakes for P-pol, and 381 polarization measurements based on 48 earthquakes for R-pol. This allowed us to successfully determine the North/South orientations for 40 out of 57 OBS: 13 stations were devoid of usable data and 4 stations were too noisy. From twice the standard deviation (95% confidence interval), we estimate the errors between 1° and 20°.

Spectral Classification of the 30 Doradus Stellar Populations

NASA Astrophysics Data System (ADS)

Walborn, Nolan R.; Blades, J. Chris

1997-10-01

An optical spectral classification study of 106 OB stars within the 30 Doradus Nebula has sharpened the description of the spatial and temporal structures among the associated clusters. Five distinct stellar groups are recognized: (1) the central early-O (Carina phase) concentration, which includes Radcliffe 136 (R136); (2) a younger (Orion phase) population to the north and west of R136, containing heavily embedded early-O dwarfs and IR sources, the formation of which was likely triggered by the central concentration; (3) an older population of late-O and early-B supergiants (Scorpius OB1 phase) throughout the central field, whose structural relationship, if any, to the younger groups is unclear; (4) a previously known, even older compact cluster 3' northwest of R136, containing A- and M-type supergiants (h and χ Persei phase), which has evidently affected the nebular dynamics substantially; and (5) a newly recognized Sco OB1-phase association, surrounding the recently discovered luminous blue variable (LBV) R143, in the southern part of the Nebula. The intricacy of this region and the implications for the interpretation of more distant starbursts are emphasized. The evidence indicates that the formation of the 30 Dor stellar content was neither instantaneous nor continuous, but rather that the stars formed in discrete events at different epochs. The average difference between the derived and calibration absolute visual magnitudes of the stars is 0.05, indicating that the classification, calibration, and adopted distance modulus (V0 - MV = 18.6) are accurate. For 70 of the stars, either the absolute value of that difference is <=0.6 mag, or they are subluminous dwarfs or superluminous supergiants. Many astrophysically interesting objects have been isolated for further investigation. Surprisingly, in view of the presence of several O3 supergiants, the mid-Of star R139 is identified as the most massive object in this sample; it is located well along the 120 M⊙ track, very near the Humphreys-Davidson limit, and it is probably an immediate LBV precursor. This work can and should be extended in three ways: (1) higher resolution and higher S/N observations of many of the stars with larger ground-based telescopes for quantitative analysis, (2) ground-based spectral classification of the numerous additional accessible stars in the field, and (3) spatially resolved spectral classification of compact multiple systems with the Hubble Space Telescope.

Evaluation of metal content in perch of the Ob River basin

NASA Astrophysics Data System (ADS)

Osipova, N. A.; Stepanova, K. D.; Matveenko, I. A.

2015-11-01

The geochemical features of river perch in the River Ob basin have been studied (the upper and middle reaches of the Ob River and the lower reach of the Tom River). The contents of Ag, Bi, Cd, Co, Cr, Cu, Fe, Mn, Mo, Ni, Pb, Sn, W, Zn, Hg in perch's soft tissue are defined by the methods of ICP AES and stripping voltammetry, that of mercury in bones - by the atomic absorption method using mercury analyzer PA-915+. The distribution series of metal absolute concentrations in perch's soft tissue from the Ob River basin are plotted: Fe > Zn > Cu > Mn, typical for uncontaminated or slightly metal contaminated water bodies. In soft tissue of the studied samples the metal content does not exceed the permissible values. The mercury content in bones of studied samples is in the range 0,036-0,556 mg/kg. The mercury concentration is higher in bones in comparison with soft tissue in all samples.

Universal upper limit on inflation energy scale from cosmic magnetic field

DOE Office of Scientific and Technical Information (OSTI.GOV)

Fujita, Tomohiro; Mukohyama, Shinji, E-mail: tomohiro.fujita@ipmu.jp, E-mail: shinji.mukohyama@ipmu.jp

2012-10-01

Recently observational lower bounds on the strength of cosmic magnetic fields were reported, based on γ-ray flux from distant blazars. If inflation is responsible for the generation of such magnetic fields then the inflation energy scale is bounded from above as ρ{sub inf}{sup 1/4} < 2.5 × 10{sup −7}M{sub Pl} × (B{sub obs}/10{sup −15}G){sup −2} in a wide class of inflationary magnetogenesis models, where B{sub obs} is the observed strength of cosmic magnetic fields. The tensor-to-scalar ratio is correspondingly constrained as r < 10{sup −19} × (B{sub obs}/10{sup −15}G){sup −8}. Therefore, if the reported strength B{sub obs} ≥ 10{sup −15}Gmore » is confirmed and if any signatures of gravitational waves from inflation are detected in the near future, then our result indicates some tensions between inflationary magnetogenesis and observations.« less

Seismic velocity structures of the transitional crust across the northeastern margin of the South China Sea

NASA Astrophysics Data System (ADS)

Xiaoli, W.; Li, C. F.

2017-12-01

A wide-angle OBS profile (OBS2016-2) was simulated by using forward method, in order to investigate the structures of the transition crust across the northeastern margin of the South China Sea (SCS). Reflection and refraction data recorded at 14 ocean bottom seismometers (OBS) along the NW-SE profile of 320 km long are integrated to image the Cenozoic (1.7-3.3 km/s) sediment and Mesozoic (4.2-5.3 km/s) sediment at northeastern Chaoshan Depression, the upper (5.5 km/s-6.3 km/s) and lower (6.4 km/s-6.9 km/s) crust successfully. The 2-D velocity-depth models are obtained by using the 2-D forward ray-tracing RayInvr software (Zelt and Smith, 1992). The initial model is established based on single channel seismic profile, the seismic phases of the 14 OBSs and the regional geologic and geophysical data. The velocity model reveals that the thickness of sediment (1.2-5.5 km) varies strongly from onshore to offshore due to the seafloor spreading of the SCS. Several relict volcanoes are identified in the upper crust (2.1-8.1 km) by single channel seismic data acquisited along the same profile. The depth of MOHO interface in the velocity model decreases seaward gradually from 26.8 to 10.8 km. Ocean-continent transition zone in the northeastern margin of the SCS is characterized by several volcanoes and igneous rocks in the upper crust.

Substellar Companions to weak-line TTauri Stars

NASA Astrophysics Data System (ADS)

Brandner, W.; Alcala, J. M.; Covino, E.; Frink, S.

1997-05-01

Weak-line TTauri stars, contrary to classical TTauri stars, no longer possess massive circumstellar disks. In weak-line TTauri stars, the circumstellar matter was either accreted onto the TTauri star or has been redistributed. Disk instabilities in the outer disk might result in the formation of brown dwarfs and giant planets. Based on photometric and spectroscopic studies of ROSAT sources, we have selected an initial sample of 200 weak-line TTauri stars in the Chamaeleon T association and the Scorpius Centaurus OB association. In the course of follow-up observations we identified visual and spectroscopic binary stars and excluded them from our final list, as the complex dynamics and gravitational interaction in binary systems might aggravate or even completely inhibit the formation of planets (depending on physical separation of the binary components and their mass-ratio). The membership of individual stars to the associations was established from proper motion studies and radial velocity surveys. Our final sample consists of 70 single weak-line TTauri stars. We have initiated a program to spatially RESOLVE young brown dwarfs and young giant planets as companions to single weak-line TTauri stars using adaptive optics at the ESO 3.6m telescope and HST/NICMOS. In this poster we describe the observing strategy and present first results of our adaptive optics observations.

Regional and temporal variations in coding of hospital diagnoses referring to upper gastrointestinal and oesophageal bleeding in Germany.

PubMed

Langner, Ingo; Mikolajczyk, Rafael; Garbe, Edeltraut

2011-08-17

Health insurance claims data are increasingly used for health services research in Germany. Hospital diagnoses in these data are coded according to the International Classification of Diseases, German modification (ICD-10-GM). Due to the historical division into West and East Germany, different coding practices might persist in both former parts. Additionally, the introduction of Diagnosis Related Groups (DRGs) in Germany in 2003/2004 might have changed the coding. The aim of this study was to investigate regional and temporal variations in coding of hospitalisation diagnoses in Germany. We analysed hospitalisation diagnoses for oesophageal bleeding (OB) and upper gastrointestinal bleeding (UGIB) from the official German Hospital Statistics provided by the Federal Statistical Office. Bleeding diagnoses were classified as "specific" (origin of bleeding provided) or "unspecific" (origin of bleeding not provided) coding. We studied regional (former East versus West Germany) differences in incidence of hospitalisations with specific or unspecific coding for OB and UGIB and temporal variations between 2000 and 2005. For each year, incidence ratios of hospitalisations for former East versus West Germany were estimated with log-linear regression models adjusting for age, gender and population density. Significant differences in specific and unspecific coding between East and West Germany and over time were found for both, OB and UGIB hospitalisation diagnoses, respectively. For example in 2002, incidence ratios of hospitalisations for East versus West Germany were 1.24 (95% CI 1.16-1.32) for specific and 0.67 (95% CI 0.60-0.74) for unspecific OB diagnoses and 1.43 (95% CI 1.36-1.51) for specific and 0.83 (95% CI 0.80-0.87) for unspecific UGIB. Regional differences nearly disappeared and time trends were less marked when using combined specific and unspecific diagnoses of OB or UGIB, respectively. During the study period, there were substantial regional and temporal variations in the coding of OB and UGIB diagnoses in hospitalised patients. Possible explanations for the observed regional variations are different coding preferences, further influenced by changes in coding and reimbursement rules. Analysing groups of diagnoses including specific and unspecific codes reduces the influence of varying coding practices.

First all-sky search for continuous gravitational waves from unknown sources in binary systems

NASA Astrophysics Data System (ADS)

Aasi, J.; Abbott, B. P.; Abbott, R.; Abbott, T.; Abernathy, M. R.; Accadia, T.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Affeldt, C.; Agathos, M.; Aggarwal, N.; Aguiar, O. D.; Ain, A.; Ajith, P.; Alemic, A.; Allen, B.; Allocca, A.; Amariutei, D.; Andersen, M.; Anderson, R.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C.; Areeda, J.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Austin, L.; Aylott, B. E.; Babak, S.; Baker, P. T.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barbet, M.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barton, M. A.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Bauchrowitz, J.; Bauer, Th. S.; Behnke, B.; Bejger, M.; Beker, M. G.; Belczynski, C.; Bell, A. S.; Bell, C.; Bergmann, G.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Beyersdorf, P. T.; Bilenko, I. A.; Billingsley, G.; Birch, J.; Biscans, S.; Bitossi, M.; Bizouard, M. A.; Black, E.; Blackburn, J. K.; Blackburn, L.; Blair, D.; Bloemen, S.; Blom, M.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, G.; Bogan, C.; Bond, C.; Bondu, F.; Bonelli, L.; Bonnand, R.; Bork, R.; Born, M.; Boschi, V.; Bose, Sukanta; Bosi, L.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Bridges, D. O.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brückner, F.; Buchman, S.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Burman, R.; Buskulic, D.; Buy, C.; Cadonati, L.; Cagnoli, G.; Calderón Bustillo, J.; Calloni, E.; Camp, J. B.; Campsie, P.; Cannon, K. C.; Canuel, B.; Cao, J.; Capano, C. D.; Carbognani, F.; Carbone, L.; Caride, S.; Castiglia, A.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Celerier, C.; Cella, G.; Cepeda, C.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chen, X.; Chen, Y.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Chow, J.; Christensen, N.; Chu, Q.; Chua, S. S. Y.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C.; Colombini, M.; Cominsky, L.; Constancio, M.; Conte, A.; Cook, D.; Corbitt, T. R.; Cordier, M.; Cornish, N.; Corpuz, A.; Corsi, A.; Costa, C. A.; Coughlin, M. W.; Coughlin, S.; Coulon, J.-P.; Countryman, S.; Couvares, P.; Coward, D. M.; Cowart, M.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Creighton, T. D.; Crowder, S. G.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dahl, K.; Dal Canton, T.; Damjanic, M.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dattilo, V.; Daveloza, H.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; Dayanga, T.; Debreczeni, G.; Degallaix, J.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Dhurandhar, S.; Díaz, M.; Di Fiore, L.; Di Lieto, A.; Di Palma, I.; Di Virgilio, A.; Donath, A.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dossa, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Dwyer, S.; Eberle, T.; Edo, T.; Edwards, M.; Effler, A.; Eggenstein, H.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Endrőczi, G.; Essick, R.; Etzel, T.; Evans, M.; Evans, T.; Factourovich, M.; Fafone, V.; Fairhurst, S.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fehrmann, H.; Fejer, M. M.; Feldbaum, D.; Feroz, F.; Ferrante, I.; Ferrini, F.; Fidecaro, F.; Finn, L. S.; Fiori, I.; Fisher, R. P.; Flaminio, R.; Fournier, J.-D.; Franco, S.; Frasca, S.; Frasconi, F.; Frede, M.; Frei, Z.; Freise, A.; Frey, R.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gair, J.; Gammaitoni, L.; Gaonkar, S.; Garufi, F.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, C.; Gleason, J.; Goetz, E.; Goetz, R.; Gondan, L.; González, G.; Gordon, N.; Gorodetsky, M. L.; Gossan, S.; Goßler, S.; Gouaty, R.; Gräf, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greenhalgh, R. J. S.; Gretarsson, A. M.; Groot, P.; Grote, H.; Grover, K.; Grunewald, S.; Guidi, G. M.; Guido, C.; Gushwa, K.; Gustafson, E. K.; Gustafson, R.; Hammer, D.; Hammond, G.; Hanke, M.; Hanks, J.; Hanna, C.; Hanson, J.; Harms, J.; Harry, G. M.; Harry, I. W.; Harstad, E. D.; Hart, M.; Hartman, M. T.; Haster, C.-J.; Haughian, K.; Heidmann, A.; Heintze, M.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Heptonstall, A. W.; Heurs, M.; Hewitson, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Holt, K.; Hooper, S.; Hopkins, P.; Hosken, D. J.; Hough, J.; Howell, E. J.; Hu, Y.; Huerta, E.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh, M.; Huynh-Dinh, T.; Ingram, D. R.; Inta, R.; Isogai, T.; Ivanov, A.; Iyer, B. R.; Izumi, K.; Jacobson, M.; James, E.; Jang, H.; Jaranowski, P.; Ji, Y.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; K, Haris; Kalmus, P.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karlen, J.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, H.; Kawabe, K.; Kawazoe, F.; Kéfélian, F.; Keiser, G. M.; Keitel, D.; Kelley, D. B.; Kells, W.; Khalaidovski, A.; Khalili, F. Y.; Khazanov, E. A.; Kim, C.; Kim, K.; Kim, N.; Kim, N. G.; Kim, Y.-M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Klimenko, S.; Kline, J.; Koehlenbeck, S.; Kokeyama, K.; Kondrashov, V.; Koranda, S.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kremin, A.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, A.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Kwee, P.; Landry, M.; Lantz, B.; Larson, S.; Lasky, P. D.; Lawrie, C.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.-H.; Lee, H. K.; Lee, H. M.; Lee, J.; Leonardi, M.; Leong, J. R.; Le Roux, A.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B.; Lewis, J.; Li, T. G. F.; Libbrecht, K.; Libson, A.; Lin, A. C.; Littenberg, T. B.; Litvine, V.; Lockerbie, N. A.; Lockett, V.; Lodhia, D.; Loew, K.; Logue, J.; Lombardi, A. L.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J.; Lubinski, M. J.; Lück, H.; Luijten, E.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macarthur, J.; Macdonald, E. P.; MacDonald, T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magana-Sandoval, F.; Mageswaran, M.; Maglione, C.; Mailand, K.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Manca, G. M.; Mandel, I.; Mandic, V.; Mangano, V.; Mangini, N.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A.; Maros, E.; Marque, J.; Martelli, F.; Martin, I. W.; Martin, R. M.; Martinelli, L.; Martynov, D.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Matichard, F.; Matone, L.; Matzner, R. A.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McGuire, S. C.; McIntyre, G.; McIver, J.; McLin, K.; Meacher, D.; Meadors, G. D.; Mehmet, M.; Meidam, J.; Meinders, M.; Melatos, A.; Mendell, G.; Mercer, R. A.; Meshkov, S.; Messenger, C.; Meyers, P.; Miao, H.; Michel, C.; Mikhailov, E. E.; Milano, L.; Milde, S.; Miller, J.; Minenkov, Y.; Mingarelli, C. M. F.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moe, B.; Moesta, P.; Mohan, M.; Mohapatra, S. R. P.; Moraru, D.; Moreno, G.; Morgado, N.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Mukherjee, S.; Mullavey, A.; Munch, J.; Murphy, D.; Murray, P. G.; Mytidis, A.; Nagy, M. F.; Nanda Kumar, D.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nelemans, G.; Neri, I.; Neri, M.; Newton, G.; Nguyen, T.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Ochsner, E.; O'Dell, J.; Oelker, E.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oppermann, P.; O'Reilly, B.; O'Shaughnessy, R.; Osthelder, C.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Padilla, C.; Pai, A.; Palashov, O.; Palomba, C.; Pan, H.; Pan, Y.; Pankow, C.; Paoletti, F.; Paoletti, R.; Papa, M. A.; Paris, H.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Pedraza, M.; Penn, S.; Perreca, A.; Phelps, M.; Pichot, M.; Pickenpack, M.; Piergiovanni, F.; Pierro, V.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poeld, J.; Poggiani, R.; Poteomkin, A.; Powell, J.; Prasad, J.; Premachandra, S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L.; Puncken, O.; Punturo, M.; Puppo, P.; Qin, J.; Quetschke, V.; Quintero, E.; Quiroga, G.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Rácz, I.; Radkins, H.; Raffai, P.; Raja, S.; Rajalakshmi, G.; Rakhmanov, M.; Ramet, C.; Ramirez, K.; Rapagnani, P.; Raymond, V.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Reid, S.; Reitze, D. H.; Rhoades, E.; Ricci, F.; Riles, K.; Robertson, N. A.; Robinet, F.; Rocchi, A.; Rodruck, M.; Rolland, L.; Rollins, J. G.; Romano, R.; Romanov, G.; Romie, J. H.; Rosińska, D.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Salemi, F.; Sammut, L.; Sandberg, V.; Sanders, J. R.; Sannibale, V.; Santiago-Prieto, I.; Saracco, E.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Savage, R.; Scheuer, J.; Schilling, R.; Schnabel, R.; Schofield, R. M. S.; Schreiber, E.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shapiro, B.; Shawhan, P.; Shoemaker, D. H.; Sidery, T. L.; Siellez, K.; Siemens, X.; Sigg, D.; Simakov, D.; Singer, A.; Singer, L.; Singh, R.; Sintes, A. M.; Slagmolen, B. J. J.; Slutsky, J.; Smith, J. R.; Smith, M.; Smith, R. J. E.; Smith-Lefebvre, N. D.; Son, E. J.; Sorazu, B.; Souradeep, T.; Sperandio, L.; Staley, A.; Stebbins, J.; Steinlechner, J.; Steinlechner, S.; Stephens, B. C.; Steplewski, S.; Stevenson, S.; Stone, R.; Stops, D.; Strain, K. A.; Straniero, N.; Strigin, S.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Susmithan, S.; Sutton, P. J.; Swinkels, B.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tarabrin, S. P.; Taylor, R.; ter Braack, A. P. M.; Thirugnanasambandam, M. P.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, V.; Tokmakov, K. V.; Tomlinson, C.; Toncelli, A.; Tonelli, M.; Torre, O.; Torres, C. V.; Torrie, C. I.; Travasso, F.; Traylor, G.; Tse, M.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Urbanek, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van den Brand, J. F. J.; Van Den Broeck, C.; van der Putten, S.; van der Sluys, M. V.; van Heijningen, J.; van Veggel, A. A.; Vass, S.; Vasúth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Verkindt, D.; Verma, S. S.; Vetrano, F.; Viceré, A.; Vincent-Finley, R.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vousden, W. D.; Vyachanin, S. P.; Wade, A.; Wade, L.; Wade, M.; Walker, M.; Wallace, L.; Wang, M.; Wang, X.; Ward, R. L.; Was, M.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.; Wessels, P.; West, M.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Wiesner, K.; Wilkinson, C.; Williams, K.; Williams, L.; Williams, R.; Williams, T.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M.; Winkler, W.; Wipf, C. C.; Wiseman, A. G.; Wittel, H.; Woan, G.; Worden, J.; Yablon, J.; Yakushin, I.; Yamamoto, H.; Yancey, C. C.; Yang, H.; Yang, Z.; Yoshida, S.; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zendri, J.-P.; Zhang, Fan; Zhang, L.; Zhao, C.; Zhu, X. J.; Zucker, M. E.; Zuraw, S.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration

2014-09-01

We present the first results of an all-sky search for continuous gravitational waves from unknown spinning neutron stars in binary systems using LIGO and Virgo data. Using a specially developed analysis program, the TwoSpect algorithm, the search was carried out on data from the sixth LIGO science run and the second and third Virgo science runs. The search covers a range of frequencies from 20 Hz to 520 Hz, a range of orbital periods from 2 to ˜2,254 h and a frequency- and period-dependent range of frequency modulation depths from 0.277 to 100 mHz. This corresponds to a range of projected semimajor axes of the orbit from ˜0.6×10-3 ls to ˜6,500 ls assuming the orbit of the binary is circular. While no plausible candidate gravitational wave events survive the pipeline, upper limits are set on the analyzed data. The most sensitive 95% confidence upper limit obtained on gravitational wave strain is 2.3×10-24 at 217 Hz, assuming the source waves are circularly polarized. Although this search has been optimized for circular binary orbits, the upper limits obtained remain valid for orbital eccentricities as large as 0.9. In addition, upper limits are placed on continuous gravitational wave emission from the low-mass x-ray binary Scorpius X-1 between 20 Hz and 57.25 Hz.

Infiltration pattern in a regolith-fractured bedrock profile: field observation of a dye stain pattern

NASA Astrophysics Data System (ADS)

Kim, Jae Gon; Lee, Gyoo Ho; Lee, Jin-Soo; Chon, Chul-Min; Kim, Tack Hyun; Ha, Kyoochul

2006-02-01

We examined the infiltration pattern of water in a regolith-bedrock profile consisting of two overburdens (OB1 and OB2), a buried rice paddy soil (PS), two texturally distinctive weathered materials (WM1 and WM2) and a fractured sedimentary rock (BR), using a Brilliant Blue FCF dye tracer. A black-coloured coating in conducting fractures in WM1, WM2 and BR was analysed by X-ray diffraction and scanning electron microscopy. The dye tracer penetrated to greater than 2 m depth in the profile. The macropore flow and saturated interflow were the major infiltration patterns in the profile. Macropore flow and saturated interflow were observed along fractures in WM1, WM2 and BR and at the dipping interfaces of PS-WM1, PS-WM2 and PS-BR respectively. Heterogeneous matrix flow occurred in upper overburden (OB1) and PS. Compared with OB1, the coarser textured OB2 acted as a physical barrier for vertical flow of water. The PS with low bulk density and many fine roots was another major conducting route of water in the profile. Manganese oxide and iron oxide were positively identified in the black coating material and had low crystallinity and high surface area, indicating their high reactivity with conducting contaminants.

Imaging the seismic structure beneath oceanic spreading centers using ocean bottom geophysical techniques

NASA Astrophysics Data System (ADS)

Zha, Yang

This dissertation focuses on imaging the crustal and upper mantle seismic velocity structure beneath oceanic spreading centers. The goals are to provide a better understanding of the crustal magmatic system and the relationship between mantle melting processes, crustal architecture and ridge characteristics. To address these questions I have analyzed ocean bottom geophysical data collected from the fast-spreading East Pacific Rise and the back-arc Eastern Lau Spreading Center using a combination of ambient noise tomography and seafloor compliance analysis. To characterize the crustal melt distribution at fast spreading ridges, I analyze seafloor compliance - the deformation under long period ocean wave forcing - measured during multiple expeditions between 1994 and 2007 at the East Pacific Rise 9º - 10ºN segment. A 3D numerical modeling technique is developed and used to estimate the effects of low shear velocity zones on compliance measurements. The forward modeling suggests strong variations of lower crustal shear velocity along the ridge axis, with zones of possible high melt fractions beneath certain segments. Analysis of repeated compliance measurements at 9º48'N indicates a decrease of crustal melt fraction following the 2005 - 2006 eruption. This temporal variability provides direct evidence for short-term variations of the magmatic system at a fast spreading ridge. To understand the relationship between mantle melting processes and crustal properties, I apply ambient noise tomography of ocean bottom seismograph (OBS) data to image the upper mantle seismic structure beneath the Eastern Lau Spreading Center (ELSC). The seismic images reveal an asymmetric upper mantle low velocity zone (LVZ) beneath the ELSC, representing a zone of partial melt. As the ridge migrates away from the volcanic arc, the LVZ becomes increasingly offset and separated from the sub-arc low velocity zone. The separation of the ridge and arc low velocity zones is spatially coincident with the abrupt transition in crustal composition and ridge morphology. Therefore these results confirm a previous prediction that the changing interaction between the arc and back-arc magmatic systems is responsible for the abrupt change in crustal properties along the ELSC. I further investigate the crustal structure along and across the ELSC using seafloor compliance. Compliance measurements are inverted for local crustal shear velocity structure as well as sediment thickness at 30 OBS locations using a Monte Carlo method. Sediment increases asymmetrically with seafloor age, with much a higher rate to the east of the ridge. Along the ELSC, upper crustal velocities increase from south to north as the ridge migrates away from the volcanic arc front, consistent with a less porous upper crust with possibly less subduction input. Furthermore, average upper crust shear velocities for crust produced at past ELSC when it was near the volcanic arc are considerably slower than crust produced at present day northern ELSC. I show that the implications of previous active seismic studies in the axial ELSC can be extended much farther off-axis and back in time. I also address a challenge of ocean bottom seismology and develop a new method for determining OBS horizontal orientations using multi-component ambient noise correlation. I demonstrate that the OBS orientations can be robustly estimated through maximizing the correlation between the diagonal and cross terms of the noise correlation function. This method is applied to the ELSC OBS experiment dataset and the obtained orientations are consistent with results from a conventional teleseismic method. The new method is promising for a wide range of applications.

Bias correction of surface downwelling longwave and shortwave radiation for the EWEMBI dataset

NASA Astrophysics Data System (ADS)

Lange, Stefan

2018-05-01

Many meteorological forcing datasets include bias-corrected surface downwelling longwave and shortwave radiation (rlds and rsds). Methods used for such bias corrections range from multi-year monthly mean value scaling to quantile mapping at the daily timescale. An additional downscaling is necessary if the data to be corrected have a higher spatial resolution than the observational data used to determine the biases. This was the case when EartH2Observe (E2OBS; Calton et al., 2016) rlds and rsds were bias-corrected using more coarsely resolved Surface Radiation Budget (SRB; Stackhouse Jr. et al., 2011) data for the production of the meteorological forcing dataset EWEMBI (Lange, 2016). This article systematically compares various parametric quantile mapping methods designed specifically for this purpose, including those used for the production of EWEMBI rlds and rsds. The methods vary in the timescale at which they operate, in their way of accounting for physical upper radiation limits, and in their approach to bridging the spatial resolution gap between E2OBS and SRB. It is shown how temporal and spatial variability deflation related to bilinear interpolation and other deterministic downscaling approaches can be overcome by downscaling the target statistics of quantile mapping from the SRB to the E2OBS grid such that the sub-SRB-grid-scale spatial variability present in the original E2OBS data is retained. Cross validations at the daily and monthly timescales reveal that it is worthwhile to take empirical estimates of physical upper limits into account when adjusting either radiation component and that, overall, bias correction at the daily timescale is more effective than bias correction at the monthly timescale if sampling errors are taken into account.

Fine and gross motor skills differ between healthy-weight and obese children.

PubMed

Gentier, Ilse; D'Hondt, Eva; Shultz, Sarah; Deforche, Benedicte; Augustijn, Mireille; Hoorne, Sofie; Verlaecke, Katja; De Bourdeaudhuij, Ilse; Lenoir, Matthieu

2013-11-01

Within the obesity literature, focus is put on the link between weight status and gross motor skills. However, research on fine motor skills in the obese (OB) childhood population is limited. Therefore, the present study focused on possible weight related differences in gross as well as fine motor skill tasks. Thirty-four OB children (12 ♀ and 22 ♂, aged 7-13 years) were recruited prior to participating in a multidisciplinary treatment program at the Zeepreventorium (De Haan, Belgium). Additionally, a control group of 34 age and gender-matched healthy-weight (HW) children was included in the study. Anthropometric measures were recorded and gross and fine motor skills were assessed using the Bruininks-Oseretsky Test of Motor Proficiency, second edition (BOT-2). Results were analyzed by independent samples t-tests, multivariate analysis of variance, and a chi-squared test. Being OB was detrimental for all subtests evaluating gross motor skill performance (i.e., upper-limb coordination, bilateral coordination, balance, running speed and agility, and strength). Furthermore, OB children performed worse in fine motor precision and a manual dexterity task, when compared to their HW peers. No group differences existed for the fine motor integration task. Our study provides evidence that lower motor competence in OB children is not limited to gross motor skills alone; OB children are also affected by fine motor skill problems. Further investigation is warranted to provide possible explanations for these differences. It is tentatively suggested that OB children experience difficulties with the integration and processing of sensory information. Future research is needed to explore whether this assumption is correct and what the underlying mechanism(s) could be. Copyright © 2013 Elsevier Ltd. All rights reserved.

Convective radiation fluid-dynamics: formation and early evolution of ultra low-mass objects

NASA Astrophysics Data System (ADS)

Wuchterl, G.

2005-12-01

The formation process of ultra low-mass objects is some kind of extension of the star formation process. The physical changes towards lower mass are discussed by investigating the collapse of cloud cores that are modelled as Bonnor-Ebert spheres. Their collapse is followed by solving the equations of fluid dynamics with radiation and a model of time-dependent convection that has been calibrated to the Sun. For a sequence of cloud-cores with 1 to 0.01 solar masses, evolutionary tracks and isochrones are shown in the mass-radius diagram, the Hertzsprung-Russel diagram and the effective temperature-surface gravity or Kiel diagram. The collapse and the early hydrostatic evolution to ages of few Ma are briefly discussed and compared to observations of objects in Upper Scorpius and the low-mass components of GG Tau.

Comet ISON Swoops Around the Sun

NASA Image and Video Library

2013-12-02

Comet ISON swoops around the sun and through Scorpius. This composite merges an SDO AIA 171 sun image (Nov. 28, 2214 UT), SOHO C2 (2036 UT) and C3 (2030 UT) images, and a DSS view of the sky in northern Scorpius. Credit: NASA/ESA/SOHO, NASA/SDO, DSS, and Francis Reddy NASA image use policy. NASA Goddard Space Flight Center enables NASA’s mission through four scientific endeavors: Earth Science, Heliophysics, Solar System Exploration, and Astrophysics. Goddard plays a leading role in NASA’s accomplishments by contributing compelling scientific knowledge to advance the Agency’s mission. Follow us on Twitter Like us on Facebook Find us on Instagram

Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

PubMed

Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

1986-12-30

The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

Orienting Ocean Bottom Seismic Sensors from Ship Noise Polarization Analysis

NASA Astrophysics Data System (ADS)

Barruol, Guilhem; Dreo, Richard; Fontaine, Fabrice R.; Scholz, John R.; Sigloch, Karin; Geay, Bruno; Bouillon, Alexandre

2017-04-01

For the RHUM-RUM project (Réunion Hotspot and Upper Mantle - Réunions Unterer Mantel, www.rhum-rum.net), a network of 57 ocean-bottom seismometers (OBS) was installed on the ocean floor around La Réunion Island in the SW Indian Ocean. Part of the network happened to be located beneath a route of heavy ship traffic connecting SE-Asia and the South-Atlantic region. We analysed the ship noise recorded on the OBS and show that it can be used for determining the horizontal orientations of the seismic instruments as they were recording on the ocean floor. The OBS, provided by the German DEPAS and the French INSU OBS national pools, were equipped with wide-band or broad-band three-components seismic and hydro-acoustic sensors. They were deployed in Nov. 2012 by R/V Marion Dufresne and recovered by R/V Meteor one year later. Depending on the configuration, the OBS recorded for 8 to 13 months. By combining the trajectories of passing ships - provided by AIS (Automatic Identification system) GPS data - with our geophysical data recorded on the ocean floor, we show that both hydro-acoustic and seismic spectral analyses exhibit clear signals associated with vessels between 1 and 50 Hz, in the high-frequency range of our instruments. Large cargo vessels are detected several hours before and after their closest point of approach (CPA) and show clear Doppler effects which put quantitative constraints on their distances and speeds. By analysing the continuous noise polarization on the three seismic components, we show that the polarization of the noise emitted by ships passing in the neighbourhood of an ocean-bottom seismometer can be used for retrieving the orientation of the OBS horizontal components on the ocean floor with respect to the geographic reference frame. We find good agreement between OBS orientations thus calculated from ship noise and the OBS orientations determined independently from teleseismic body and surface wave polarization methods (Scholz et al., GJI, 2017).

Three-Dimensional Slowness Images of the Upper Crust Beneath the Lucky Strike Hydrothermal Vent Sites

NASA Astrophysics Data System (ADS)

Seher, T.; Crawford, W.; Singh, S.; Canales, J. P.; Combier, V.; Cannat, M.; Carton, H.; Dusunur, D.; Escartin, J.; Miranda, M. J.; Pouillet-Erguy, A.

2005-12-01

In June-July 2005 we carried out the SISMOMAR cruise, as part of the MOMAR project (Monitoring the Mid-Atlantic Ridge). Within this cruise, we conducted a 3D seismic reflection survey over an 18 km km x 3.8 km area covering both the Lucky Strike volcano and hydrothermal vents field. In order to have a full coverage inside the 3D box, shots continued for 2.25 km on either side of the box and extended out to the median valley bounding faults. To complement the streamer measurements 25 Ocean Bottom Seismometers (OBS) were placed in an 18 km x 18 km area. 11 OBS positions lie inside the 3D box and can be used to determine a very detailed image of the 3D velocity structure beneath the Lucky Strike volcano and hydrothermal vents field. For the 3D box a tuned array of 14 air guns (2600 cubic inches) was fired at an interval of 37.5 m for a total of 39 lines. We will present the first results of the OBS measurements near the Lucky Strike volcano. As a first step towards a joint 3D travel time and slowness (the inverse of velocity at turning depth) tomography, we present the 3D slowness function (latitude, longitude, offset), which can be considered as a 3D brute stack velocity image of the sub-surface (c.f. Barton and Edwards, 1999). The presence of fluid in the upper crust due to hydrothermal circulation should appear as a low velocity anomaly beneath the hydrothermal vents. In the next step the OBS measurements will be used to corroborate the reflection images of layer 2A observed in the streamer data for the 3D box. The OBS inside the 3D box recorded turning ray arrivals from the upper crust at a very fine sampling interval (37.5 m x 100 m) over a large azimuth. This provides the unique opportunity for jointly inverting travel time and slowness. Hence the measurements contain information on local gradients and should provide a very detailed velocity model of the subsurface, including information on hydrothermal systems and a possilbe anisotropy (e.g. Cherret and Singh, 1999). References: P. Barton, R. Edwards: Velocity imaging by tau-p transformation, LITHOS Science Report, 1999, 1, 67-75. A. Cherrett, S. Singh: 3D anisotropic models from multi-component data, LITHOS Science Report, 1999, 1, 29-34.

A Thermal Infrared Imaging Study of Very Low Mass, Wide-separation Brown Dwarf Companions to Upper Scorpius Stars: Constraining Circumstellar Environments

NASA Astrophysics Data System (ADS)

Bailey, Vanessa; Hinz, Philip M.; Currie, Thayne; Su, Kate Y. L.; Esposito, Simone; Hill, John M.; Hoffmann, William F.; Jones, Terry; Kim, Jihun; Leisenring, Jarron; Meyer, Michael; Murray-Clay, Ruth; Nelson, Matthew J.; Pinna, Enrico; Puglisi, Alfio; Rieke, George; Rodigas, Timothy; Skemer, Andrew; Skrutskie, Michael F.; Vaitheeswaran, Vidhya; Wilson, John C.

2013-04-01

We present a 3-5 μm LBT/MMT adaptive optics imaging study of three Upper Scorpius stars with brown dwarf (BD) companions with very low masses/mass ratios (M BD <25 M Jup; M BD/M sstarf ≈ 1%-2%) and wide separations (300-700 AU): GSC 06214, 1RXS 1609, and HIP 78530. We combine these new thermal IR data with existing 1-4 μm and 24 μm photometry to constrain the properties of the BDs and identify evidence for circumprimary/circumsecondary disks in these unusual systems. We confirm that GSC 06214B is surrounded by a disk, further showing that this disk produces a broadband IR excess due to small dust near the dust sublimation radius. An unresolved 24 μm excess in the system may be explained by the contribution from this disk. 1RXS 1609B exhibits no 3-4 μm excess, nor does its primary; however, the system as a whole has a modest 24 μm excess, which may come from warm dust around the primary and/or BD. Neither object in the HIP 78530 system exhibits near- to mid-IR excesses. We additionally find that the 1-4 μm colors of HIP 78530B match a spectral type of M3 ± 2, inconsistent with the M8 spectral type assigned based on its near-IR spectrum, indicating that it may be a low-mass star rather than a BD. We present new upper limits on additional low-mass companions in the system (<5 M Jup beyond 175 AU). Finally, we examine the utility of circumsecondary disks as probes of the formation histories of wide BD companions, finding that the presence of a disk may disfavor BD formation near the primary with subsequent outward scattering. Observations reported here were obtained at the LBT and MMT Observatories. The MMT Observatory is a joint facility of the University of Arizona and the Smithsonian Institution. The LBT is an international collaboration among institutions in the United States, Italy, and Germany. LBT Corporation partners are: The University of Arizona on behalf of the Arizona university system; Istituto Nazionale di Astrofisica, Italy; LBT Beteiligungsgesellschaft, Germany, representing the Max-Planck Society, the Astrophysical Institute Potsdam, and Heidelberg University; The Ohio State University; and The Research Corporation, on behalf of The University of Notre Dame, University of Minnesota, and University of Virginia.

Lessons from the Short GRB 170817A: The First Gravitational-wave Detection of a Binary Neutron Star Merger

NASA Astrophysics Data System (ADS)

Granot, Jonathan; Guetta, Dafne; Gill, Ramandeep

2017-12-01

The first, long-awaited, detection of a gravitational-wave (GW) signal from the merger of a binary neutron star (NS-NS) system was finally achieved (GW170817) and was also accompanied by an electromagnetic counterpart—the short-duration gamma-ray burst (GRB) 170817A. It occurred in the nearby (D≈ 40 Mpc) elliptical galaxy NGC 4993 and showed optical, IR, and UV emission from half a day up to weeks after the event, as well as late-time X-ray (at ≥slant 8.9 days) and radio (at ≥slant 16.4 days) emission. There was a delay of {{Δ }}t≈ 1.74 {{s}} between the GW merger chirp signal and the prompt GRB emission onset, and an upper limit of {θ }{obs}< 28^\\circ was set on the viewing angle w.r.t the jet’s symmetry axis from the GW signal. In this letter we examine some of the implications of these groundbreaking observations. The delay {{Δ }}t sets an upper limit on the prompt GRB emission radius, {R}γ ≲ 2c{{Δ }}t/{({θ }{obs}-{θ }0)}2, for a jet with sharp edges at an angle {θ }0< {θ }{obs}. GRB 170817A’s relatively low isotropic equivalent γ-ray energy output may suggest a viewing angle slightly outside the jet’s sharp edge, {θ }{obs}-{θ }0˜ {(0.05-0.1)({{Γ }}/100)}-1, but its peak ν {F}ν photon energy and afterglow emission suggest instead that the jet does not have sharp edges and the prompt emission was dominated by less energetic material along our line of sight, at {θ }{obs}≳ 2{θ }0. Finally, we consider the type of remnant that is produced by the NS-NS merger and find that a relatively long-lived (> 2 s) massive NS is strongly disfavored, while a hyper-massive NS of lifetime ˜ 1 {{s}} appears to be somewhat favored over the direct formation of a black hole.

Earth's crust model of the South-Okhotsk Basin by wide-angle OBS data

NASA Astrophysics Data System (ADS)

Kashubin, Sergey N.; Petrov, Oleg V.; Rybalka, Alexander V.; Milshtein, Evgenia D.; Shokalsky, Sergey P.; Verba, Mark L.; Petrov, Evgeniy O.

2017-07-01

Deep seismic studies of the Sea of Okhotsk region started in late 1950s. Since that time, wide-angle reflection and refraction data on more than two dozen profiles were acquired. Only five of those profiles either crossed or entered the deep-water area of the South-Okhotsk Basin (also known as the Kuril Basin or the South-Okhotsk Deep-Water Trough). Only P-waves were used to develop velocity-interface models in all the early research. Thus, all seismic and geodynamic models of the Okhotsk region were based only on the information on compressional waves. Nevertheless, the use of Vp/Vs ratio in addition to P-wave velocity allows discriminating felsic and mafic crustal layers with similar Vp values. In 2007 the Russian seismic service company Sevmorgeo acquired multi-component data with ocean bottom seismometers (OBS) along the 1700-km-long north-south 2-DV-M Profile. Only P-wave information was used previously to develop models for the entire profile. In this study, a multi-wave processing, analysis, and interpretation of the OBS data are presented for the 550-km-long southern segment of this Profile that crosses the deep-water South-Okhotsk Basin. Within this segment 50 seismometers were deployed with nominal OBS station spacing of 10-12 km. Shot point spacing was 250 m. Not only primary P-waves and S-waves but also multiples and P-S, S-P converted waves were analyzed in this study to constrain velocity-interface models by means of travel time forward modeling. In offshore deep seismic studies, thick water layer hinders an estimation of velocities in the sedimentary cover and in the upper consolidated crust. Primarily, this is due to the fact that refracted waves propagating in low-velocity solid upper layers interfere with high-amplitude direct water wave. However, in multi-component measurements with ocean bottom seismometers, it is possible to use converted and multiple waves for velocity estimations in these layers. Consequently, one can obtain P- and S-waves velocity models of the sedimentary strata and the upper consolidated crust. Velocity values in the upper consolidated crust beneath the South-Okhotsk Basin (Vp = 5.50-5.80 km/s, Vp/Vs = 1.74-1.76) allow interpretation of this 2.5-3.5-km-thick layer to be consistent with a felsic (granodioritic) crust. These results suggest that the Earth's crust in this region can be considered continental in nature, rather than previously accepted oceanic crust. Even though, the crust is thinned and stretched at this location.

Hard X-ray Flux from Low-Mass Stars in the Cygnus OB2 Association

NASA Astrophysics Data System (ADS)

Caramazza, M.; Drake, J. J.; Micela, G.; Flaccomio, E.

2009-05-01

We investigate the X-ray emission in the 20-40 keV band expected from the flaring low-mass stellar population in Cygnus OB2 assuming that the observed soft X-ray emission is due to a superposition of flares and that the ratio of hard X-ray to soft X-ray emission is described by a scaling found for solar flares by Isola and co-workers. We estimate a low-mass stellar hard X-ray flux in the 20-40 keV band in the range ~7×1031-7×1033 erg/s and speculate the limit of this values. Hard X-ray emission could lie at a level not much below the current observed flux upper limits for Cygnus OB2. Simbol-X, with its broad energy band (10-100 keV) and its sensitivity should be able to detect this emission and would provide insights into the hard X-ray production of flares on pre-main sequence stars.

Thermal dependence of cardiac function in arctic fish: implications of a warming world.

PubMed

Franklin, Craig E; Farrell, Anthony P; Altimiras, Jordi; Axelsson, Michael

2013-11-15

With the Arctic experiencing one of the greatest and most rapid increases in sea temperatures in modern time, predicting how Arctic marine organisms will respond to elevated temperatures has become crucial for conservation biology. Here, we examined the thermal sensitivity of cardiorespiratory performance for three closely related species of sculpins that inhabit the Arctic waters, two of which, Gymnocanthus tricuspis and Myoxocephalus scorpioides, have adapted to a restricted range within the Arctic, whereas the third species, Myoxocephalus scorpius, has a wider distribution. We tested the hypothesis that the fish restricted to Arctic cold waters would show reduced cardiorespiratory scope in response to an increase in temperature, as compared with the more eurythermal M. scorpius. As expected from their biogeography, M. scorpioides and G. tricuspis maximised cardiorespiratory performance at temperatures between 1 and 4°C, whereas M. scorpius maximised performance over a wider range of temperatures (1-10°C). Furthermore, factorial scope for cardiac output collapsed at elevated temperature for the two high-latitude species, negatively impacting their ability to support aerobically driven metabolic processes. Consequently, these results concurred with our hypothesis, suggesting that the sculpin species restricted to the Arctic are likely to be negatively impacted by increases in ocean temperatures.

On the Binary Nature of Massive Blue Hypergiants: High-resolution X-Ray Spectroscopy Suggests That Cyg OB2 12 is a Colliding Wind Binary

NASA Astrophysics Data System (ADS)

Oskinova, L. M.; Huenemoerder, D. P.; Hamann, W.-R.; Shenar, T.; Sander, A. A. C.; Ignace, R.; Todt, H.; Hainich, R.

2017-08-01

The blue hypergiant Cyg OB2 12 (B3Ia+) is a representative member of the class of very massive stars in a poorly understood evolutionary stage. We obtained its high-resolution X-ray spectrum using the Chandra observatory. PoWR model atmospheres were calculated to provide realistic wind opacities and to establish the wind density structure. We find that collisional de-excitation is the dominant mechanism depopulating the metastable upper levels of the forbidden lines of the He-like ions Si xiv and Mg xii. Comparison between the model and observations reveals that X-ray emission is produced in a dense plasma, which could reside only at the photosphere or in a colliding wind zone between binary components. The observed X-ray spectra are well-fitted by thermal plasma models, with average temperatures in excess of 10 MK. The wind speed in Cyg OB2 12 is not high enough to power such high temperatures, but the collision of two winds in a binary system can be sufficient. We used archival data to investigate the X-ray properties of other blue hypergiants. In general, stars of this class are not detected as X-ray sources. We suggest that our new Chandra observations of Cyg OB2 12 can be best explained if Cyg OB2 12 is a colliding wind binary possessing a late O-type companion. This makes Cyg OB2 12 only the second binary system among the 16 known Galactic hypergiants. This low binary fraction indicates that the blue hypergiants are likely products of massive binary evolution during which they either accreted a significant amount of mass or already merged with their companions.

On the Binary Nature of Massive Blue Hypergiants: High-resolution X-Ray Spectroscopy Suggests That Cyg OB2 12 is a Colliding Wind Binary

DOE Office of Scientific and Technical Information (OSTI.GOV)

Oskinova, L. M.; Hamann, W.-R.; Shenar, T.

The blue hypergiant Cyg OB2 12 (B3Ia{sup +}) is a representative member of the class of very massive stars in a poorly understood evolutionary stage. We obtained its high-resolution X-ray spectrum using the Chandra observatory. PoWR model atmospheres were calculated to provide realistic wind opacities and to establish the wind density structure. We find that collisional de-excitation is the dominant mechanism depopulating the metastable upper levels of the forbidden lines of the He-like ions Si xiv and Mg xii. Comparison between the model and observations reveals that X-ray emission is produced in a dense plasma, which could reside only atmore » the photosphere or in a colliding wind zone between binary components. The observed X-ray spectra are well-fitted by thermal plasma models, with average temperatures in excess of 10 MK. The wind speed in Cyg OB2 12 is not high enough to power such high temperatures, but the collision of two winds in a binary system can be sufficient. We used archival data to investigate the X-ray properties of other blue hypergiants. In general, stars of this class are not detected as X-ray sources. We suggest that our new Chandra observations of Cyg OB2 12 can be best explained if Cyg OB2 12 is a colliding wind binary possessing a late O-type companion. This makes Cyg OB2 12 only the second binary system among the 16 known Galactic hypergiants. This low binary fraction indicates that the blue hypergiants are likely products of massive binary evolution during which they either accreted a significant amount of mass or already merged with their companions.« less

Young Brown Dwarfs and Giant Planets as Companions to Weak-Line T Tauri Stars

NASA Astrophysics Data System (ADS)

Brandner, Wolfgang; Frink, Sabine; Kohler, Rainer; Kunkel, Michael

Weak-line T Tauri stars, contrary to classical T Tauri stars, no longer possess massive circumstellar disks. In weak-line T Tauri stars, the circumstellar matter was either accreted onto the T Tauri star or has been redistributed. Disk instabilities in the outer disk might result in the formation of brown dwarfs and giant planets. Based on photometric and spectroscopic studies of ROSAT sources, we have selected an initial sample of 200 weak-line T Tauri stars in the Chamaeleon T association and the Scorpius-Centaurus OB association. In the course of follow-up observations, we identified visual and spectroscopic binary stars and excluded them from our final list, as the complex dynamics and gravitational interaction in binary systems might aggravate or even completely inhibit the formation of planets (depending on physical separation of the binary components and their mass ratio). The membership of individual stars to the associations was established from proper motion studies and radial velocity surveys. Our final sample consists of 70 single weak-line T Tauri stars. We have initiated a program to spatially resolve young brown dwarfs and young giant planets as companions to single weak-line T Tauri stars using adaptive optics at the ESO 3.6 m telescope and HST/NICMOS. In this poster we describe the observing strategy and present first results of our adaptive optics observations. An update on the program status can be found at http://www.astro.uiuc.edu/~brandner/text/bd/bd.html

Astronomers Trace Microquasar's Path Back in Time

NASA Astrophysics Data System (ADS)

2003-01-01

Astronomers have traced the orbit through our Milky Way Galaxy of a voracious neutron star and a companion star it is cannibalizing, and conclude that the pair joined more than 30 million years ago and probably were catapulted out of a cluster of stars far from the Galaxy's center. Path of Microquasar and Sun Path of Microquasar (red) and Sun (yellow) through the Milky Way Galaxy for the past 230 million years. Animations: GIF Version MPEG Version CREDIT: Mirabel & Rodrigues, NRAO/AUI/NSF The pair of stars, called Scorpius X-1, form a "microquasar," in which material sucked from the "normal" star forms a rapidly-rotating disk around the superdense neutron star. The disk becomes so hot it emits X-rays, and also spits out "jets" of subatomic particles at nearly the speed of light. Using precise positional data from the National Science Foundation's Very Long Baseline Array (VLBA) and from optical telescopes, Felix Mirabel, an astrophysicist at the Institute for Astronomy and Space Physics of Argentina and French Atomic Energy Commission, and Irapuan Rodrigues, also of the French Atomic Energy Commission, calculated that Scorpius X-1 is not orbiting the Milky Way's center in step with most other stars, but instead follows an eccentric path far above and below the Galaxy's plane. Scorpius X-1, discovered with a rocket-borne X-ray telescope in 1962, is about 9,000 light-years from Earth. It is the brightest continuous source of X-rays beyond the Solar System. The 1962 discovery and associated work earned a share of the 2002 Nobel Prize in physics for Riccardo Giacconi. Mirabel and Rodrigues used a number of published observations to calculate the path of Scorpius X-1 over the past few million years. "This is the most accurate determination we have made of the path of an X-ray binary," said Mirabel. By tracing the object's path backward in time, the scientists were able to conclude that the neutron star and its companion have been traveling together for more than 30 million years. They also speculated on the birthplace of Scorpius X-1. "The neutron star, which is the remnant left over from the supernova explosion of an even more massive star, either came from the Milky Way's disk, or from a globular cluster at a considerable distance from the disk," said Rodrigues. Globular clusters are clumps of millions of stars in the outskirts of the Galaxy. If it came from the Galaxy's disk, the scientists say, it would have had to receive a powerful one-sided "kick" from the supernova explosion to get into its present eccentric orbit. While this is possible, they conclude that a more likely scenario is that the neutron star came from a globular cluster. "Probably, this neutron star picked up its companion and was thrown out of its globular cluster by a close encounter with other stars at the cluster's core," Mirabel said. The scientists published their results in the January 30 issue of the journal Astronomy and Astrophysics. The same pair of researchers traced a similar path of a black hole and its companion star in 2001. Also that year, other astronomers produced a "movie" showing motions in the jet of material ejected from the disk around Scorpius X-1's neutron star. The National Radio Astronomy Observatory is a facility of the National Science Foundation, operated under cooperative agreement by Associated Universities, Inc.

Triggering risk factors of the burnout syndrome in OB/GYN physicians from a reference public university of Brazil.

PubMed

Ferreira Bortoletti, Fátima; Teresa Benevides-Pereira, Ana Maria; Vasconcellos, Esdras Guerreiro; Siqueira, José Oliveira; Araujo Júnior, Edward; Nardozza, Luciano Marcondes Machado; Sebastiani, Ricardo Werner; Moron, Antonio Fernandes

2012-01-01

Objective. To identify the risk factors to the development of Burnout Syndrome in Ob/Gyn Brazilian physicians in four dimensions: emotional exhaustion (EE), professional repression (PR), dehumanization (De), and emotional distancing (EmD). Methods. A prospective cross-sectional study was realized with 48 Ob/Gyn physicians (12 lecturers, 12 attending physicians, 12 medical residents, and 12 graduate students) from Department of Obstetrics, São Paulo Federal University (UNIFESP). We used a sociodemographic questionnaire focusing on the activities (administrative, educational, healthcare, and research). We applied a Burnout Syndrome Inventory (BSI) composed of two parts: triggering factors (ISB1) and the Burnout Syndrome (ISB2). The ISB1 is composed of two scales: positive organizational conditions (POC) and negative organizational conditions (NOC). The ISB2 is composed of four scales: EE, PR, De, and EmD. Results. We observed a rate below and above average to POC and NOC, respectively. The dimensions recorded a level above average to EE, an index at the upper limit of the average to De, a median index to EmD, and a median index to PR. Conclusions. The Ob/Gyn physicians are in an area of vulnerability for the development of Burnout Syndrome due to the high level of EE and De, associated with a median index of PR. The high rate of NOC contributes to the triggering of this scenery.

Triggering Risk Factors of the Burnout Syndrome in Ob/Gyn Physicians from a Reference Public University of Brazil

PubMed Central

Ferreira Bortoletti, Fátima; Teresa Benevides-Pereira, Ana Maria; Vasconcellos, Esdras Guerreiro; Siqueira, José Oliveira; Araujo Júnior, Edward; Nardozza, Luciano Marcondes Machado; Sebastiani, Ricardo Werner; Moron, Antonio Fernandes

2012-01-01

Objective. To identify the risk factors to the development of Burnout Syndrome in Ob/Gyn Brazilian physicians in four dimensions: emotional exhaustion (EE), professional repression (PR), dehumanization (De), and emotional distancing (EmD). Methods. A prospective cross-sectional study was realized with 48 Ob/Gyn physicians (12 lecturers, 12 attending physicians, 12 medical residents, and 12 graduate students) from Department of Obstetrics, São Paulo Federal University (UNIFESP). We used a sociodemographic questionnaire focusing on the activities (administrative, educational, healthcare, and research). We applied a Burnout Syndrome Inventory (BSI) composed of two parts: triggering factors (ISB1) and the Burnout Syndrome (ISB2). The ISB1 is composed of two scales: positive organizational conditions (POC) and negative organizational conditions (NOC). The ISB2 is composed of four scales: EE, PR, De, and EmD. Results. We observed a rate below and above average to POC and NOC, respectively. The dimensions recorded a level above average to EE, an index at the upper limit of the average to De, a median index to EmD, and a median index to PR. Conclusions. The Ob/Gyn physicians are in an area of vulnerability for the development of Burnout Syndrome due to the high level of EE and De, associated with a median index of PR. The high rate of NOC contributes to the triggering of this scenery. PMID:23304541

Skyscape of an Amazonian Diaspora: Arawak Astronomy in Historical Comparative Perspective

NASA Astrophysics Data System (ADS)

Jara, Fabiola

The title of this article "Arawak Astronomy" suggests that the research matter concerns the astronomy of an already well-defined ethnographic entity. This however does not do justice to the complexities of Arawak (pre)history. This contribution aims to discuss and connect the available historical and ethnographic data on Arawak astronomies as gathered by the author (Jara 2000), with the most recent research on the archeology and comparative linguistics of the Arawak diaspora. The article argues that Arawak astronomy has to be related to the cultural and sociopolitical continuities and discontinuities of the Arawak diaspora throughout the lowlands of tropical South America. This article recognizes the need to consider Arawak astronomy has an object to be discovered and explained within its local and regional contexts. Notwithstanding these remarks, based on a sustained examination of ethnohistorical and ethnographic sources, this article proposes that Arawak astronomy can be characterized by at least four elements: firstly, a horizon system of observation which combines the observation of the solar solstices and equinoxes with the near heliacal and near cosmic rising or setting of at least seven star groups - the Pleiades, the Hyades, the upper stars of the constellation of Scorpius (including α Sco), Corvus, the Belt of Orion, several stars near Sirius, and the Milky Way. Secondly, the association of the rising and setting of these star groups with the seasonal cycle, mainly with the start and/or of the end of rainy and dry seasons. Thirdly, the widespread association of the stars of the year (most commonly the Pleiades but sometimes Orion or the head of Scorpius) with the beginning of the agricultural cycle and consequently with the end of the heavy rains announcing the time to plant the new fields. The last and fourth commonality are the inscriptions or markings of the origin of the stars in the local landscape, lakes, mountains, and other salient landscape features.

A new oxygen barrier film reduces aerobic deterioration in farm-scale corn silage.

PubMed

Borreani, G; Tabacco, E; Cavallarin, L

2007-10-01

Recently, many studies have focused on the aerobic deterioration of corn silage at the farm level, because a large part of the product stored in horizontal silos is exposed to air and is more prone to spoilage. The most important factor influencing the preservation of forage ensiling is the degree of anaerobiosis that is usually achieved with sheets of polyethylene. A new black-on-white (125-microm) coextruded oxygen barrier (OB) film has been developed for silage sealing and was tested in the present experiment to assess the effects on fermentation quality, dry matter losses, and yeast and mold counts at opening of whole-crop corn bunker silos compared with conventional polyethylene (ST) film. Two trials were carried out on 2 commercial farms. The bunkers were divided into 2 parts along the length so that half of the feedout face would be covered with ST film and the other half with OB film. Eight plastic net bags with well-mixed fresh material were weighed and buried in the upper layer of the bunker, and 4 bags were buried in the central part. The silos were opened for summer consumption and were fed out at different rates (19 vs. 33 cm/d). The bags were unloaded, weighed, and subsampled to analyze the DM content, pH, lactic and monocarboxylic acids, ammonia, yeast and mold counts, and aerobic stability. The pH of the peripheral silage was different under the 2 films, with a lower value in the OB treatment. The OB film on farm 1 affected the silage dry matter losses, which were reduced 3.7 times in comparison with the ST film sealing. On farm 2, although the dry matter losses were numerically higher in the silage sealed with the ST film compared with OB film (9.0 vs. 5.9%, respectively), the difference was not statistically significant. However, the corn silage sealed with the ST film was less stable than the silage sealed with the OB film. The results indicate that the new OB film is a promising tool to constrain spoilage and dry matter losses under critical farm conditions, when inadequate amounts of silage are removed daily. The OB film further improved the stability of the corn silage in the peripheral areas of the silos even when a proper harvest-to-feedout management was implemented.

Distribution of global fallouts cesium-137 in taiga and tundra catenae at the Ob River basin

NASA Astrophysics Data System (ADS)

Semenkov, I. N.; Usacheva, A. A.; Miroshnikov, A. Yu.

2015-03-01

The classification of soil catenae at the Ob River basin is developed and applied. This classification reflects the diverse geochemical conditions that led to the formation of certain soil bodies, their combinations and the migration fields of chemical elements. The soil and geochemical diversity of the Ob River basin catenae was analyzed. The vertical and lateral distribution of global fallouts cesium-137 was studied using the example of the four most common catenae types in Western Siberia tundra and taiga. In landscapes of dwarf birches and dark coniferous forests on gleysols, cryosols, podzols, and cryic-stagnosols, the highest 137Cs activity density and specific activity are characteristic of the upper soil layer of over 30% ash, while the moss-grass-shrub cover is characterized by low 137Cs activity density and specific activity. In landscapes of dwarf birches and pine woods on podzols, the maximum specific activity of cesium-137 is typical for moss-grass-shrub cover, while the maximum reserves are concentrated in the upper soil layer of over 30% ash. Bog landscapes and moss-grass-shrub cover are characterized by a minimum activity of 137Cs, and its reserves in soil generally decrease exponentially with depth. The cesium-137 penetration depth increases in oligotrophic histosols from northern to middle taiga landscapes from 10-15 to 40 cm. 137Cs is accumulated in oligotrophic histosols for increases in pH from 3.3 to 4.0 and in concretionary interlayers of pisoplinthic-cryic-histic-stagnosols. Cryogenic movement, on the one hand, leads to burying organic layers enriched in 137Cs and, on the other hand, to deducing specific activity when mixed with low-active material from lower soil layers.

Long-term skeletal and dental changes in patients with cleft lip and palate after maxillary distraction: a report of three cases treated with a rigid external distraction device.

PubMed

Harada, Kiyoshi; Sato, Masaru; Omura, Ken

2005-04-01

We examined long-term skeletal and dental changes in three patients with cleft lip and palate who underwent maxillary distraction using a rigid external distraction device. Two were children, and one was an adult. Changes in the overjet (OJ), overbite (OB), and positions of the anterior nasal spine (ANS), upper incisors (U1), pogonion (Pog), and lower incisors (L1) were measured on preoperative to 36 months postoperative lateral-cephalograms. In the adult, the positions of all examination points were relatively stable from 6 to 36 months postoperatively, and the OJ and OB were maintained at over 2 mm at 36 months. In the children, the positions of ANS and U1 changed inferiorly, Pog and L1 changed anteroinferiorly, and OJ and OB tended to decrease from 6 to 36 months postoperatively. Long-term skeletal and dental stability following maxillary distraction was relatively well maintained in the adult patient. In the children, the maxillomandibular growth was observed after maxillary distraction, but the mandibular overgrowth might have been inhibited by the correction of class III dentoskeletal deformity resulting from the maxillary distraction.

Constraining the location of gamma-ray flares in luminous blazars

DOE Office of Scientific and Technical Information (OSTI.GOV)

Nalewajko, Krzysztof; Begelman, Mitchell C.; Sikora, Marek, E-mail: knalew@jila.colorado.edu

2014-07-10

Locating the gamma-ray emission sites in blazar jets is a long standing and highly controversial issue. We jointly investigate several constraints on the distance scale r and Lorentz factor Γ of the gamma-ray emitting regions in luminous blazars (primarily flat spectrum radio quasars). Working in the framework of one-zone external radiation Comptonization models, we perform a parameter space study for several representative cases of actual gamma-ray flares in their multiwavelength context. We find a particularly useful combination of three constraints: from an upper limit on the collimation parameter Γθ ≲ 1, from an upper limit on the synchrotron self-Compton (SSC)more » luminosity L{sub SSC} ≲ L{sub X}, and from an upper limit on the efficient cooling photon energy E{sub cool,obs} ≲ 100 MeV. These three constraints are particularly strong for sources with low accretion disk luminosity L{sub d}. The commonly used intrinsic pair-production opacity constraint on Γ is usually much weaker than the SSC constraint. The SSC and cooling constraints provide a robust lower limit on the collimation parameter Γθ ≳ 0.1-0.7. Typical values of r corresponding to moderate values of Γ ∼ 20 are in the range 0.1-1 pc, and are determined primarily by the observed variability timescale t{sub var,obs}. Alternative scenarios motivated by the observed gamma-ray/millimeter connection, in which gamma-ray flares of t{sub var,obs} ∼ a few days are located at r ∼ 10 pc, are in conflict with both the SSC and cooling constraints. Moreover, we use a simple light travel time argument to point out that the gamma-ray/millimeter connection does not provide a significant constraint on the location of gamma-ray flares. We argue that spine-sheath models of the jet structure do not offer a plausible alternative to external radiation fields at large distances; however, an extended broad-line region is an idea worth exploring. We propose that the most definite additional constraint could be provided by determination of the synchrotron self-absorption frequency for correlated synchrotron and gamma-ray flares.« less

In the Blackest Night, a Green Ring Nebula

NASA Image and Video Library

2011-06-15

This glowing emerald nebula seen by NASA Spitzer Space Telescope is named RCW 120; this region of hot gas and glowing dust can be found in the murky clouds encircled by the tail of the constellation Scorpius.

Jabbah and Associates

NASA Image and Video Library

2011-11-25

This view from NASA Wide-field Infrared Survey Explorer takes in an area of the sky in the constellation of Scorpius surrounding Jabbah Arabic name means the forehead of the scorpion which is larger than a grid of eight by eight full moons.

In the Grip of the Scorpion Claw

NASA Image and Video Library

2010-09-21

Gripped in the claw of the constellation Scorpius sits the reflection nebula DG 129, a cloud of gas and dust that reflects light from nearby, bright stars. This infrared view of the nebula was captured by NASA Wide-field Infrared Survey Explorer.

Gravitational waves from Scorpius X-1: A comparison of search methods and prospects for detection with advanced detectors

NASA Astrophysics Data System (ADS)

Messenger, C.; Bulten, H. J.; Crowder, S. G.; Dergachev, V.; Galloway, D. K.; Goetz, E.; Jonker, R. J. G.; Lasky, P. D.; Meadors, G. D.; Melatos, A.; Premachandra, S.; Riles, K.; Sammut, L.; Thrane, E. H.; Whelan, J. T.; Zhang, Y.

2015-07-01

The low-mass X-ray binary Scorpius X-1 (Sco X-1) is potentially the most luminous source of continuous gravitational-wave radiation for interferometers such as LIGO and Virgo. For low-mass X-ray binaries this radiation would be sustained by active accretion of matter from its binary companion. With the Advanced Detector Era fast approaching, work is underway to develop an array of robust tools for maximizing the science and detection potential of Sco X-1. We describe the plans and progress of a project designed to compare the numerous independent search algorithms currently available. We employ a mock-data challenge in which the search pipelines are tested for their relative proficiencies in parameter estimation, computational efficiency, robustness, and most importantly, search sensitivity. The mock-data challenge data contains an ensemble of 50 Scorpius X-1 (Sco X-1) type signals, simulated within a frequency band of 50-1500 Hz. Simulated detector noise was generated assuming the expected best strain sensitivity of Advanced LIGO [1] and Advanced VIRGO [2] (4 ×10-24 Hz-1 /2 ). A distribution of signal amplitudes was then chosen so as to allow a useful comparison of search methodologies. A factor of 2 in strain separates the quietest detected signal, at 6.8 ×10-26 strain, from the torque-balance limit at a spin frequency of 300 Hz, although this limit could range from 1.2 ×10-25 (25 Hz) to 2.2 ×10-26 (750 Hz) depending on the unknown frequency of Sco X-1. With future improvements to the search algorithms and using advanced detector data, our expectations for probing below the theoretical torque-balance strain limit are optimistic.

Metal residues, histopathology and presence of parasites in the liver and gills of fourhorn sculpin (Myoxocephalus quadricornis) and shorthorn sculpin (Myoxocephalus scorpius) near a former lead-zinc mine in East Greenland

DOE Office of Scientific and Technical Information (OSTI.GOV)

Dang, Mai

Fourhorn sculpins (Myoxocephalus quadricornis) and shorthorn sculpins (Myoxocephalus scorpius) have been considered suitable local bioindicators for environmental monitoring studies in the Arctic. Because these species share many characteristics, data from the two species have previously been pooled when assessing marine metal contamination. A chemical and histological study was conducted on fourhorn and shorthorn sculpins collected around a contaminated lead-zinc mine at East Greenland to investigate whether there were any differences in the residues of metals, histopathology and parasites in liver and gills between the two sculpin species. The results demonstrated that concentrations of copper (Cu), zinc (Zn), mercury (Hg) andmore » lead (Pb) were significantly higher in the fourhorn sculpins (p<0.001) while there were no significant differences for arsenic (As) or cadmium (Cd). Furthermore, density of blood vessel fibrosis (p=0.028), prevalence and density of chondroplasia (p=0.002 and p=0.005, respectively), number of mucin-containing mucous cells (p<0.001) and chloride cells (p<0.001) and mean intensity of colonial Peritricha (p<0.001) were significantly higher in fourhorn sculpin. Based on these results we suggest that pooling the two species when conducting environmental assessments is not recommended as it can lead to incorrect conclusions. We propose that a larger study investigating the biological effects of zinc-lead mining in Greenland is needed. - Highlights: • Fourhorn sculpins (Myoxocephalus quadricornis) more sensitive to pollution than shorthorn sculpins (Myoxocephalus scorpius). • Metal residues, histological changes and presence of parasites were species-specific. • Different sculpin species should not be pooled together as pollution biomarkers.« less

Optimal Spectral Decomposition (OSD) for Ocean Data Assimilation

DTIC Science & Technology

2015-01-01

tropical North Atlantic from the Argo float data (Chu et al. 2007 ), and temporal and spatial variability of global upper-ocean heat content (Chu 2011...O. V. Melnichenko, and N. C. Wells, 2007 : Long baro- clinic Rossby waves in the tropical North Atlantic observed fromprofiling floats. J...Harrison, and D. Stammer , D., Eds., Vol. 2, ESA Publ. WPP- 306, doi:10.5270/OceanObs09.cwp.86. Tang, Y., and R. Kleeman, 2004: SST assimilation

More Rapidly Rotating PMS M Dwarfs with Light Curves Suggestive of Orbiting Clouds of Material

NASA Astrophysics Data System (ADS)

Stauffer, John; Rebull, Luisa; David, Trevor J.; Jardine, Moira; Collier Cameron, Andrew; Cody, Ann Marie; Hillenbrand, Lynne A.; Barrado, David; van Eyken, Julian; Melis, Carl; Briceno, Cesar

2018-02-01

In a previous paper, using data from K2 Campaign 2, we identified 11 very low mass members of the ρ Oph and Upper Scorpius star-forming region as having periodic photometric variability and phased light curves showing multiple scallops or undulations. All of the stars with the “scallop-shell” light curve morphology are mid-to-late M dwarfs without evidence of active accretion and with photometric periods generally <1 day. Their phased light curves have too much structure to be attributed to non-axisymmetrically distributed photospheric spots and rotational modulation. We have now identified an additional eight probable members of the same star-forming region plus three stars in the Taurus star-forming region with this same light curve morphology and sharing the same period and spectral type range as the previous group. We describe the light curves of these new stars in detail and present their general physical characteristics. We also examine the properties of the overall set of stars in order to identify common features that might help elucidate the causes of their photometric variability.

Revisiting the birth locations of pulsars B1929+10, B2020+28, and B2021+51

NASA Astrophysics Data System (ADS)

Kirsten, Franz; Vlemmings, Wouter; Campbell, Robert M.; Kramer, Michael; Chatterjee, Shami

2015-05-01

We present new proper motion and parallax measurements obtained with the European VLBI Network (EVN) at 5GHz for the three isolated pulsars B1929+10, B2020+28, and B2021+51. For B1929+10 we combined our data with earlier VLBI measurements and confirm the robustness of the astrometric parameters of this pulsar. For pulsars B2020+28 and B2021+51 our observations indicate that both stars are almost a factor of two closer to the solar system than previously thought, placing them at a distance of 1.39-0.06+0.05 and 1.25-0.17+ 0.14kpc. Using our new astrometry, we simulated the orbits of all three pulsars in the Galactic potential with the aim to confirm or reject previously proposed birth locations. Our observations ultimately rule out a claimed binary origin of B1929+10 and the runaway star ζ Ophiuchi in Upper Scorpius. A putative common binary origin of B2020+28 and B2021+51 in the Cygnus Superbubble is also very unlikely.

High-resolution soft X-ray spectra of Scorpius X-1 - The structure of circumsource accreting material

NASA Technical Reports Server (NTRS)

Kahn, S. M.; Seward, F. D.; Chlebowski, T.

1984-01-01

Four observations of Scorpius X-1 with the Objective Grating Spectrometer of the Einstein Observatory have provided high-resolution spectra (lambda/Delta lambda = approximately 20-50) in the wavelength range 7-46 A. The spectra reveal the presence of absorption structure due to oxygen, nitrogen, and iron, and variable emission structure associated with ionized iron and nitrogen. The strengths of these features suggest that the N/O abundance ratio in the absorbing and line emitting gas is anomalously high, which might indicate that these spectral components are associated with processed material, probably accreting matter transferred from the surface of an evolved companion. Constraints on the inclination of the system, however, imply that this cool, dense, accreting material must be well out of the plane of the binary system. Possible models for the origin and nature of this circumsource medium are discussed. An extensive discussion of the calibration of the Objective Grating Spectrometer and of the analysis of spectra acquired by that instrument is also provided.

Genetic induction of phosphate toxicity significantly reduces the survival of hypercholesterolemic obese mice

PubMed Central

Ohnishi, Mutsuko; Kato, Shigeko; Razzaque, M. Shawkat

2013-01-01

Objective The adverse effects of metabolic disorders in obesity have been extensively studied; however, the pathologic effects of hyperphosphatemia or phosphate toxicity in obesity have not been studied in similar depth and detail, chiefly because such an association is thought to be uncommon. Studies have established that the incidence of obesity-associated nephropathy is increasing. Because hyperphosphatemia is a major consequence of renal impairment, this study determines the in vivo effects of hyperphosphatemia in obesity. Methods and results We genetically induced hyperphosphatemia in leptin-deficient obese (ob/ob) mice by generating ob/ob and klotho double knockout [ob/ob-klotho−/−] mice. As a control, we made ob/ob mice with hypophosphatemia by generating ob/ob and 1-alpha hydroxylase double knockout [ob/ob-1α(OH)ase−/−] mice. Compared to the wild-type mice, all three obese background mice, namely ob/ob, ob/ob-klotho−/−, and ob/ob-1α(OH)ase−/− mice developed hypercholesterolemia. In addition, the hyperphosphatemic, ob/ob-klotho−/− genetic background induced generalized tissue atrophy and widespread soft-tissue and vascular calcifications, which led to a shorter lifespan; no such changes were observed in the hypophosphatemic, ob/ob-1α(OH)ase−/− mice. Significantly, in contrast to the reduced survival of the ob/ob-klotho−/− mice, lowering serum phosphate levels in ob/ob-1α(OH)ase−/− mice showed no such compromised survival, despite both mice being hypercholesterolemic. Conclusion These genetic manipulation studies suggest phosphate toxicity is an important risk factor in obesity that can adversely affect survival. PMID:22037453

Genetic induction of phosphate toxicity significantly reduces the survival of hypercholesterolemic obese mice.

PubMed

Ohnishi, Mutsuko; Kato, Shigeko; Razzaque, M Shawkat

2011-11-25

The adverse effects of metabolic disorders in obesity have been extensively studied; however, the pathologic effects of hyperphosphatemia or phosphate toxicity in obesity have not been studied in similar depth and detail, chiefly because such an association is thought to be uncommon. Studies have established that the incidence of obesity-associated nephropathy is increasing. Because hyperphosphatemia is a major consequence of renal impairment, this study determines the in vivo effects of hyperphosphatemia in obesity. We genetically induced hyperphosphatemia in leptin-deficient obese (ob/ob) mice by generating ob/ob and klotho double knockout [ob/ob-klotho(-/-)] mice. As a control, we made ob/ob mice with hypophosphatemia by generating ob/ob and 1-alpha hydroxylase double knockout [ob/ob-1α(OH)ase(-/-)] mice. Compared to the wild-type mice, all three obese background mice, namely ob/ob, ob/ob-klotho(-/-), and ob/ob-1α(OH)ase(-/-) mice developed hypercholesterolemia. In addition, the hyperphosphatemic, ob/ob-klotho(-/-) genetic background induced generalized tissue atrophy and widespread soft-tissue and vascular calcifications, which led to a shorter lifespan; no such changes were observed in the hypophosphatemic, ob/ob-1α(OH)ase(-/-) mice. Significantly, in contrast to the reduced survival of the ob/ob-klotho(-/-) mice, lowering serum phosphate levels in ob/ob-1α(OH)ase(-/-) mice showed no such compromised survival, despite both mice being hypercholesterolemic. These genetic manipulation studies suggest phosphate toxicity is an important risk factor in obesity that can adversely affect survival. Copyright © 2011 Elsevier Inc. All rights reserved.

Leptin Reduces the Expression and Increases the Phosphorylation of the Negative Regulators of GLUT4 Traffic TBC1D1 and TBC1D4 in Muscle of ob/ob Mice

PubMed Central

Sáinz, Neira; Rodríguez, Amaia; Catalán, Victoria; Becerril, Sara; Ramírez, Beatriz; Lancha, Andoni; Burgos-Ramos, Emma; Gómez-Ambrosi, Javier; Frühbeck, Gema

2012-01-01

Leptin improves insulin sensitivity in skeletal muscle. Our goal was to determine whether proteins controlling GLUT4 traffic are altered by leptin deficiency and in vivo leptin administration in skeletal muscle of wild type and ob/ob mice. Leptin-deficient ob/ob mice were divided in three groups: control, leptin-treated (1 mg/kg/d) and leptin pair-fed ob/ob mice. Microarray analysis revealed that 1,546 and 1,127 genes were regulated by leptin deficiency and leptin treatment, respectively. Among these, we identified 24 genes involved in intracellular vesicle-mediated transport in ob/ob mice. TBC1 domain family, member 1 (Tbc1d1), a negative regulator of GLUT4 translocation, was up-regulated (P = 0.001) in ob/ob mice as compared to wild types. Importantly, leptin treatment reduced the transcript levels of Tbc1d1 (P<0.001) and Tbc1d4 (P = 0.004) in the leptin-treated ob/ob as compared to pair-fed ob/ob animals. In addition, phosphorylation levels of TBC1D1 and TBC1D4 were enhanced in leptin-treated ob/ob as compared to control ob/ob (P = 0.015 and P = 0.023, respectively) and pair-fed ob/ob (P = 0.036 and P = 0.034, respectively) mice. Despite similar GLUT4 protein expression in wild type and ob/ob groups a different immunolocalization of this protein was evidenced in muscle sections. Leptin treatment increased GLUT4 immunoreactivity in gastrocnemius and extensor digitorum longus sections of leptin-treated ob/ob mice. Moreover, GLUT4 protein detected in immunoprecipitates from TBC1D4 was reduced by leptin replacement compared to control ob/ob (P = 0.013) and pair-fed ob/ob (P = 0.037) mice. Our findings suggest that leptin enhances the intracellular GLUT4 transport in skeletal muscle of ob/ob animals by reducing the expression and activity of the negative regulators of GLUT4 traffic TBC1D1 and TBC1D4. PMID:22253718

Genetically obese (ob/ob) mice are resistant to the lethal effects of thioacetamide hepatotoxicity

DOE Office of Scientific and Technical Information (OSTI.GOV)

Won, Young-Suk; Song, Ji-Won; Lim, Jong-Hwan

Obesity increases the risk of chronic liver diseases, including viral hepatitis, alcohol-induced liver disease, and non-alcoholic steatohepatitis. In this study, we investigated the effects of obesity in acute hepatic failure using a murine model of thioacetamide (TA)-induced liver injury. Genetically obese ob/ob mice, together with non-obese ob/+ littermates, were subjected to a single intraperitoneal injection of TA, and examined for signs of hepatic injury. ob/ob mice showed a significantly higher survival rate, lower levels of serum alanine aminotransferase and aspartate aminotransferase, and less hepatic necrosis and apoptosis, compared with ob/+ mice. In addition, ob/ob mice exhibited significantly lower levels ofmore » malondialdehyde and significantly higher levels of glutathione and antioxidant enzyme activities compared with their ob/+ counterparts. Bioactivation analyses revealed reduced plasma clearance of TA and covalent binding of [{sup 14}C]TA to liver macromolecules in ob/ob mice. Together, these data demonstrate that genetically obese mice are resistant to TA-induced acute liver injury through diminished bioactivation of TA and antioxidant effects. - Highlights: • ob/ob mice are resistant to lethal doses of thioacetamide, compared to ob/+ mice. • ob/ob mice show reduced oxidative stress and enhanced antioxidant enzyme activity. • ob/ob mice exhibit diminished bioactivation of thioacetamide.« less

Ablation of ghrelin receptor in leptin-deficient ob/ob mice has paradoxical effects on glucose homeostasis when compared with ablation of ghrelin in ob/ob mice.

PubMed

Ma, Xiaojun; Lin, Yuezhen; Lin, Ligen; Qin, Guijun; Pereira, Fred A; Haymond, Morey W; Butte, Nancy F; Sun, Yuxiang

2012-08-01

The orexigenic hormone ghrelin is important in diabetes because it has an inhibitory effect on insulin secretion. Ghrelin ablation in leptin-deficient ob/ob (Ghrelin(-/-):ob/ob) mice increases insulin secretion and improves hyperglycemia. The physiologically relevant ghrelin receptor is the growth hormone secretagogue receptor (GHS-R), and GHS-R antagonists are thought to be an effective strategy for treating diabetes. However, since some of ghrelin's effects are independent of GHS-R, we have utilized genetic approaches to determine whether ghrelin's effect on insulin secretion is mediated through GHS-R and whether GHS-R antagonism indeed inhibits insulin secretion. We investigated the effects of GHS-R on glucose homeostasis in Ghsr-ablated ob/ob mice (Ghsr(-/-):ob/ob). Ghsr ablation did not rescue the hyperphagia, obesity, or insulin resistance of ob/ob mice. Surprisingly, Ghsr ablation worsened the hyperglycemia, decreased insulin, and impaired glucose tolerance. Consistently, Ghsr ablation in ob/ob mice upregulated negative β-cell regulators (such as UCP-2, SREBP-1c, ChREBP, and MIF-1) and downregulated positive β-cell regulators (such as HIF-1α, FGF-21, and PDX-1) in whole pancreas; this suggests that Ghsr ablation impairs pancreatic β-cell function in leptin deficiency. Of note, Ghsr ablation in ob/ob mice did not affect the islet size; the average islet size of Ghsr(-/-):ob/ob mice is similar to that of ob/ob mice. In summary, because Ghsr ablation in leptin deficiency impairs insulin secretion and worsens hyperglycemia, this suggests that GHS-R antagonists may actually aggravate diabetes under certain conditions. The paradoxical effects of ghrelin ablation and Ghsr ablation in ob/ob mice highlight the complexity of the ghrelin-signaling pathway.

Rotation of Low-mass Stars in Upper Scorpius and ρ Ophiuchus with K2

NASA Astrophysics Data System (ADS)

Rebull, L. M.; Stauffer, J. R.; Cody, A. M.; Hillenbrand, L. A.; David, T. J.; Pinsonneault, M.

2018-05-01

We present an analysis of K2 light curves (LCs) for candidate members of the young Upper Sco (USco) association (∼8 Myr) and the neighboring ρ Oph embedded cluster (∼1 Myr). We establish ∼1300 stars as probable members, ∼80% of which are periodic. The phased LCs have a variety of shapes which can be attributed to physical causes ranging from stellar pulsation and stellar rotation to disk-related phenomena. We identify and discuss a number of observed behaviors. The periods are ∼0.2–30 days with a peak near 2 days and the rapid period end nearing breakup velocity. M stars in the young USco region rotate systematically faster than GK stars, a pattern also present in K2 data for the older Pleiades and Praesepe systems. At higher masses (types FGK), the well-defined period–color relationship for slowly rotating stars seen in the Pleiades and Praesepe systems is not yet present in USco. Circumstellar disks are present predominantly among the more slowly rotating M stars in USco, with few disks in the subday rotators. However, M dwarfs with disks rotate faster on average than FGK systems with disks. For four of these disked M dwarfs, we provide direct evidence for disk locking based on the K2 LC morphologies. Our preliminary analysis shows a relatively mass-independent spin-up by a factor of ∼3.5 between USco and the Pleiades, then mass-dependent spin-down between Pleiades and Praesepe.

Glycerol-3-Phosphate Acyltransferase 1 Deficiency in ob/ob Mice Diminishes Hepatic Steatosis but Does Not Protect Against Insulin Resistance or Obesity

PubMed Central

Wendel, Angela A.; Li, Lei O.; Li, Yue; Cline, Gary W.; Shulman, Gerald I.; Coleman, Rosalind A.

2010-01-01

OBJECTIVE Hepatic steatosis is strongly associated with insulin resistance, but a causal role has not been established. In ob/ob mice, sterol regulatory element binding protein 1 (SREBP1) mediates the induction of steatosis by upregulating target genes, including glycerol-3-phosphate acyltransferase-1 (Gpat1), which catalyzes the first and committed step in the pathway of glycerolipid synthesis. We asked whether ob/ob mice lacking Gpat1 would have reduced hepatic steatosis and improved insulin sensitivity. RESEARCH DESIGN AND METHODS Hepatic lipids, insulin sensitivity, and hepatic insulin signaling were compared in lean (Lep+/?), lean-Gpat1−/−, ob/ob (Lepob/ob), and ob/ob-Gpat1−/− mice. RESULTS Compared with ob/ob mice, the lack of Gpat1 in ob/ob mice reduced hepatic triacylglycerol (TAG) and diacylglycerol (DAG) content 59 and 74%, respectively, but increased acyl-CoA levels. Despite the reduction in hepatic lipids, fasting glucose and insulin concentrations did not improve, and insulin tolerance remained impaired. In both ob/ob and ob/ob-Gpat1−/− mice, insulin resistance was accompanied by elevated hepatic protein kinase C-ε activation and blunted insulin-stimulated Akt activation. CONCLUSIONS These results suggest that decreasing hepatic steatosis alone does not improve insulin resistance, and that factors other than increased hepatic DAG and TAG contribute to hepatic insulin resistance in this genetically obese model. They also show that the SREBP1-mediated induction of hepatic steatosis in ob/ob mice requires Gpat1. PMID:20200319

Effect of leptin administration on myelination in ob/ob mouse cerebrum after birth.

PubMed

Hashimoto, Ryuju; Matsumoto, Akihiro; Udagawa, Jun; Hioki, Kyoji; Otani, Hiroki

2013-01-09

Brain weight and size are known to be reduced in adult leptin-deficient Lep/Lep (OB) mice when compared with the wild-type (+/+) mice (C57BL/6: B6). We here analyzed leptin's effects on myelination by examining morphometrically the myelin sheath (MS) in the cerebrum of postnatal day (P) 14 and P28 OB that had received leptin 1 nmol/capita/day from P7 to P14 or P28 (OB+lep), in comparison with OB and B6. We examined myelin basic protein (MBP) mRNA levels and the differentiation of oligodendrocytes by comparing the number of oligodendrocyte precursor cells (OPCs) and the mature oligodendrocytes in the cerebrum between OB, OB+lep, and B6 on P14 and P28. MBP-mRNA expression was lower in OB than in B6 on P14 and P28. On P14, it was higher in OB+lep than in OB but was still lower than in B6, whereas on P28 it was even higher in OB+lep than in B6. On P28, the radii of myelinated axons were larger in OB than in B6 and OB+lep. The MS on P28 was significantly thinner in OB than in B6, but there was no significant difference between OB and OB+lep. There were significantly fewer mature oligodendrocytes in OB and OB+lep than in B6 on P28, whereas on P14 there were significantly fewer OPCs in OB and OB+lep than in B6. Our results suggested that leptin regulates the myelination of oligodendrocytes and that the replenishment of leptin in OB recovered myelination but did not affect the differentiation of OPCs from P7 to P28.

Role of estrogen receptor signaling in skeletal response to leptin in female ob/ob mice.

PubMed

Turner, Russell T; Philbrick, Kenneth A; Kuah, Amida F; Branscum, Adam J; Iwaniec, Urszula T

2017-06-01

Leptin, critical in regulation of energy metabolism, is also important for normal bone growth, maturation and turnover. Compared to wild type (WT) mice, bone mass is lower in leptin-deficient ob/ob mice. Osteopenia in growing ob/ob mice is due to decreased bone accrual, and is associated with reduced longitudinal bone growth, impaired cancellous bone maturation and increased marrow adipose tissue (MAT). However, leptin deficiency also results in gonadal dysfunction, disrupting production of gonadal hormones which regulate bone growth and turnover. The present study evaluated the role of increased estrogen in mediating the effects of leptin on bone in ob/ob mice. Three-month-old female ob/ob mice were randomized into one of the 3 groups: (1) ob/ob  + vehicle (veh), (2) ob/ob  + leptin (leptin) or (3) ob/ob  + leptin and the potent estrogen receptor antagonist ICI 182,780 (leptin + ICI). Age-matched WT mice received vehicle. Leptin (40 µg/mouse, daily) and ICI (10 µg/mouse, 2×/week) were administered by subcutaneous injection for 1 month and bone analyzed by X-ray absorptiometry, microcomputed tomography and static and dynamic histomorphometry. Uterine weight did not differ between ob/ob mice and ob/ob mice receiving leptin + ICI, indicating that ICI successfully blocked the uterine response to leptin-induced increases in estrogen levels. Compared to leptin-treated ob/ob mice, ob/ob mice receiving leptin + ICI had lower uterine weight; did not differ in weight loss, MAT or bone formation rate; and had higher longitudinal bone growth rate and cancellous bone volume fraction. We conclude that increased estrogen signaling following leptin treatment is dispensable for the positive actions of leptin on bone and may attenuate leptin-induced bone growth. © 2017 Society for Endocrinology.

Constraints on radial anisotropy in the central Pacific upper mantle from the NoMelt OBS array

NASA Astrophysics Data System (ADS)

Russell, J. B.; Gaherty, J. B.; Lin, P. P.; Zebker, M.

2016-12-01

Observations of seismic anisotropy in ocean basins are important for constraining deformation and melting processes in the upper mantle. The NoMelt OBS array was deployed on relatively pristine, 70-Ma seafloor in the central Pacific with the aim of constraining upper-mantle circulation and the evolution of the lithosphere-asthenosphere system. Azimuthal variations in Rayleigh-wave velocity suggest strong anisotropic fabric both in the lithosphere and deep in the asthenosphere, and we aim to evaluate whether radial anisotropy shows a similar pattern. We use a combination of Love waves from earthquakes (20-100 s) as well as high-frequency ambient noise (5-10 s) to estimate VSH in the upper 300 km beneath the NoMelt array. Waveform fitting of the ambient-noise cross spectra provide phase-velocity estimates that are sensitive to the upper 50 km of the mantle. To constrain structure beneath the lid, we employ an array-based approach to measure Love-wave phase velocities across the array using seven shallow-focus events (< 25 km) with high signal-to-noise ratio and diverse azimuthal coverage. The Love wave phase-velocity measurements suggest strong interference of the first overtone for intermediate periods (20-50 s), while longer periods (>60 s) are mostly dominated by fundamental mode energy. Through forward modeling of Love wave Fréchet kernels, we find an extremely strong nonlinearity in individual mode-branch sensitivity that is dependent on the relative velocity difference between the low-velocity zone (LVZ) and the overlying Pacific lid. For the fundamental mode in the presence of a strong LVZ, intermediate periods (20-50 s) have little sensitivity within the lithospheric mantle with peak sensitivity pushed to the base of the low-velocity zone. This peak sensitivity migrates to much shallower depth as the lid/LVZ contrast is reduced. Therefore, we use a Monte Carlo approach to systematically explore the model space and identify the most robust model features required to minimize phase-velocity misfit of the full multimode Love wave arrivals. The resulting VSH model is combined with the NoMelt VSV model to obtain estimates of radial anisotropy for the top 300km of the central Pacific upper-mantle.

Ship Noise in the SW Indian Ocean Recorded by Ocean Bottom Seismic and Hydroacoustic Sensors

NASA Astrophysics Data System (ADS)

Barruol, G.; Dreo, R.; Fontaine, F. R.; Scholz, J. R.; Sigloch, K.

2016-12-01

In the frame of the RHUM-RUM project (Réunion Hotspot and Upper Mantle - Réunions Unterer Mantel, www.rhum-rum.net), a network of 57 ocean-bottom seismometers (OBS) has been installed on the ocean floor around La Réunion Island, but also on the neighbouring Southwest and Central Indian Ridges. The OBS were equipped by wide- and broad-band three-components seismic and hydroacoustic sensors. They were deployed in Nov. 2012, and depending on the configuration, they recorded for 8 to 13 months. Interestingly, part of the network was located beneath a NE-SW trending lane of very dense ship traffic connecting SE-Asia and the South-Atlantic region. By combining the vessel position - provided by AIS GPS data - and our geophysical data recorded on the ocean floor, we analyze the seismic and hydroacoustic ship signatures. From spectral analyzes, we show clear signals over the whole high-frequency range available from our instruments (between 1 and 50 Hz). The RHUM-RUM network covering latitude between 17 and 34° South, this allows to detect numerous vessels and to compare the noise characteristics (frequency content, polarization) of each vessel. We also investigate the possibility of using the polarization of the noise emitted by ships passing above an ocean-bottom seismometer, to help retrieving the orientation of the OBS horizontal components on the ocean floor in the geographic reference frame.

Critical constraint on inflationary magnetogenesis

DOE Office of Scientific and Technical Information (OSTI.GOV)

Fujita, Tomohiro; Yokoyama, Shuichiro, E-mail: tomohiro.fujita@ipmu.jp, E-mail: shu@icrr.u-tokyo.ac.jp

2014-03-01

Recently, there are several reports that the cosmic magnetic fields on Mpc scale in void region is larger than ∼ 10{sup −15}G with an uncertainty of a few orders from the current blazar observations. On the other hand, in inflationary magnetogenesis models, additional primordial curvature perturbations are inevitably produced from iso-curvature perturbations due to generated electromagnetic fields. We explore such induced curvature perturbations in a model independent way and obtained a severe upper bound for the energy scale of inflation from the observed cosmic magnetic fields and the observed amplitude of the curvature perturbation , as ρ{sub inf}{sup 1/4}

The orphan nuclear receptor small heterodimer partner is required for thiazolidinedione effects in leptin-deficient mice.

PubMed

Tseng, Hsiu-Ting; Park, Young Joo; Lee, Yoon Kwang; Moore, David D

2015-05-08

Small heterodimer partner (SHP, NR0B2) is involved in diverse metabolic pathways, including hepatic bile acid, lipid and glucose homeostasis, and has been implicated in effects on the peroxisome proliferator-activated receptor γ (PPARγ), a master regulator of adipogenesis and the receptor for antidiabetic drugs thiazolidinediones (TZDs). In this study, we aim to investigate the role of SHP in TZD response by comparing TZD-treated leptin-deficient (ob/ob) and leptin-, SHP-deficient (ob/ob;Shp(-/-)) double mutant mice. Both ob/ob and double mutant ob/ob;Shp(-/-) mice developed hyperglycemia, insulin resistance, and hyperlipidemia, but hepatic fat accumulation was decreased in the double mutant ob/ob;Shp(-/-) mice. PPARγ2 mRNA levels were markedly lower in ob/ob;Shp(-/-) liver and decreased to a lesser extent in adipose tissue. The TZD troglitazone did not reduce glucose or circulating triglyceride levels in ob/ob;Shp(-/-) mice. Expression of the adipocytokines, such as adiponectin and resistin, was not stimulated by troglitazone treatment. Expression of hepatic lipogenic genes was also reduced in ob/ob;Shp(-/-) mice. Moreover, overexpression of SHP by adenovirus infection increased PPARγ2 mRNA levels in mouse primary hepatocytes. Our results suggest that SHP is required for both antidiabetic and hypolipidemic effects of TZDs in ob/ob mice through regulation of PPARγ expression.

Ablation of ghrelin receptor in leptin-deficient ob/ob mice has paradoxical effects on glucose homeostasis when compared with ablation of ghrelin in ob/ob mice

USDA-ARS?s Scientific Manuscript database

The orexigenic hormone ghrelin is important in diabetes because it has an inhibitory effect on insulin secretion. Ghrelin ablation in leptin-deficient ob/ob (Ghrelin(-/-):ob/ob) mice increases insulin secretion and improves hyperglycemia. The physiologically relevant ghrelin receptor is the growth ...

The Star Formation Scenario in the Galactic Range from Ophiuchus to Chamaeleon

NASA Astrophysics Data System (ADS)

Sartori, Marília J.

2000-07-01

The molecular cloud complexes of Chamaeleon, Lupus and Ophiuchus, and the OB sub-groups of stars that form the Scorpius OB2 association are located at galactic longitudes in the interval 290° to 360°, all of them in a distance range from 100 to 200 pc. The distribution of known young stars in this region, both of low and of high mass, suggests that they belong to a single large structure. Moreover, a significant number of pre-main sequence (PMS) stars far from the star-forming clouds have been recently discovered. This scenario suggests that a global analysis of the star formation must be performed, especially of such nearby regions for which a large amount of data can be obtained. In order to test the models that intend to describe the history of star formation in these nearby star-forming regions, we collected information on the distribution of gas and dust and on the related young stellar populations. We mapped the molecular clouds of the complexes located in Chamaeleon, Lupus and Ophiuchus by means of an automatic method for star counting on plates of the Digitized Sky Survey. Another improvement with respect to the traditional star counts method is that we have adopted a relation between the extinction and the number of stars based on the predictions of the Galaxy's model by Ortiz & Lépine (1993, A&A 279, 90). Our maps confirm that there is an extended distribution of dust in the regions between the main clouds. We built a complete list of PMS and early-type stars from the literature, including all the available distance, radial velocity and proper motion data. We completed these data with our own determinations of proper motions of PMS stars, using positions obtained with the Valinhos Meridian Circle (IAG/USP, Brazil), photographic plates and public catalogs (Teixeira et al. 2000, A&A in press). Using these kinematical data and comparing the positions and spatial velocities of PMS stars to those of early-type stars, we verified that the kinematics of the two stellar populations is very similar. We estimated the age of the PMS stars using H-R diagrams constructed with photometric data, spectral type and HIPPARCOS parallaxes, when available. We also re-determined the age of the OB associations using the same method. The comparison of the ages of the two populations shows that they are also similar. Our conclusion is that the two stellar populations have a common global origin. The arrangement of stars and molecular clouds in this extended region and the average velocity of the stars in the opposite direction of the galactic rotation, agree with the expected behavior of the star formation in a nearby spiral arm. On the other hand, the star formation by impact of high velocity clouds on the galactic disk and the sequential star formation do not explain our results. We conclude that the extended complex we have studied probably belongs to a spiral arm close to the Sun.

Roselle is cardioprotective in diet-induced obesity rat model with myocardial infarction.

PubMed

Si, Lislivia Yiang-Nee; Ali, Siti Aishah Mohd; Latip, Jalifah; Fauzi, Norsyahida Mohd; Budin, Siti Balkis; Zainalabidin, Satirah

2017-12-15

Obesity increase the risks of hypertension and myocardial infarction (MI) mediated by oxidative stress. This study was undertaken to investigate the actions of roselle aqueous extract (R) on cardiotoxicity in obese (OB) rats and thereon OB rats subjected to MI. Male Sprague-Dawley rats were fed with either normal diet or high-fat diet for 8weeks. Firstly, OB rats were divided into (1) OB and (2) OB+R (100mg/kg, p.o, 28days). Then, OB rats were subjected to MI (ISO, 85mg/kg, s.c, 2days) and divided into three groups: (1) OB+MI, (2) OB+MI+R and (3) OB+MI+enalapril for another 4weeks. Roselle ameliorated OB and OB+MI's cardiac systolic dysfunction and reduced cardiac hypertrophy and fibrosis. The increased oxidative markers and decreased antioxidant enzymes in OB and OB+MI groups were all attenuated by roselle. These observations indicate the protective effect of roselle on cardiac dysfunction in OB and OB+MI rats, which suggest its potential to be developed as a nutraceutical product for obese and obese patients with MI in the future. Copyright © 2017 Elsevier Inc. All rights reserved.

Long-term X-ray studies of Scorpius X-1. I - Search for binary periodicity

NASA Technical Reports Server (NTRS)

Holt, S. S.; Boldt, E. A.; Serlemitsos, P. J.; Kaluzienski, L. J.

1976-01-01

No evidence for modulation of the Sco X-1 intensity between 3 and 6 keV at the optical period of 0.787313 day is found during one year of quasi-continuous observation. Any persistent X-ray modulation at this period must be less than one percent.

Two New Species of Xenotarsonemus (Acari: Tarsonemidae) from the Atlantic Forest, Brazil.

PubMed

Lofego, A C; Cavalcante, A C C; Demite, P R

2018-04-01

Two new species, Xenotarsonemus quiriri n. sp. and Xenotarsonemus scorpius n. sp., are described and illustrated in this paper based on specimens collected on Myrtaceae plants in Atlantic Forest areas of the states of Bahia and Santa Catarina, Brazil. A key to identification of Xenotarsonemus species reported from Brazil is provided.

Unibody Composite Pressurized Structure (UCPS) for In-Space Propulsion

NASA Technical Reports Server (NTRS)

Rufer, Markus

2015-01-01

Microcosm, Inc., in conjunction with the Scorpius Space Launch Company, is developing a UCPS (Unibody Composite Pressurized Structure )for in-space propulsion. This innovative approach constitutes a clean break from traditional spacecraft design by combining what were traditionally separate primary and secondary support structures and metal propellant tanks into a single unit.

NEW BROWN DWARF COMPANIONS TO YOUNG STARS IN SCORPIUS-CENTAURUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Janson, Markus; Jayawardhana, Ray; Bonavita, Mariangela

2012-10-10

We present the discoveries of three faint companions to young stars in the Scorpius-Centaurus region, imaged with the NICI instrument on Gemini South. We have confirmed all three companions through common proper motion tests. Follow-up spectroscopy has confirmed two of them, HIP 65423 B and HIP 65517 B, to be brown dwarfs, while the third, HIP 72099 B, is more likely a very low mass star just above the hydrogen burning limit. The detection of wide companions in the mass range of {approx}40-100 M{sub jup} complements previous work in the same region, reporting detections of similarly wide companions with lowermore » masses, in the range of {approx}10-30 M{sub jup}. Such low masses near the deuterium burning limit have raised the question of whether those objects formed like planets or stars. The existence of intermediate objects as reported here could represent a bridge between lower-mass companions and stellar companions, but in any case demonstrate that mass alone may not provide a clear-cut distinction for the formation of low-mass companions to stars.« less

The isolation, purification and amino-acid sequence of insulin from the teleost fish Cottus scorpius (daddy sculpin).

PubMed

Cutfield, J F; Cutfield, S M; Carne, A; Emdin, S O; Falkmer, S

1986-07-01

Insulin from the principal islets of the teleost fish, Cottus scorpius (daddy sculpin), has been isolated and sequenced. Purification involved acid/alcohol extraction, gel filtration, and reverse-phase high-performance liquid chromatography to yield nearly 1 mg pure insulin/g wet weight islet tissue. Biological potency was estimated as 40% compared to porcine insulin. The sculpin insulin crystallised in the absence of zinc ions although zinc is known to be present in the islets in significant amounts. Two other hormones, glucagon and pancreatic polypeptide, were copurified with the insulin, and an N-terminal sequence for pancreatic polypeptide was determined. The primary structure of sculpin insulin shows a number of sequence changes unique so far amongst teleost fish. These changes occur at A14 (Arg), A15 (Val), and B2 (Asp). The B chain contains 29 amino acids and there is no N-terminal extension as seen with several other fish. Presumably as a result of the amino acid substitutions, sculpin insulin does not readily form crystals containing zinc-insulin hexamers, despite the presence of the coordinating B10 His.

Analysis of converted S-waves and gravity anomaly along the Aegir Ridge: implications for crustal lithology

NASA Astrophysics Data System (ADS)

Rai, A. K.; Breivik, A. J.; Mjelde, R.; Hanan, B. B.; Ito, G.; Sayit, K.; Howell, S.; Vogt, P. R.; Pedersen, R.

2012-12-01

The Aegir Ridge is an extinct spreading ridge in North-East Atlantic ocean. A thinner than normal crust around the Aegir Ridge appears as a hole in the extensively magmatic surroundings. Its proximity to the Iceland hot-spot makes it particularly important for understanding the changing dynamics of hotspot-ridge interaction. An integrated seismic and dredging experiment was conduced during the summer of 2010 with the primary aim to understand the nature of magmatism along the ridge shortly before cessation of seafloor spreading through variations of sub-seafloor lithological properties. Here, we present results of analysis of converted shear-waves recorded on OBS-sesimic data, and ship-gravity data. The shear-wave study enables us to quantify the variation of Vp/Vs in the sediments, crust and the upper-most mantle. We also inverted the gravity data to determine the sub-seafloor density distribution. The P- to S- converted shear-waves were identified on 20 OBSs along a profile with a total length of 550 km parallel to the ridge-axis. The sedimentary section on top of the crystalline crust is well illuminated in the streamer data. The forward modelling of the OBS data reveals that the Vp/Vs ratio in sediments are as high as 4.8, decreasing rapidly to a value of 3.00, primarily due to compaction of sediments with depth. Identification of sufficient PnS and PSn phases enable us to model the crustal and upper-most mantle Vp/Vs. The upper crystalline crust requires a Vp/Vs value of 1.99 and 1.89 for the southern and the northern profiles respectively, to fit the observations. The lower crust and upper-most part of the mantle have a Vp/Vs of ~1.82 and 1.795 respectively. Slightly lower Vp and moderate increase in Vp/Vs in parts of the crust and upper mantle presumably indicate presence of faulting, fracturing in the crust and moderate degree of serpentinization of the upper mantle. A sub-seafloor density model is derived by non-linear inversion of the gravity anomaly. The distribution of sediments appear to control the short-wavelength features of the gravity data, whereas density variations are required in the upper mantle to optimally fit the overall gravity anomaly. Our results suggest certain degree of temperature and/or compositional heterogeneities towards the southern ends of Aegir Ridge, near the Iceland-Faroes Ridge.

Nonlinear Geometric and Differential Geometric Guidance of UAVs with Vision Sensing for Reactive Obstacle Avoidance

DTIC Science & Technology

2010-09-29

1 1 1 2 2 2ˆ ˆ ˆ ˆ ˆ ˆˆ ˆ ˆ ˆ0 0 0 0 0 0 0 0 0 0 T r ob ob ob ob ob ob tr tr trX r r rθ φ θ φ θ φ= (3.28) 29...ˆ ˆ ˆ ˆˆ ˆ ˆ0 0 0 0 0 0 0 T r ob ob ob tr tr trX r rθ φ θ φ⎡ ⎤= ⎣ ⎦ (3.29) Since obstacles are assumed to be point obstacles, it

Co-evolution of soils and vegetation in the Aísa Valley Experimental Station (Central Pyrenees)

NASA Astrophysics Data System (ADS)

Serrano Muela, Maria Pilar; Nadal Romero, Estela; Lasanta, Teodoro; María García Ruiz, José

2013-04-01

Soils and vegetation tend to evolve jointly in relation to climate evolution and the impacts of human activity. This study analyzes soil and vegetation characteristics under various plant covers, using information from the Aísa Valley Experimental Station (AVES), Spanish Pyrenees, from 1991 to 2010. The land uses considered were: dense shrub cover, grazing meadow, abandoned field, cereal (barley), abandoned shifting agriculture, active shifting agriculture, burnt1 and burnt2 plots, and in-fallow plot. All the plots were installed on a field abandoned 45 years ago. Some of the plots did not change in plant cover through the study period (e.g., the meadow, cereal and shifting agriculture plots), but others underwent changes in density and composition, such as: (i) The dense shrub cover plot represents the natural evolution of the abandoned field. When the AVES was equipped, this plot was completely dominated by Genista scorpius, with a few stands of Rosa gr. Canina. Twenty years later, Genista scorpius is affected of senescence and shows almost no regeneration capacity. (ii) The abandoned field had previously been cultivated with cereals until 1993. Once abandoned, the progression of plant colonization was very rapid. Firstly with grasses and, 10 years later, with Genista scorpius. At present, this latter occupies more than 50% of the plot. (iii) The evolution of plant colonization in the abandoned shifting agriculture plot was slower than that in the 'normal' abandoned field, mainly because of the differences in fertilization when they were cultivated. (iv) One of the burnt plots evolved from 0% to a coverage of almost 100% in a shot period, whereas the other plot remained with a shrub density of about 60% several years after the fire. Soil samples (superficial and depth) were analyzed to obtain physical and chemical properties: structure, texture, pH, CaCO3, Organic Matter and various anions and cations. The main purpose was to detect differences in the soil properties as a consequence of land cover/land uses.

Temperature dependence of O2 consumption; opposite effects of leptin and etomoxir on respiratory quotient in mice.

PubMed

Högberg, Helena; Engblom, Lars; Ekdahl, Asa; Lidell, Veronica; Walum, Erik; Alberts, Peteris

2006-04-01

The aims were to compare the temperature dependence of the metabolic rate in young ob/ob mice with that in mature ob/ob and db/db mice and to examine the effect on the metabolic substrate preference of leptin and etomoxir in ob/ob, C57BL/6J (wild-type), and db/db mice. In vivo oxygen consumption and carbon dioxide production were continuously measured by indirect calorimetry, and body temperature and total locomotor activity were measured by an implanted transponder. Leptin, etomoxir, or vehicle was administered intraperitoneally. The temperature dependence of the metabolic rate of mature ob/ob and db/db mice were similar to that in wild-type mice. In young 6-week-old ob/ob mice, the metabolic rate was almost doubled at 15 degrees C. Leptin (2 x 3 mg/kg) decreased the respiratory quotient (RQ) and carbon dioxide production but did not alter oxygen consumption, body temperature, or locomotor activity in ob/ob and C57BL/6J mice and had no effect in the db/db mice. Etomoxir (2 x 30 mg/kg) enhanced RQ and decreased oxygen consumption, carbon dioxide production, and body temperature in ob/ob, C57BL/6J, and db/db mice. Total locomotor activity was reduced in ob/ob and C57BL/6J mice. In young ob/ob mice, the temperature sensitivity was enhanced compared with mature mice. Leptin and etomoxir had opposite effects on metabolic substrate preference. Leptin and lowered environmental temperature increased the relative fat oxidation as indicated by decreased RQ, possibly through activation of the sympathetic nervous system.

Thermogenesis, fatty acid synthesis with oxidation, and inflammation in the brown adipose tissue of ob/ob (-/-) mice.

PubMed

Martins, Fabiane Ferreira; Bargut, Thereza Cristina Lonzetti; Aguila, Marcia Barbosa; Mandarim-de-Lacerda, Carlos Alberto

2017-03-01

Brown adipose tissue (BAT) is specialized in heat production, but its metabolism in ob/ob mice is still a matter of debate. We aimed to verify ob/ob mice BAT using C57Bl/6 male mice (as the wild-type, WT) and leptin-deficient ob/ob mice (on the C57Bl/6 background strain), at three months of age (n=10/group). At euthanasia, animals had their interscapular BAT weighed, and prepared for analysis (Western blot, and RT-qPCR). In comparison with the WT group, the ob/ob group showed reduced thermogenic signaling markers (gene expression of beta 3-adrenergic receptor, beta3-AR; PPARgamma coactivator 1 alpha, PGC1alpha, and uncoupling protein 1, UCP1). The ob/ob group also showed impaired gene expression for lipid utilization (perilipin was increased, while other markers were diminished: carnitine palmitoyltransferase-1b, CPT-1b; cluster of differentiation 36, CD36; fatty acid binding protein 4, FABP4; fatty acid synthase, FAS, and sterol regulatory element-binding protein 1c, SREBP1c), and altered protein expression of insulin signaling (diminished pAKT, TC10, and GLUT-4). Lastly, the ob/ob group showed increased gene expression of markers of inflammation (interleukin 1 beta, IL-1beta; IL-6, tumor necrosis factor alpha, TNFalpha; and monocyte chemotactic protein-1, MCP-1). In conclusion, the ob/ob mice have decreased thermogenic markers associated with reduced gene expression related to fatty acid synthesis, mobilization, and oxidation. There were also alterations in insulin signaling and protein and gene expressions of inflammation. The findings suggest that the lack of substrate for thermogenesis and the local inflammation negatively regulated thermogenic signaling in the ob/ob mice. Copyright © 2016 Elsevier GmbH. All rights reserved.

Hormone-sensitive lipase deficiency suppresses insulin secretion from pancreatic islets of Lep{sup ob/ob} mice

DOE Office of Scientific and Technical Information (OSTI.GOV)

Sekiya, Motohiro; Yahagi, Naoya, E-mail: nyahagi-tky@umin.ac.jp; Laboratory of Molecular Physiology on Energy Metabolism, Graduate School of Medicine, University of Tokyo, Tokyo 113-8655

2009-09-25

It has long been a matter of debate whether the hormone-sensitive lipase (HSL)-mediated lipolysis in pancreatic {beta}-cells can affect insulin secretion through the alteration of lipotoxicity. We generated mice lacking both leptin and HSL (Lep{sup ob/ob}/HSL{sup -/-}) and explored the role of HSL in pancreatic {beta}-cells in the setting of obesity. Lep{sup ob/ob}/HSL{sup -/-} developed elevated blood glucose levels and reduced plasma insulin levels compared with Lep{sup ob/ob}/HSL{sup +/+} in a fed state, while the deficiency of HSL did not affect glucose homeostasis in Lep{sup +/+} background. The deficiency of HSL exacerbated the accumulation of triglycerides in Lep{sup ob/ob} islets,more » leading to reduced glucose-stimulated insulin secretion. The deficiency of HSL also diminished the islet mass in Lep{sup ob/ob} mice due to decreased cell proliferation. In conclusion, HSL affects insulin secretary capacity especially in the setting of obesity.« less

Energy balance in adrenalectomized ob/ob mice: effects of dietary starch and glucose.

PubMed

Warwick, B P; Romsos, D R

1988-07-01

Effects of different carbohydrate types on energy balance, fatty acid synthesis, and plasma insulin concentrations in adrenalectomized ob/ob mice were investigated. Obese (ob/ob) and lean mice adrenalectomized at 4 wk of age received one of four high-carbohydrate powdered diets for 3 wk: stock, glucose, starch, or starch plus wheat bran. Adrenalectomy reduced energy intake of ob/ob mice equally independent of diet type, whereas energetic efficiency, in vivo rates of fatty acid synthesis in liver and white adipose tissue, and plasma insulin concentrations were substantially reduced to approach values in lean mice in all adrenalectomized ob/ob mice except those fed glucose. The ability of adrenalectomy to normalize energy balance in ob/ob mice depends on factors other than the reduced circulating concentration of glucocorticoids alone. Diet composition is a crucial factor, and striking differences exist between semipurified diets containing a simple sugar (glucose) and those containing a complex carbohydrate (starch), with no additional effect of dietary fiber (wheat bran).

Loss of stearoyl-CoA desaturase 1 rescues cardiac function in obese leptin-deficient mice.

PubMed

Dobrzyn, Pawel; Dobrzyn, Agnieszka; Miyazaki, Makoto; Ntambi, James M

2010-08-01

The heart of leptin-deficient ob/ob mice is characterized by pathologic left ventricular hypertrophy along with elevated triglyceride (TG) content, increased stearoyl-CoA desaturase (SCD) activity, and increased myocyte apoptosis. In the present study, using an ob/ob;SCD1(-/-) mouse model, we tested the hypothesis that lack of SCD1 could improve steatosis and left ventricle (LV) function in leptin deficiency. We show that disruption of the SCD1 gene improves cardiac function in ob/ob mice by correcting systolic and diastolic dysfunction without affecting levels of plasma TG and FFA. The improvement is associated with reduced expression of genes involved in FA transport and lipid synthesis in the heart, as well as reduction in cardiac FFA, diacylglycerol, TG, and ceramide levels. The rate of FA beta-oxidation is also significantly lower in the heart of ob/ob;SCD1(-/-) mice compared with ob/ob controls. Moreover, SCD1 deficiency reduces cardiac apoptosis in ob/ob mice due to increased expression of antiapoptotic factor Bcl-2 and inhibition of inducible nitric oxide synthase and caspase-3 activities. Reduction in myocardial lipid accumulation and inhibition of apoptosis appear to be one of the main mechanisms responsible for improved LV function in ob/ob mice caused by SCD1 deficiency.

Novel regulatory mechanisms for generation of the soluble leptin receptor: implications for leptin action.

PubMed

Schaab, Michael; Kausch, Henriette; Klammt, Juergen; Nowicki, Marcin; Anderegg, Ulf; Gebhardt, Rolf; Rose-John, Stefan; Scheller, Juergen; Thiery, Joachim; Kratzsch, Juergen

2012-01-01

The adipokine leptin realizes signal transduction via four different membrane-anchored leptin receptor (Ob-R) isoforms in humans. However, the amount of functionally active Ob-R is affected by constitutive shedding of the extracellular domain via a so far unknown mechanism. The product of the cleavage process the so-called soluble leptin receptor (sOb-R) is the main binding protein for leptin in human blood and modulates its bioavailability. sOb-R levels are differentially regulated in metabolic disorders like type 1 diabetes mellitus or obesity and can, therefore, enhance or reduce leptin sensitivity. To describe mechanisms of Ob-R cleavage and to investigate the functional significance of differential sOb-R levels we established a model of HEK293 cells transiently transfected with different human Ob-R isoforms. Using siRNA knockdown experiments we identified ADAM10 (A Disintegrin And Metalloproteinase 10) as a major protease for constitutive and activated Ob-R cleavage. Additionally, the induction of lipotoxicity and apoptosis led to enhanced shedding shown by increased levels of the soluble leptin receptor (sOb-R) in cell supernatants. Conversely, high leptin concentrations and ER stress reduced sOb-R levels. Decreased amounts of sOb-R due to ER stress were accompanied by impaired leptin signaling and reduced leptin binding. Lipotoxicity and apoptosis increased Ob-R cleavage via ADAM10-dependent mechanisms. In contrast high leptin levels and ER stress led to reduced sOb-R levels. While increased sOb-R concentrations seem to directly block leptin action, reduced amounts of sOb-R may reflect decreased membrane expression of Ob-R. These findings could explain changes of leptin sensitivity which are associated with variations of serum sOb-R levels in metabolic diseases.

Novel Regulatory Mechanisms for Generation of the Soluble Leptin Receptor: Implications for Leptin Action

PubMed Central

Schaab, Michael; Kausch, Henriette; Klammt, Juergen; Nowicki, Marcin; Anderegg, Ulf; Gebhardt, Rolf; Rose-John, Stefan; Scheller, Juergen; Thiery, Joachim; Kratzsch, Juergen

2012-01-01

Background The adipokine leptin realizes signal transduction via four different membrane-anchored leptin receptor (Ob-R) isoforms in humans. However, the amount of functionally active Ob-R is affected by constitutive shedding of the extracellular domain via a so far unknown mechanism. The product of the cleavage process the so-called soluble leptin receptor (sOb-R) is the main binding protein for leptin in human blood and modulates its bioavailability. sOb-R levels are differentially regulated in metabolic disorders like type 1 diabetes mellitus or obesity and can, therefore, enhance or reduce leptin sensitivity. Methodology/Principal Findings To describe mechanisms of Ob-R cleavage and to investigate the functional significance of differential sOb-R levels we established a model of HEK293 cells transiently transfected with different human Ob-R isoforms. Using siRNA knockdown experiments we identified ADAM10 (A Disintegrin And Metalloproteinase 10) as a major protease for constitutive and activated Ob-R cleavage. Additionally, the induction of lipotoxicity and apoptosis led to enhanced shedding shown by increased levels of the soluble leptin receptor (sOb-R) in cell supernatants. Conversely, high leptin concentrations and ER stress reduced sOb-R levels. Decreased amounts of sOb-R due to ER stress were accompanied by impaired leptin signaling and reduced leptin binding. Conclusions Lipotoxicity and apoptosis increased Ob-R cleavage via ADAM10-dependent mechanisms. In contrast high leptin levels and ER stress led to reduced sOb-R levels. While increased sOb-R concentrations seem to directly block leptin action, reduced amounts of sOb-R may reflect decreased membrane expression of Ob-R. These findings could explain changes of leptin sensitivity which are associated with variations of serum sOb-R levels in metabolic diseases. PMID:22545089

Ophiuchus

NASA Astrophysics Data System (ADS)

Murdin, P.

2000-11-01

(the Serpent-bearer; abbrev. Oph, gen. Ophiuchi; area 948 sq. deg.) An equatorial constellation which lies between Hercules and Scorpius, and culminates at midnight in mid-June. The ecliptic cuts across the southern part of Ophiuchus, but the constellation is not included among the constellations of the zodiac. Ophiuchus is usually said to represent Asclepius, the Greek god of medicine, and is sh...

Scorpius

NASA Astrophysics Data System (ADS)

Murdin, P.

2000-11-01

(the Scorpion; abbrev. Sco., gen. Scorpii; area 497 sq. deg.) A southern zodiacal constellation which lies between Ophiuchus and Ara, and culminates at midnight in early June. Its origin dates back to Sumerian times, when it was called Girtab, `the stinger', but today it is associated with the scorpion that, in Greek mythology, killed Orion the hunter—and the two constellations lie on opposite sid...

Leptin and leptin receptor are detectable in equine spermatozoa but are not involved in in vitro fertilisation.

PubMed

Lange-Consiglio, Anna; Corradetti, Bruna; Perrini, Claudia; Bizzaro, Davide; Cremonesi, Fausto

2016-04-01

In human and swine, leptin (OB) has been identified in seminal plasma and leptin receptors (OB-R) on the cell surface of spermatozoa, indicating that spermatozoa are a target for OB. This hormone has also been detected in follicular fluid (FF) in women and mares, although its role requires further study. The aims of this study were to investigate the immunolocalisation and the expression of OB and OB-R in equine spermatozoa and to evaluate the involvement of OB in equine in vitro fertilisation (IVF). Since progesterone (P) and OB are both found in FF, the individual and combined effects of these two hormones were studied in equine IVF and compared with the results obtained from the use of FF for in vitro sperm preparation. For the first time, we were able to identify OB and OB-R mRNA and their corresponding proteins in equine spermatozoa. When spermatozoa were treated with OB, there was a decrease in the three motility parameters VSL, STR and LIN, commonly associated with hyperactivation, whilst the acrosome reaction rate increased (P<0.05). The fertilisation rate was 51% with FF, 46.15% with P, 43.64% with P+OB and 0% with OB alone. The percentage of eight-cell stage embryos was 18.7% with FF, 17.1% with P and 16.7% with OB+P. OB alone did not permit oocyte fertilisation, indicating that, in the horse, OB is involved in capacitation and hyperactivation but not in sperm penetration.

Children and Adolescent Obesity Associates with Pressure-Dependent and Age-Related Increase in Carotid and Femoral Arteries' Stiffness and Not in Brachial Artery, Indicative of Nonintrinsic Arterial Wall Alteration

PubMed Central

García-Espinosa, Victoria; Curcio, Santiago; Castro, Juan Manuel; Arana, Maite; Giachetto, Gustavo; Chiesa, Pedro; Zócalo, Yanina

2016-01-01

Aim. To analyze if childhood obesity associates with changes in elastic, transitional, and/or muscular arteries' stiffness. Methods. 221 subjects (4–15 years, 92 females) were assigned to normal weight (NW, n = 137) or obesity (OB, n = 84) groups, considering their body mass index z-score. Age groups were defined: 4–8; 8–12; 12–15 years old. Carotid, femoral, and brachial artery local stiffness was determined through systodiastolic pressure-diameter and stress-strain relationships. To this end, arterial diameter and peripheral and aortic blood pressure (BP) levels and waveforms were recorded. Carotid-femoral, femoropedal, and carotid-radial pulse wave velocities were determined to evaluate aortic, lower-limb, and upper-limb regional arterial stiffness, respectively. Correlation analysis between stiffness parameters and BP was done. Results. Compared to NW, OB subjects showed higher peripheral and central BP and carotid and femoral stiffness, reaching statistical significance in subjects aged 12 and older. Arterial stiffness differences disappeared when levels were normalized for BP. There were no differences in intrinsic arterial wall stiffness (elastic modulus), BP stiffness relationships, and regional stiffness parameters. Conclusion. OB associates with BP-dependent and age-related increase in carotid and femoral (but not brachial) stiffness. Stiffness changes would not be explained by intrinsic arterial wall alterations but could be associated with the higher BP levels observed in obese children. PMID:27066273

Stratiform and Convective Precipitation Properties of Tropical Cyclones in the Northwest Pacific

NASA Astrophysics Data System (ADS)

Yang, Zhaohong; Yuan, Tie; Jiang, Haiyan; Zhang, Lei; Zhang, Chen

2018-04-01

The properties of stratiform and the convective precipitation of tropical cyclones (TCs) over the northwest Pacific are examined using the Tropical Rainfall Measuring Mission data for 1998-2013. TCs are classified into inner core (IC), inner rainband (IB), and outer rainband (OB) regions, and the results show that TCs are dominated by stratiform precipitation, which accounts for more than 78% of the total raining area. The highest fraction of the stratiform raining area exists in the IB region and increases as the TC intensity increases (from 80% to 93%). Strong convective signatures generally occur in the IC region, less often in the IB region, and least often in the OB region. Stratiform precipitation in the IC region generally has comparable or even stronger ice scattering signatures and higher 20 dBZ radar echo heights than the convective precipitation in the IB and OB regions. Weak convection decreases significantly as the TC intensity increases, which leads to increased convective intensity. Stratiform (convective) precipitation accounts for 61% (39%) of the total TC volumetric rain and 25% (75%) of the total TC lightning flash, respectively. Moreover, stratiform precipitation's contribution to the total TC volumetric rain and lightning flash increases as the TC intensity increases, which indicates that stronger TCs are favorable for maintaining more stratiform precipitation. The stratiform and convective precipitation properties in different TC regions and intensities cooperatively change with the enhanced ascending branch in the IC region and the radial outflow at the upper levels of the secondary circulation.

From Head to Sword: The Clustering Properties of Stars in Orion

NASA Astrophysics Data System (ADS)

Gomez, Mercedes; Lada, Charles J.

1998-04-01

We investigate the structure in the spatial distributions of optically selected samples of young stars in the Head (lambda Orionis) and in the Sword (Orion A) regions of the constellation of Orion with the aid of stellar surface density maps and the two-point angular correlation function. The distributions of young stars in both regions are found to be nonrandom and highly clustered. Stellar surface density maps reveal three distinct clusters in the lambda Ori region. The two-point correlation function displays significant features at angular scales that correspond to the radii and separations of the three clusters identified in the surface density maps. Most young stars in the lambda Ori region (~80%) are presently found within these three clusters, consistent with the idea that the majority of young stars in this region were formed in dense protostellar clusters that have significantly expanded since their formation. Over a scale of ~0.05d-0.5d the correlation function is well described by a single power law that increases smoothly with decreasing angular scale. This suggests that, within the clusters, the stars either are themselves hierarchically clustered or have a volume density distribution that falls steeply with radius. The relative lack of Hα emission-line stars in the one cluster in this region that contains OB stars suggests a timescale for emission-line activity of less than 4 Myr around late-type stars in the cluster and may indicate that the lifetimes of protoplanetary disks around young stellar objects are reduced in clusters containing O stars. The spatial distribution of young stars in the Orion A region is considerably more complex. The angular correlation function of the OB stars (which are mostly foreground to the Orion A molecular cloud) is very similar to that of the Hα stars (which are located mostly within the molecular cloud) and significantly different from that of the young stars in the lambda Ori region. This suggests that, although spatially separated, both populations in the Orion A region may have originated from a similar fragmentation process. Stellar surface density maps and modeling of the angular correlation function suggest that somewhat less than half of the OB and Hα stars in the Orion A cloud are presently within well-defined stellar clusters. Although all the OB stars could have originated in rich clusters, a significant fraction of the Hα stars appear to have formed outside such clusters in a more spatially dispersed manner. The close similarity of the angular correlation functions of the OB and Hα stars toward the molecular cloud, in conjunction with the earlier indications of a relatively high star formation rate and high gas pressure in this cloud, is consistent with the idea that older, foreground OB stars triggered the current episode of star formation in the Orion A cloud. One of the OB clusters (Upper Sword) that is foreground to the cloud does not appear to be associated with any of the clusterings of emission-line stars, again suggesting a timescale (<4 Myr) for emission-line activity and disk lifetimes around late-type stars born in OB clusters.

Evidence for an interaction between leptin, T cell costimulatory antigens CD28, CTLA-4 and CD26 (dipeptidyl peptidase IV) in BCG-induced immune responses of leptin- and leptin receptor-deficient mice.

PubMed

Rüter, Jens; Hoffmann, Torsten; Demuth, Hans-Ulrich; Moschansky, Petra; Klapp, Burghard F; Hildebrandt, Martin

2004-06-01

We assessed changes of the enzyme dipeptidyl peptidase IV (DPP IV, CD26) in the context of leptin or leptin receptor deficiency. C57BL/6 mice, Leptin-deficient mice (ob/ob mice, B6.V-Lep) and Leptin-receptor-deficient mice (db/db mice, B6.Cg-m+/+Lepr) were infected with B. Calmette-Guerin (BCG) and sacrificed three days later. DPP IV activity in serum was higher in ob/ob mice and in db/db mice than in wild-type mice. The expression of DPP IV/CD26 on splenocytes was higher in ob/ob mice than in wild-type animals, and lower in db/db mice, and decreased upon stimulation with BCG in ob/ob mice only. Several T cell antigens including CTLA-4 were expressed aberrantly in ob/ob and in db/db mice. Our observations provide evidence for a relationship between DPP IV and leptin.

Effects of ovarian steroids and prolactin on the sequential development of nesting behaviour in female budgerigars.

PubMed

Hutchison, R E

1975-10-01

As intact, breeding female budgerigars approach egg-laying, they spend an increasing amount of time in the nestbox and nest hollow. The brood patch area begins to defeather and becomes vascular and the oviduct increases in weight. Precursory albumen forms in the tubular glands of the oviduct. Oestradiol (OB) treatment in combination with prolactin (OB+PL) induced ovariectomized budgerigars to display nesting behaviour which did not differ from that shown by intact females in the 3 days immediately preceding egg-laying. In contrast, OB induced only the initial phase of the nesting sequence and the effects of OB in combination with progesterone (OB+PR) were intermediate between treatments with OB alone and OB+PL. Incubation of artificial eggs occurred only in the OB+PL group and the latency to display of the incubation posture was shorter in the OB+PL group than in the OB+PR group. No incubation posture was displayed by the OB-treated group. Oviduct development was not influenced by prolactin, but progesterone induced precocious development of tubular glands in the magnum region of the oviduct. Treatment with OB+PR induced uniform development of precursor albumen in the tubular glands. Development of the brood patch occurred with both OB+PL and OB+PR treatment. However, OB+PR resulted in defeathering which was advanced in relation to vascularity when compared with intact breeding females, whereas defeathering and vascularity of the OB+PL group did not differ from that of intact females at egg-laying. These results indicate that prolactin in combination with oestradiol was more effective than progesterone not only in inducing the later phases of nesting behaviour but also in initiating incubation behaviour and defeathering of the brood patch area.

Interleukin-18, together with interleukin-12, induces severe acute pancreatitis in obese but not in nonobese leptin-deficient mice

PubMed Central

Sennello, Joseph A.; Fayad, Raja; Pini, Maria; Gove, Melissa E.; Ponemone, Venkatesh; Cabay, Robert J.; Siegmund, Britta; Dinarello, Charles A.; Fantuzzi, Giamila

2008-01-01

Obesity is associated with increased severity of acute pancreatitis (AP). The cytokines IL-18 and IL-12 are elevated in patients with AP, and IL-18 levels are high in obesity. We aimed to develop a pathologically relevant model to study obesity-associated severe AP. Lean WT and obese leptin-deficient ob/ob mice received two injections of IL-12 plus IL-18. Survival, pancreatic inflammation, and biochemical markers of AP were measured. Dosing with IL-12 plus IL-18 induced 100% lethality in ob/ob mice; no lethality was observed in WT mice. Disruption of pancreatic exocrine tissue and acinar cell death as well as serum amylase and lipase levels were significantly higher in ob/ob than in WT mice. Edematous AP developed in WT mice, whereas obese ob/ob mice developed necrotizing AP. Adipose tissue necrosis and saponification were present in cytokine-injected ob/ob but not in WT mice. Severe hypocalcemia and elevated acute-phase response developed in ob/ob mice. The cytokine combination induced high levels of regenerating protein 1 and pancreatitis-associated protein expression in the pancreas of WT but not of ob/ob mice. To differentiate the contribution of obesity to that of leptin deficiency, mice received short- and long-term leptin replacement therapy. Short-term leptin reconstitution in the absence of major weight loss did not protect ob/ob mice, whereas leptin deficiency in the absence of obesity resulted in a significant reduction in the severity of the pancreatitis. In conclusion, we developed a pathologically relevant model of AP in which obesity per se is associated with increased severity. PMID:18515422

Object-based connectedness facilitates matching.

PubMed

Koning, Arno; van Lier, Rob

2003-10-01

In two matching tasks, participants had to match two images of object pairs. Image-based (IB) connectedness refers to connectedness between the objects in an image. Object-based (OB) connectedness refers to connectedness between the interpreted objects. In Experiment 1, a monocular depth cue (shadow) was used to distinguish different relation types between object pairs. Three relation types were created: IB/OB-connected objects, IB/OB-disconnected objects, and IB-connected/OB-disconnected objects. It was found that IB/OB-connected objects were matched faster than IB/OB-disconnected objects. Objects that were IB-connected/OB-disconnected were matched equally to IB/OB-disconnected objects. In Experiment 2, stereoscopic presentation was used. With relation types comparable to those in Experiment 1, it was again found that OB connectedness determined speed of matching, rather than IB connectedness. We conclude that matching of projections of three-dimensional objects depends more on OB connectedness than on IB connectedness.

Directional Limits on Persistent Gravitational Waves from Advanced LIGO's First Observing Run

NASA Astrophysics Data System (ADS)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allocca, A.; Altin, P. A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Beer, C.; Bejger, M.; Belahcene, I.; Belgin, M.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Biscoveanu, A. S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Campbell, W.; Canepa, M.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M.; Conti, L.; Cooper, S. J.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, E.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Davis, D.; Daw, E. J.; Day, B.; Day, R.; De, S.; DeBra, D.; Debreczeni, G.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Essick, R. C.; Etienne, Z.; Etzel, T.; Evans, M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Fernández Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J.-M.; Isi, M.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kelley, D. B.; Kennedy, R.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, Whansun; Kim, W.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Klein, B.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lockerbie, N. A.; Lombardi, A. L.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lousto, C. O.; Lovelace, G.; Lück, H.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña-Sandoval, F.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGrath, C.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Mytidis, A.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Rhoades, E.; Ricci, F.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, J. D.; Romano, R.; Romie, J. H.; Rosińska, D.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schlassa, S.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Setyawati, Y.; Shaddock, D. A.; Shaffer, T. J.; Shahriar, M. S.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stevenson, S. P.; Stone, R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tao, D.; Tápai, M.; Taracchini, A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tippens, T.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tomlinson, C.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tse, M.; Tso, R.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Weßels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; ZadroŻny, A.; Zangrando, L.; Zanolin, M.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration

2017-03-01

We employ gravitational-wave radiometry to map the stochastic gravitational wave background expected from a variety of contributing mechanisms and test the assumption of isotropy using data from the Advanced Laser Interferometer Gravitational Wave Observatory's (aLIGO) first observing run. We also search for persistent gravitational waves from point sources with only minimal assumptions over the 20-1726 Hz frequency band. Finding no evidence of gravitational waves from either point sources or a stochastic background, we set limits at 90% confidence. For broadband point sources, we report upper limits on the gravitational wave energy flux per unit frequency in the range Fα ,Θ(f )<(0.1 - 56 )×10-8 erg cm-2 s-1 Hz-1(f /25 Hz )α -1 depending on the sky location Θ and the spectral power index α . For extended sources, we report upper limits on the fractional gravitational wave energy density required to close the Universe of Ω (f ,Θ )<(0.39 - 7.6 )×10-8 sr-1(f /25 Hz )α depending on Θ and α . Directed searches for narrowband gravitational waves from astrophysically interesting objects (Scorpius X-1, Supernova 1987 A, and the Galactic Center) yield median frequency-dependent limits on strain amplitude of h0<(6.7 ,5.5 , and 7.0 )×10-25 , respectively, at the most sensitive detector frequencies between 130-175 Hz. This represents a mean improvement of a factor of 2 across the band compared to previous searches of this kind for these sky locations, considering the different quantities of strain constrained in each case.

Association between ferritin and hepcidin levels and inflammatory status in patients with type 2 diabetes mellitus and obesity.

PubMed

Andrews, Mónica; Soto, Néstor; Arredondo-Olguín, Miguel

2015-01-01

The aim of this study was to determine the association between iron parameters and inflammation in obese individuals with and without type 2 diabetes mellitus (T2DM). We studied 132 obese individuals (OB), 60 individuals with T2DM, 106 obese individuals with T2DM (T2DOB), and 146 controls (C). All of were men aged >30 y. Biochemical, iron nutrition, and oxidative stress parameters were determined. Peripheral mononuclear cells were isolated and total RNA was extracted to quantify tumor necrosis factor (TNF)-α, nuclear factor (NF)-κB, interleukin (IL)-6, toll-like receptor (TLR)-2/4 and hepcidin by quantitative reverse transcription polymerase chain reaction. OB, T2DM, and T2DOB individuals had higher ferritin, retinol-binding protein 4, and thiobarbituric acid reactive substance (TBAR) levels than controls. T2DOB and T2DM individuals showed high high-sensitivity C-reactive protein (hsCRP) levels and OB with and without T2DM had elevated levels of serum hepcidin. Heme oxygenase activity was high in OB and T2DM and there were no differences observed in superoxide dismutase and glutathione parameters. A correlation between TBARS and ferritin in T2DOB was observed (r = 0.31; P < 0.006). Multiple linear regression analysis showed an association between diabetes and obesity with ferritin, TBARS, and hsCRP levels. The upper quartiles of ferritin, TBARS and hepcidin showed an adjusted odd ratio for T2DM of 1.782, 2.250, and 4.370, respectively. TNF-α, IL-6, hepcidin, NF-κB, TLR-2/4 mRNA abundances were increased in T2DM and T2DOB. Elevated hsCRP and hepcidin levels, and increased gene expression of TNF-α, IL-6, NF-κB, and TLR-2/4 in patients with diabetes, obesity, or both exacerbate and perpetuate the insulin resistance and inflammatory state. Copyright © 2015 Elsevier Inc. All rights reserved.

Multifrequency tomography of the La Reunion mantle plume with P and S waves using ocean bottom seismometers in the Indian Ocean

NASA Astrophysics Data System (ADS)

Tsekhmistrenko, M.; Sigloch, K.; Hosseini, K.

2017-12-01

The RHUM-RUM experiment (Reunion Hotspot Upper Mantle - Reunions Unterer Mantel) investigates the presence or absence of a whole mantle plume beneath the volcanic hotspot island of La Reunion. From 2011 to 2016, RHUM-RUM instrumented a 2000 km x 2000 km area of western Indian Ocean seafloor, islands and Madagascar with broadband seismometers and hydrophones. The central component was a 13-month deployment of 57 German and French Ocean Bottom Seismometers (OBS) in 2300-5600 m depth. This was supplemented by 2-3 years deployments of 37 island stations on Reunion, Mauritius, Rodrigues, the southern Seychelles, the Iles Eparses and southern Madagascar. Two partner projects contributed another 30+ stations on Madagascar. We present results of multifrequency P- and S-waveform tomography of the entire mantle column beneath the Reunion hotspot. We use all frequency passbands that efficiently transmit body waves and rise above the considerable noise floor of OBS measurements. More than 200 teleseismic events during the 13-month long OBS deployment yielded usable measurements, and another 400 events before and after. We present our methods, discuss data yield and quality of ocean-bottom versus island/land seismometers and hydrophones. 150,000 combined cross-correlations measurements were used in multifrequency P-wave tomography, in passbands between 30 s and 2.7 s dominant period. Cross-correlation coefficients at permanent and temporal land stations are generally higher than on OBS, which are more affected by both microseismic and self-noise. Hydrophones worked more reliably, but strong reverberations from the water column mean that they are still less usable than seismograms. All measurements of the RHUM-RUM array are embedded in a global P-wave inversion. Mantle structures obtained from this new, high resolution tomographic model of the La Reunion area are compared to existing tomographies. We also compare to local and global convection models in order to understand the relation between mantle flow and the development of mantle plumes through time.

Finite frequency P-wave traveltime measurements on ocean bottom seismometers and hydrophones in the western Indian Ocean

NASA Astrophysics Data System (ADS)

Tsekhmistrenko, Maria; Sigloch, Karin; Hosseini, Kasra; Barruol, Guilhem

2016-04-01

From 2011 to 2014, the RHUM-RUM project (Reunion Hotspot Upper Mantle - Reunions Unterer Mantel) instrumented a 2000x2000km2 area of Indian Ocean seafloor, islands and Madagascar with broadband seismometers and hydrophones. The central component was a 13-month deployment of 57 German and French Ocean Bottom Seismometers (OBS) in 2300-5600 m depth. This was supplemented by 2-3 year deployments of 37 island stations on Reunion, Mauritius, Rodrigues, the southern Seychelles, the Iles Eparses and southern Madagascar. Two partner projects contributed another 30+ stations on Madagascar. Our ultimate objective is multifrequency waveform tomography of the entire mantle column beneath the Reunion hotspot. Ideally we would use all passbands that efficiently transmit body waves but this meets practical limits in the noise characteristics of ocean-bottom recordings in particular. Here we present the preliminary data set of frequency-dependent P-wave traveltime measurements on seismometers and hydrophones, obtained by cross-correlation of observed with predicted waveforms. The latter are synthesized from fully numerical Green's functions and carefully estimated, broadband source time functions. More than 200 teleseismic events during the 13-month long deployment yielded usable P-waveform measurements. We present our methods and discuss data yield and quality of ocean-bottom versus land seismometers, and of OBS versus broadband hydrophones. Above and below the microseismic noise band, data yields are higher than within it, especially for OBS. The 48 German OBS, equipped with Guralp 60 s sensors, were afflicted by relatively high self-noise compared to the 9 French instruments equipped with Nanometrics Trillium 240 s sensors. The HighTechInc (model HTI-01 and HTI-04-PCA/ULF) hydrophones (100 s corner period) functioned particularly reliably but their waveforms are relatively more challenging to model due to reverberations in the water column. We obtain ~15000 combined cross-correlations measurements that should be usable in multifrequency P-wave tomography, in passbands between 30 s and 2.7 s dominant period.

Deficiency in Nrf2 transcription factor decreases adipose tissue mass and hepatic lipid accumulation in leptin-deficient mice.

PubMed

Xu, Jialin; Donepudi, Ajay C; More, Vijay R; Kulkarni, Supriya R; Li, Liya; Guo, Liangran; Yan, Bingfang; Chatterjee, Tapan; Weintraub, Neal; Slitt, Angela L

2015-02-01

To evaluate whether Nrf2 deficiency impacts insulin resistance and lipid accumulation in liver and white adipose tissue. Lep(ob/ob) mice (OB) with targeted Nrf2 deletion (OB-Nrf2KO) were generated. Pathogenesis of obesity and type 2 diabetes was measured in C57BL/6J, Nrf2KO, OB, and OB-Nrf2KO mice. Hepatic lipid content, lipid clearance, and very low-density lipoprotein (VLDL) secretion were determined between OB and OB-Nrf2KO mice. OB-Nrf2KO mice exhibited decreased white adipose tissue mass and decreased adipogenic and lipogenic gene expression compared with OB mice. Nrf2 deficiency prolonged hyperglycemia in response to glucose challenge, which was paralleled by reduced insulin-stimulated Akt phosphorylation. In OB mice, Nrf2 deficiency decreased hepatic lipid accumulation, decreased peroxisome proliferator-activated receptor γ expression and nicotinamide adenine dinucleotide phosphate (NADPH) content, and enhanced VLDL secretion. However, this observation was opposite in lean mice. Additionally, OB-Nrf2KO mice exhibited increased plasma triglyceride content, decreased HDL-cholesterol content, and enhanced apolipoprotein B expression, suggesting Nrf2 deficiency caused dyslipidemia in these mice. Nrf2 deficiency in Lep(ob/ob) mice reduced white adipose tissue mass and prevented hepatic lipid accumulation but induced insulin resistance and dyslipidemia. This study indicates a dual role of Nrf2 during metabolic dysregulation-increasing lipid accumulation in liver and white adipose tissue but preventing lipid accumulation in obese mice. © 2014 The Obesity Society.

Chromium (D-phenylalanine)3 improves obesity-induced cardiac contractile defect in ob/ob mice.

PubMed

Dong, Feng; Yang, Xiaoping; Sreejayan, Nair; Ren, Jun

2007-11-01

Low-molecular weight chromium compounds, such as chromium picolinate [Cr(pic)(3)], improve insulin sensitivity, although toxicity is a concern. We synthesized a novel chromium complex, chromium (d-phenylalanine)(3) [Cr(d-phe)(3)], in an attempt to improve insulin sensitivity with reduced toxicity. The aim of this study was to compare the two chromium compounds on cardiac contractile function in ob/ob obese mice. C57BL lean and ob/ob obese mice were randomly divided into three groups: H(2)O, Cr(d-phe)(3), or Cr(pic)(3) (45 mug/kg per day orally for 6 months). The glucose tolerance test displayed improved glucose clearance by Cr(d-phe)(3) but not Cr(pic)(3). Myocytes from ob/ob mice exhibited depressed peak shortening (PS) and maximal velocity of shortening/relengthening (+/-dL/dt), prolonged time-to-PS and time-to-90% relengthening (TR90), reduced electrically stimulated rise in intracellular Ca(2+) (Deltafura-2 fluorescence intensity), and slowed intracellular Ca(2+) decay. Although a 3-month Cr(d-phe)(3) treatment for a separate group of ob/ob and lean 2-month-old mice only rectified reduced +/-dL/dt in ob/ob mice, all mechanical and intracellular Ca(2+) abnormalities were significantly attenuated or ablated by 6 months of Cr(d-phe)(3) but not Cr(pic)(3) treatment (except TR90). Sarco(endo)plasmic reticulum Ca(2+) ATPase activity and Na(+)-Ca(2+) exchanger expression were depressed in ob/ob mice, which were reversed by both Cr(d-phe)(3) and Cr(pic)(3), with a more pronounced effect from Cr(d-phe)(3). Cr(d-phe)(3) corrected reduced insulin-stimulated glucose uptake and improved basal phosphorylation of Akt and insulin receptor, as well as insulin-stimulated phosphorylation of Akt and insulin receptor in ob/ob myocytes. Heart homogenates from ob/ob mice had enhanced oxidative stress and protein carbonyl formation compared with the lean group, which were attenuated by both Cr(d-phe)(3) and Cr(pic)(3). Our data suggest that the new Cr(d-phe)(3) compound possesses better cardio-protective and insulin-sensitizing properties against obesity.

Brain volume in early MS patients with and without IgG oligoclonal bands in CSF.

PubMed

Fenu, G; Lorefice, L; Sechi, V; Loi, L; Contu, F; Cabras, F; Coghe, G; Frau, J; Secci, M A; Melis, C; Schirru, L; Costa, G; Melas, V; Arru, M; Barracciu, M A; Marrosu, M G; Cocco, E

2018-01-01

Oligoclonal bands of IgG (OB) are proposed as an early prognostic factor of the disease. Growing attention is directed towards brain volume evaluation as a possible marker of the severity of MS. Previous studies found that MS patients lacking OB have less brain atrophy. to evaluate a possible relationship between OB and cerebral volume in a cohort of early MS patients. Inclusion criteria were: diagnosis of relapsing-remitting MS; CSF analysis and MRI acquired simultaneously and within 12 months from clinical onset. A total of 15 healthy controls underwent MRI. In 20 MS patients, CSF analysis did not show OB synthesis (OB negative group). A control group of 25 MS patients in whom OB was detected was also randomly recruited (OB positive group). T test showed a significant difference in NWV between the OB positive and OB negative groups (P value = 0.01), and between the OB positive group and the healthy controls (P value = 0.001). No differences were detected between OB negative group and healthy controls. Multivariable linear regression showed a relationship between NWV and OB synthesis (P value = 0.02) controlling for age, gender, and EDSS. Our preliminary results suggest that OB positive patients show more atrophy of white matter since early phases of the disease, supporting the role of CSF analysis as a prognostic factor in MS. Copyright © 2017 Elsevier B.V. All rights reserved.

Switching performance of OBS network model under prefetched real traffic

NASA Astrophysics Data System (ADS)

Huang, Zhenhua; Xu, Du; Lei, Wen

2005-11-01

Optical Burst Switching (OBS) [1] is now widely considered as an efficient switching technique in building the next generation optical Internet .So it's very important to precisely evaluate the performance of the OBS network model. The performance of the OBS network model is variable in different condition, but the most important thing is that how it works under real traffic load. In the traditional simulation models, uniform traffics are usually generated by simulation software to imitate the data source of the edge node in the OBS network model, and through which the performance of the OBS network is evaluated. Unfortunately, without being simulated by real traffic, the traditional simulation models have several problems and their results are doubtable. To deal with this problem, we present a new simulation model for analysis and performance evaluation of the OBS network, which uses prefetched IP traffic to be data source of the OBS network model. The prefetched IP traffic can be considered as real IP source of the OBS edge node and the OBS network model has the same clock rate with a real OBS system. So it's easy to conclude that this model is closer to the real OBS system than the traditional ones. The simulation results also indicate that this model is more accurate to evaluate the performance of the OBS network system and the results of this model are closer to the actual situation.

Hyperphagia, lower body temperature, and reduced running wheel activity precede development of morbid obesity in New Zealand obese mice.

PubMed

Jürgens, Hella S; Schürmann, Annette; Kluge, Reinhart; Ortmann, Sylvia; Klaus, Susanne; Joost, Hans-Georg; Tschöp, Matthias H

2006-04-13

Among polygenic mouse models of obesity, the New Zealand obese (NZO) mouse exhibits the most severe phenotype, with fat depots exceeding 40% of total body weight at the age of 6 mo. Here we dissected the components of energy balance including feeding behavior, locomotor activity, energy expenditure, and thermogenesis compared with the related lean New Zealand black (NZB) and obese B6.V-Lep(ob)/J (ob/ob) strains (11% and 65% fat at 23 wk, respectively). NZO mice exhibited a significant hyperphagia that, when food intake was expressed per metabolic body mass, was less pronounced than that of the ob/ob strain. Compared with NZB, NZO mice exhibited increased meal frequency, meal duration, and meal size. Body temperature as determined by telemetry with implanted sensors was reduced in NZO mice, but again to a lesser extent than in the ob/ob strain. In striking contrast to ob/ob mice, NZO mice were able to maintain a constant body temperature during a 20-h cold exposure, thus exhibiting a functioning cold-induced thermogenesis. No significant differences in spontaneous home cage activity were observed among NZO, NZB, and ob/ob strains. When mice had access to voluntary running wheels, however, running activity was significantly lower in NZO than NZB mice and even lower in ob/ob mice. These data indicate that obesity in NZO mice, just as in humans, is due to a combination of hyperphagia, reduced energy expenditure, and insufficient physical activity. Because NZO mice differ strikingly from the ob/ob strain in their resistance to cold stress, we suggest that the molecular defects causing hyperphagia in NZO mice are located distal from leptin and its receptor.

Ara

NASA Astrophysics Data System (ADS)

Murdin, P.

2000-11-01

(the Altar; abbrev. Ara, gen. Arae; area 237 sq. deg.) A southern constellation that lies between Scorpius and Apus, and culminates at midnight in early June. It is said to represent the altar upon which in Greek mythology the gods swore allegiance before their battle against the Titans, and that upon which Chiron, the centaur, is about to sacrifice Lupus, the wolf (which was a neighboring conste...

Biochemical indicators of pollution exposure in shorthorn sculpin (Myoxocephalus scorpius), caught in four harbours on the southwest coast of Iceland.

PubMed

Stephensen; Svavarsson; Sturve; Ericson; Adolfsson-Erici; Förlin

2000-04-01

Shorthorn sculpins (Myoxocephalus scorpius) were caught in four Icelandic harbours, differing in size, use and traffic. Biochemical responses in liver were measured and chemicals analysed in bile. Eyrarbakki harbour, which has not been in use for many years was chosen as a control site. Njar partial differentialvík harbour is a small fishing harbour and a marina, Sandger partial differentiali harbour is a large fishing harbour, and Reykjavík harbour is a large fishing harbour and an international transport harbour. Higher levels of DNA-adducts and cytochrome P4501A (CYP1A) in the fish from the harbours in Sandger partial differentiali, Njar partial differentialvík and Reykjavík, compared to Eyrarbakki harbour, indicate PAH exposure. This was confirmed by PAH analysis in bile. The higher activities of the antioxidant enzymes catalase (CAT), glutathione peroxidase (GPx) and glutathione reductase (GR) in fish caught in Sandger partial differentiali, than in fish caught in the other harbours, indicate exposure of sculpin to prooxidative compounds in Sandger partial differentiali harbour. Shorthorn sculpin seems to be a convenient species for monitoring pollution in northern coastal areas.

A Multi-Year Light Curve of Scorpius X-1 Based on CGRO BATSE Spectroscopy Detector Observations

NASA Technical Reports Server (NTRS)

McNamara, B. J.; Harrison, T. E.; Mason, P. A.; Templeton, M.; Heikkila, C. W.; Buckley, T.; Galvan, E.; Silva, A.; Harmon, B. A.

1998-01-01

A multi-year light curve of the low mass X-ray binary, Scorpius X-1, is constructed based on the Compton Gamma-ray Observatory (CGRO) Burst and Transient Source Experiment (BATSE) Spectroscopy Detector (SD) data in the nominal energy range of 10-20 keV. A detailed discussion is given of the reduction process of the BATSE/SD data. Corrections to the SD measurements are made for off-axis pointings, spectral and bandpass changes, and differences in the eight SD sensitivities. The resulting 4.4 year Sco X-1 SD light curve is characterized in terms of the time scales over which various types of emission changes occur. This light curve is then compared with Sco X-1 light curves obtained by Axiel 5, the BATSE Large Area Detectors (LADs), and the RXTE all-sky monitor (ASM). Coincident temporal coverage by the BATSE/SD and RXTE/ASM allows a direct comparison of the behavior of Sco X-1 over a range of high energies to be made. These ASM light curves are then used to discuss model constraints on the Sco X-1 system.

Morphological and biochemical alterations of skeletal muscles from the genetically obese (ob/ob) mouse.

PubMed

Kemp, J G; Blazev, R; Stephenson, D G; Stephenson, G M M

2009-08-01

Knowledge of the morphological and biochemical alterations occurring in skeletal muscles of obese animals is relatively limited, particularly with respect to non-limb muscles and relationship to fibre type. Sternomastoid (SM; fast-twitch), extensor digitorum longus (EDL; fast-twitch), and soleus (SOL; mixed) muscles of ob/ob mouse (18-22 weeks) were examined with respect to size (mass, muscle mass-to-body mass ratio, cross-sectional area (CSA)), fibre CSA, protein content, myosin heavy chain (MHC) content, MHC isoform (MHC(i)) composition, MHC(i)-based fibre type composition, and lactate dehydrogenase isoenzyme (LDH(iso)) composition. Compared with (control) muscles from lean mice, all the three muscles from ob/ob mice were smaller in size (by 13-30%), with SM and EDL being the most affected. The CSA of IIB and IIB+IID fibres (the predominant fibre types in SM and EDL muscles) was markedly smaller (by approximately 30%) in ob/ob mice, consistent with differences in muscle size. Total protein content (normalised to muscle mass) was significantly lower in EDL (-9.7%) and SOL (-14.1%) muscles of ob/ob mice, but there were no differences between SM, EDL, and SOL muscles from the two animal groups with respect to MHC content (also normalised to muscle mass). Electrophoretic analyses of MHC(i) composition in whole muscle homogenates and single muscle fibres showed a shift towards slower MHC(i) content, slower MHC(i) containing fibres, and a greater proportion of hybrid fibres in all the three muscles of ob/ob mice, with a shift towards a more aerobic-oxidative phenotype also observed with respect to LDH(iso) composition. This study showed that SM, EDL, and SOL muscles of ob/ob mice display size reductions to an extent that seems to be largely related to fibre type composition, and a shift in fibre type composition that may result from a process of structural remodelling, as suggested by the increased proportion of hybrid fibres in muscles of ob/ob mice.

All-trans retinoic acid stimulates gene expression of the cardioprotective natriuretic peptide system and prevents fibrosis and apoptosis in cardiomyocytes of obese ob/ob mice.

PubMed

Manolescu, Daniel-Constantin; Jankowski, Marek; Danalache, Bogdan A; Wang, Donghao; Broderick, Tom L; Chiasson, Jean-Louis; Gutkowska, Jolanta

2014-10-01

In hypertensive rodents, retinoic acid (RA) prevents adverse cardiac remodelling and improves myocardial infarction outcome, but its role in obesity-related changes of cardiac tissue are unclear. We hypothesized that all-trans RA (ATRA) treatment will improve the cardioprotective oxytocin-natriuretic peptides (OT-NP) system, preventing apoptosis and collagen accumulation in hearts of ob/ob mice, a mouse model of obesity and insulin resistance. Female 9-week-old B6.V-Lep/J ob/ob mice (n = 16) were divided into 2 groups: 1 group (n = 8) treated with 100 μg of ATRA dissolved in 100 μL of corn oil (vehicle) delivered daily (∼2 μg·g body weight(-1)·day(-1)) by stomach intubation for 16 days, and 1 group (n = 8) that received the vehicle alone. A group of nonobese littermate mice (n = 9) served as controls. Ob/ob mice exhibited obesity, hyperglycaemia, and downregulation of the cardiac OT-NP system, including the mRNA for the transcription factor GATA4, OT receptor and brain NP, and the protein expression for endothelial nitric oxide synthase. Hearts from ob/ob mice also demonstrated increased apoptosis and collagen accumulation. ATRA treatment induced weight loss and decreased adipocytes diameter in the visceral fat, thus reducing visceral obesity, which is associated with a high risk for cardiovascular disease. RA treatment was associated with a reduction in hyperglycemia and a normalization of the OT-NP system's expression in the hearts of ob/ob mice. Furthermore, ATRA treatment prevented apoptosis and collagen accumulation in hearts of ob/ob mice. The present study indicates that ATRA treatment was effective in restoring the cardioprotective OT-NP system and in preventing abnormal cardiac remodelling in the ob/ob mice.

Image quality and diagnostic performance of free-breathing diffusion-weighted imaging for hepatocellular carcinoma.

PubMed

Takayama, Yukihisa; Nishie, Akihiro; Asayama, Yoshiki; Ishigami, Kousei; Kakihara, Daisuke; Ushijima, Yasuhiro; Fujita, Nobuhiro; Shirabe, Ken; Takemura, Atsushi; Honda, Hiroshi

2017-05-18

To retrospectively evaluate the diagnostic performance of free-breathing diffusion-weighted imaging (FB-DWI) with modified imaging parameter settings for detecting hepatocellular carcinomas (HCCs). Fifty-one patients at risk for HCC were scanned with both FB-DWI and respiratory-triggered DWI with the navigator echo respiratory-triggering technique (RT-DWI). Qualitatively, the sharpness of the liver contour, the image noise and the chemical shift artifacts on each DWI with b -values of 1000 s/mm 2 were independently evaluated by three radiologists using 4-point scoring. We compared the image quality scores of each observer between the two DWI methods, using the Wilcoxon signed-rank test. Quantitatively, we compared the signal-to-noise ratios (SNRs) of the liver parenchyma and lesion-to-nonlesion contrast-to-noise ratios (CNRs) after measuring the signal intensity on each DWI with a b-factor of 1000 s/mm 2 . The average SNRs and CNRs between the two DWI methods were compared by the paired t-test. The detectability of HCC on each DWI was also analyzed by three radiologists. The detectability provided by the two DWI methods was compared using McNemar's test. For all observers, the averaged image quality scores of FB-DWI were: Sharpness of the liver contour [observer (Obs)-1, 3.08 ± 0.81; Obs-2, 2.98 ± 0.73; Obs-3, 3.54 ± 0.75], those of the distortion (Obs-1, 2.94 ± 0.50; Obs-2, 2.71 ± 0.70; Obs-3, 3.27 ± 0.53), and the chemical shift artifacts (Obs-1, 3.38 ± 0.60; Obs-2, 3.15 ± 1.07; Obs-3, 3.21 ± 0.85). The averaged image quality scores of RT-DWI were: Sharpness of the liver contour (Obs-1, 2.33 ± 0.65; Obs-2, 2.37 ± 0.74; Obs-3, 2.75 ± 0.81), distortion (Obs-1, 2.81 ± 0.56; Obs-2, 2.25 ± 0.74; Obs-3, 2.96 ± 0.71), and the chemical shift artifacts (Obs-1, 2.92 ± 0.59; Obs-2, 2.21 ± 0.85; Obs-3, 2.77 ± 1.08). All image quality scores of FB-DWI were significantly higher than those of RT-DWI ( P < 0.05). The average SNR of the normal liver parenchyma by FB-DWI (11.0 ± 4.8) was not significantly different from that shown by RT-DWI (11.0 ± 5.0); nor were the lesion-to-nonlesion CNRs significantly different (FB-DWI, 21.4 ± 17.7; RT-DWI, 20.1 ± 15.1). For all three observers, the detectability of FB-DWI (Obs-1, 43.6%; Obs-2, 53.6%; and Obs-3, 45.0%) was significantly higher than that of RT-DWI (Obs-1, 29.1%; Obs-2, 43.6%; and Obs-3, 34.5%) ( P < 0.05). FB-DWI showed better image quality and higher detectability of HCC compared to RT-DWI, without significantly reducing the SNRs of the liver parenchyma and lesion-to-nonlesion CNRs.

Image quality and diagnostic performance of free-breathing diffusion-weighted imaging for hepatocellular carcinoma

PubMed Central

Takayama, Yukihisa; Nishie, Akihiro; Asayama, Yoshiki; Ishigami, Kousei; Kakihara, Daisuke; Ushijima, Yasuhiro; Fujita, Nobuhiro; Shirabe, Ken; Takemura, Atsushi; Honda, Hiroshi

2017-01-01

AIM To retrospectively evaluate the diagnostic performance of free-breathing diffusion-weighted imaging (FB-DWI) with modified imaging parameter settings for detecting hepatocellular carcinomas (HCCs). METHODS Fifty-one patients at risk for HCC were scanned with both FB-DWI and respiratory-triggered DWI with the navigator echo respiratory-triggering technique (RT-DWI). Qualitatively, the sharpness of the liver contour, the image noise and the chemical shift artifacts on each DWI with b-values of 1000 s/mm2 were independently evaluated by three radiologists using 4-point scoring. We compared the image quality scores of each observer between the two DWI methods, using the Wilcoxon signed-rank test. Quantitatively, we compared the signal-to-noise ratios (SNRs) of the liver parenchyma and lesion-to-nonlesion contrast-to-noise ratios (CNRs) after measuring the signal intensity on each DWI with a b-factor of 1000 s/mm2. The average SNRs and CNRs between the two DWI methods were compared by the paired t-test. The detectability of HCC on each DWI was also analyzed by three radiologists. The detectability provided by the two DWI methods was compared using McNemar’s test. RESULTS For all observers, the averaged image quality scores of FB-DWI were: Sharpness of the liver contour [observer (Obs)-1, 3.08 ± 0.81; Obs-2, 2.98 ± 0.73; Obs-3, 3.54 ± 0.75], those of the distortion (Obs-1, 2.94 ± 0.50; Obs-2, 2.71 ± 0.70; Obs-3, 3.27 ± 0.53), and the chemical shift artifacts (Obs-1, 3.38 ± 0.60; Obs-2, 3.15 ± 1.07; Obs-3, 3.21 ± 0.85). The averaged image quality scores of RT-DWI were: Sharpness of the liver contour (Obs-1, 2.33 ± 0.65; Obs-2, 2.37 ± 0.74; Obs-3, 2.75 ± 0.81), distortion (Obs-1, 2.81 ± 0.56; Obs-2, 2.25 ± 0.74; Obs-3, 2.96 ± 0.71), and the chemical shift artifacts (Obs-1, 2.92 ± 0.59; Obs-2, 2.21 ± 0.85; Obs-3, 2.77 ± 1.08). All image quality scores of FB-DWI were significantly higher than those of RT-DWI (P < 0.05). The average SNR of the normal liver parenchyma by FB-DWI (11.0 ± 4.8) was not significantly different from that shown by RT-DWI (11.0 ± 5.0); nor were the lesion-to-nonlesion CNRs significantly different (FB-DWI, 21.4 ± 17.7; RT-DWI, 20.1 ± 15.1). For all three observers, the detectability of FB-DWI (Obs-1, 43.6%; Obs-2, 53.6%; and Obs-3, 45.0%) was significantly higher than that of RT-DWI (Obs-1, 29.1%; Obs-2, 43.6%; and Obs-3, 34.5%) (P < 0.05). CONCLUSION FB-DWI showed better image quality and higher detectability of HCC compared to RT-DWI, without significantly reducing the SNRs of the liver parenchyma and lesion-to-nonlesion CNRs. PMID:28588750

The soluble leptin receptor.

PubMed

Schaab, Michael; Kratzsch, Juergen

2015-10-01

The adipokine leptin realizes signal transduction via four different leptin receptor (OB-R) isoforms. The amount of functionally active OB-R, however, is affected by constitutive shedding of the extracellular domain. The product of the cleavage process, the so-called soluble leptin receptor (sOB-R), is the main binding protein for leptin in human blood and modulates its bioavailability. Concentrations of sOB-R are differentially regulated in metabolic disorders, such as type 1 diabetes mellitus or obesity, and can, therefore, enhance or reduce leptin sensitivity. Lipotoxicity and apoptosis increase OB-R cleavage via ADAM10-dependent mechanisms. In contrast, although increased sOB-R concentrations seem to directly inhibit leptin effects, reduced amounts of sOB-R may reflect decreased membrane expression of OB-R. These findings, in part, explain alterations of leptin sensitivity that are associated with changes in serum sOB-R concentrations seen in metabolic disorders. Copyright © 2015 Elsevier Ltd. All rights reserved.

Leptin receptor mRNA in rat brain astrocytes

PubMed Central

Hsuchou, Hung; Pan, Weihong; Barnes, Maria J.; Kastin, Abba J.

2009-01-01

We recently reported that mouse astrocytes express leptin receptors (ObR), and that obesity induces upregulation of astrocytic ObR. To provide further evidence of the importance of astrocytic ObR expression, we performed double-labeling fluorescent in-situ hybridization (FISH) and immunohistochemistry in the rat hypothalamus. Laser confocal microscopic image analysis showed that ObR mRNA was present in glial fibrillary acidic protein (+) cells that show distinctive astrocytic morphology as well as in neurons. In addition to the presence of ObR mRNA, ObR protein was shown in both astrocytes and neurons in the rat hypothalamus by double-labeling immunohistochemistry. In cultured rat C6 astrocytoma cells treated with different doses of lipopolysaccharide for 6 h, the mRNA for ObRa or ObRb did not show significant changes, as measured by quantitative RT-PCR. However, the protein expression of both ObRa and ObRb, determined by western blotting, was increased after the C6 cells were treated with either lipopolysaccharide or tumor necrosis factor-α. The results indicate that astrocytic ObR expression is present in rats as well as mice, and that it probably plays a role in the neuroinflammatory response. PMID:19747514

A Comprehensive View Of Taiwan Orogeny From TAIGER Perspective

NASA Astrophysics Data System (ADS)

Wu, F. T.; Kuochen, H.; McIntosh, K. D.; Okaya, D. A.; Lavier, L. L.

2012-12-01

Arc-continent collision is one of the basic mechanisms for building continental masses. Taiwan is young and very active. Based on known geology a multi-disciplinary geophysical experiment was designed to image the orogeny in action. Logistics for R/V Langseth, OBS and PASSCAL instruments was complex; nevertheless the field works were completed within the project period. The resulting dataset allows us to map the structures of the shallow crust and the upper mantle. The amount of data gathered is large; some key observations and current interpretations are: (I) Observation: Crustal roots on both Eurasian and Philippine Sea plates, with a high velocity rise in between. Interpretation: Deformation throughout lithosphere on both sides of the initial suture; shortening of lithosphere near plate boundary produce high velocity rise. (II) Observation: Upper mantle high velocity anomaly coincides with a steep east-dippping Wadati-Benioff seismicity in southern Taiwan; the anomaly continues part of the way to central Taiwan but it is aseismic; under northern Taiwan the anomaly is very weak and disorganized. Interpretation: Active subduction in the south (up to 22.8°N) and may be eclogitization in the lower crust and delamination in central Taiwan. (III) Observation: Low Vp/Vs, low resistivity in the core of Central Range. Interp: dry, felsic rocks at relatively high temper (up to 750OC). (IV) Obs: Strong SKS splitting (~2 sec) with trend-parallel fast axis. Interp: Shearing throughout uppermost mantle. Preliminary 2-D geodynamic modeling produces the primary observed features from simple initial model of an arc impinging on continental margin.

Chronic ethanol consumption lessens the gain of body weight, liver triglycerides, and diabetes in obese ob/ob mice.

PubMed

Fromenty, Bernard; Vadrot, Nathalie; Massart, Julie; Turlin, Bruno; Barri-Ova, Nadège; Lettéron, Philippe; Fautrel, Alain; Robin, Marie-Anne

2009-10-01

Clinical studies suggest that moderate alcohol consumption can have beneficial effects, in particular regarding cardiovascular events, insulin resistance, and type 2 diabetes. In this study, lean and obese diabetic ob/ob mice were submitted or not to chronic ethanol intake via the drinking water for 6 months, which was associated with moderate levels of plasma ethanol. Plasma levels of alanine aminotransferase and aspartate aminotransferase were not increased by alcohol intake. Ethanol consumption progressively reduced the gain of body weight in ob/ob mice, but not in lean mice, and this was observed despite higher calorie intake. Increased plasma free fatty acids and glycerol in ethanol-treated ob/ob mice suggested peripheral lipolysis. Glycemia and insulinemia were significantly reduced, whereas adiponectinemia was increased in ethanol-treated ob/ob mice. Liver weight and triglycerides were significantly decreased in ethanol-treated ob/ob mice, and this was associated with less microvesicular steatosis. Hepatic levels of AMP-activated protein kinase and the phosphorylated form of acetyl-CoA carboxylase were higher in ethanol-treated ob/ob mice, suggesting better fatty acid oxidation. However, hepatic mRNA expression of several lipogenic genes was not reduced by ethanol consumption. Finally, mild oxidative stress was noticed in the liver of ethanol-treated mice, regardless of their genotype. Hence, our data are in keeping with clinical studies suggesting that moderate ethanol intake can have beneficial effects on type 2 diabetes and insulin sensitivity, at least in part through increased levels of plasma adiponectin. However, further studies are needed to determine whether long-term drinking of light-to-moderate amounts of ethanol is safe for the liver.

Comparison of onboard low-field magnetic resonance imaging versus onboard computed tomography for anatomy visualization in radiotherapy.

PubMed

Noel, Camille E; Parikh, Parag J; Spencer, Christopher R; Green, Olga L; Hu, Yanle; Mutic, Sasa; Olsen, Jeffrey R

2015-01-01

Onboard magnetic resonance imaging (OB-MRI) for daily localization and adaptive radiotherapy has been under development by several groups. However, no clinical studies have evaluated whether OB-MRI improves visualization of the target and organs at risk (OARs) compared to standard onboard computed tomography (OB-CT). This study compared visualization of patient anatomy on images acquired on the MRI-(60)Co ViewRay system to those acquired with OB-CT. Fourteen patients enrolled on a protocol approved by the Institutional Review Board (IRB) and undergoing image-guided radiotherapy for cancer in the thorax (n = 2), pelvis (n = 6), abdomen (n = 3) or head and neck (n = 3) were imaged with OB-MRI and OB-CT. For each of the 14 patients, the OB-MRI and OB-CT datasets were displayed side-by-side and independently reviewed by three radiation oncologists. Each physician was asked to evaluate which dataset offered better visualization of the target and OARs. A quantitative contouring study was performed on two abdominal patients to assess if OB-MRI could offer improved inter-observer segmentation agreement for adaptive planning. In total 221 OARs and 10 targets were compared for visualization on OB-MRI and OB-CT by each of the three physicians. The majority of physicians (two or more) evaluated visualization on MRI as better for 71% of structures, worse for 10% of structures, and equivalent for 14% of structures. 5% of structures were not visible on either. Physicians agreed unanimously for 74% and in majority for > 99% of structures. Targets were better visualized on MRI in 4/10 cases, and never on OB-CT. Low-field MR provides better anatomic visualization of many radiotherapy targets and most OARs as compared to OB-CT. Further studies with OB-MRI should be pursued.

Hydrogen sulfide improves diabetic wound healing in ob/ob mice via attenuating inflammation.

PubMed

Zhao, Huichen; Lu, Shengxia; Chai, Jiachao; Zhang, Yuchao; Ma, Xiaoli; Chen, Jicui; Guan, Qingbo; Wan, Meiyan; Liu, Yuantao

2017-09-01

The proposed mechanisms of impaired wound healing in diabetes involve sustained inflammation, excess oxidative stress and compromised agiogenesis. Hydrogen sulfide (H 2 S) has been reported to have multiple biological activities. We aim to investigate the role of H 2 S in impaired wound healing in ob/ob mice and explore the possible mechanisms involved. Full-thickness skin dorsal wounds were created on ob/ob mice and C57BL/6 mice. Cystathionine-γ-lyase (CSE) expression and H 2 S production were determined in granulation tissues of the wounds. Effects of NaHS on wound healing were evaluated. Inflammation and angiogenesis in granulation tissues of the wounds were examined. CSE expression, and H 2 S content were significantly reduced in granulation tissues of wounds in ob/ob mice compared with control mice. NaHS treatment significantly improved wound healing in ob/ob mice, which was associated with reduced neutrophil and macrophage infiltration, decreased production of tumor necrosis factor (TNF)-α, interleukin (IL)-6. NaHS treatment decreased metalloproteinase (MMP)-9, whereas increased collagen deposition and vascular-like structures in granulation tissues of wounds in ob/ob mice. CSE down-regulation may play a role in the pathogenesis of diabetic impaired wound healing. Exogenous H 2 S could be a potential agent to improve diabetic impaired wound healing by attenuating inflammation and increasing angiogenesis. Copyright © 2017 Elsevier Inc. All rights reserved.

Hepatic steatosis inhibits autophagic proteolysis via impairment of autophagosomal acidification and cathepsin expression

DOE Office of Scientific and Technical Information (OSTI.GOV)

Inami, Yoshihiro; Yamashina, Shunhei, E-mail: syamashi@juntendo.ac.jp; Izumi, Kousuke

2011-09-09

Highlights: {yields} Acidification of autophagosome was blunted in steatotic hepatocytes. {yields} Hepatic steatosis did not disturb fusion of isolated autophagosome and lysosome. {yields} Proteinase activity of cathepsin B and L in autolysosomes was inhibited by steatosis. {yields} Hepatic expression of cathepsin B and L was suppressed by steatosis. -- Abstract: Autophagy, one of protein degradation system, contributes to maintain cellular homeostasis and cell defense. Recently, some evidences indicated that autophagy and lipid metabolism are interrelated. Here, we demonstrate that hepatic steatosis impairs autophagic proteolysis. Though accumulation of autophagosome is observed in hepatocytes from ob/ob mice, expression of p62 was augmentedmore » in liver from ob/ob mice more than control mice. Moreover, degradation of the long-lived protein leucine was significantly suppressed in hepatocytes isolated from ob/ob mice. More than 80% of autophagosomes were stained by LysoTracker Red (LTR) in hepatocytes from control mice; however, rate of LTR-stained autophagosomes in hepatocytes were suppressed in ob/ob mice. On the other hand, clearance of autolysosomes loaded with LTR was blunted in hepatocytes from ob/ob mice. Although fusion of isolated autophagosome and lysosome was not disturbed, proteinase activity of cathepsin B and L in autolysosomes and cathepsin B and L expression of liver were suppressed in ob/ob mice. These results indicate that lipid accumulation blunts autophagic proteolysis via impairment of autophagosomal acidification and cathepsin expression.« less

Proteomic analysis of oil bodies in mature Jatropha curcas seeds with different lipid content.

PubMed

Liu, Hui; Wang, Cuiping; Chen, Fan; Shen, Shihua

2015-01-15

To reveal the difference among three mature Jatropha curcas seeds (JcVH, variant with high lipid content; JcW, wild type and JcVL, variant with low lipid content) with different lipid content, comparative proteomics was employed to profile the changes of oil body (OB) associated protein species by using gels-based proteomic technique. Eighty-three protein species were successfully identified through LTQ-ES-MS/MS from mature JcW seeds purified OBs. Two-dimensional electrophoresis analysis of J. curcas OB associated protein species revealed they had essential interactions with other organelles and demonstrated that oleosin and caleosin were the most abundant OB structural protein species. Twenty-eight OB associated protein species showed significant difference among JcVH, JcW and JcVL according to statistical analysis. Complementary transient expression analysis revealed that calcium ion binding protein (CalBP) and glycine-rich RNA binding protein (GRP) were well targeted in OBs apart from the oleosins. This study demonstrated that ratio of lipid content to caleosins abundance was involved in the regulation of OB size, and the mutant induced by ethylmethylsulfone treatment might be related to the caleosin like protein species. These findings are important for biotechnological improvement with the aim to alter the lipid content in J. curcas seeds. The economic value of Jatropha curcas largely depends on the lipid content in seeds which are mainly stored in the special organelle called oil bodies (OBs). In consideration of the biological importance and applications of J. curcas OB in seeds, it is necessary to further explore the components and functions of J. curcas OBs. Although a previous study concerning the J. curcas OB proteome revealed oleosins were the major OB protein component and additional protein species were similar to those in other oil seed plants, these identified OB associated protein species were corresponding to the protein bands instead of protein spots in the electrophoresis gels. Furthermore, the interaction of OB associated protein species and their contribution to OB formation and stabilization are still blank. In this study, with the overall object of profiling OB protein species from mature J. curcas seeds with different lipid content, we provided a setting of comparative OB proteomics with biochemical data and transient expression to explore the core of OB associated protein species involved in the regulation of OB size and lipid accumulation. The results were important for biotechnological improvement with the aim to a global modification of lipid storage in J. curcas seeds. Meanwhile, this study gave insight into possible associations between OBs and other organelles in mature J. curcas seeds. It may represent new aspects of the biological functions of the OBs during the oil mobilization. Combined the technique of transient transformation, a newly reported protein species, glycine-rich RNA binding protein (GRP) was successfully targeted in OBs. Therefore, further molecular analysis of these protein species is warranted to verify this association and what role they have in OBs. Copyright © 2014 Elsevier B.V. All rights reserved.

Odor-Induced Neuronal Rhythms in the Olfactory Bulb Are Profoundly Modified in ob/ob Obese Mice

PubMed Central

Chelminski, Yan; Magnan, Christophe; Luquet, Serge H.; Everard, Amandine; Meunier, Nicolas; Gurden, Hirac; Martin, Claire

2017-01-01

Leptin, the product of the Ob(Lep) gene, is a peptide hormone that plays a major role in maintaining the balance between food intake and energy expenditure. In the brain, leptin receptors are expressed by hypothalamic cells but also in the olfactory bulb, the first central structure coding for odors, suggesting a precise function of this hormone in odor-evoked activities. Although olfaction plays a key role in feeding behavior, the ability of the olfactory bulb to integrate the energy-related signal leptin is still missing. Therefore, we studied the fate of odor-induced activity in the olfactory bulb in the genetic context of leptin deficiency using the obese ob/ob mice. By means of an odor discrimination task with concomitant local field potential recordings, we showed that ob/ob mice perform better than wild-type (WT) mice in the early stage of the task. This behavioral gain of function was associated in parallel with profound changes in neuronal oscillations in the olfactory bulb. The distribution of the peaks in the gamma frequency range was shifted toward higher frequencies in ob/ob mice compared to WT mice before learning. More notably, beta oscillatory activity, which has been shown previously to be correlated with olfactory discrimination learning, was longer and stronger in expert ob/ob mice after learning. Since oscillations in the olfactory bulb emerge from mitral to granule cell interactions, our results suggest that cellular dynamics in the olfactory bulb are deeply modified in ob/ob mice in the context of olfactory learning. PMID:28154537

Reduction of obesity, as induced by leptin, reverses endothelial dysfunction in obese (Lep(ob)) mice

NASA Technical Reports Server (NTRS)

Winters, B.; Mo, Z.; Brooks-Asplund, E.; Kim, S.; Shoukas, A.; Li, D.; Nyhan, D.; Berkowitz, D. E.

2000-01-01

Obesity is a major health care problem and is associated with significant cardiovascular morbidity. Leptin, a neuroendocrine hormone released by adipose tissue, is important in modulating obesity by signaling satiety and increasing metabolism. Moreover, leptin receptors are expressed on vascular endothelial cells (ECs) and mediate angiogenesis. We hypothesized that leptin may also play an important role in vasoregulation. We investigated vasoregulatory mechanisms in the leptin-deficient obese (ob/ob) mouse model and determined the influence of leptin replacement on endothelial-dependent vasorelaxant responses. The direct effect of leptin on EC nitric oxide (NO) production was also tested by using 4, 5-diaminofluorescein-2 diacetate staining and measurement of nitrate and nitrite concentrations. Vasoconstrictor responses to phenylephrine, norepinephrine, and U-46619 were markedly enhanced in aortic rings from ob/ob mice and were modulated by NO synthase inhibition. Vasorelaxant responses to ACh were markedly attenuated in mesenteric microvessels from ob/ob mice. Leptin replacement resulted in significant weight loss and reversal of the impaired endothelial-dependent vasorelaxant responses observed in ob/ob mice. Preincubation of ECs with leptin enhanced the release of NO production. Thus leptin-deficient ob/ob mice demonstrate marked abnormalities in vasoregulation, including impaired endothelial-dependent vasodilation, which is reversed by leptin replacement. These findings may be partially explained by the direct effect of leptin on endothelial NO production. These vascular abnormalities are similar to those observed in obese, diabetic, leptin-resistant humans. The ob/ob mouse may, therefore, be an excellent new model for the study of the cardiovascular effects of obesity.

Respiratory and Olfactory Cytotoxicity of Inhaled 2,3-Pentanedione in Sprague-Dawley Rats

PubMed Central

Hubbs, Ann F.; Cumpston, Amy M.; Goldsmith, W. Travis; Battelli, Lori A.; Kashon, Michael L.; Jackson, Mark C.; Frazer, David G.; Fedan, Jeffrey S.; Goravanahally, Madhusudan P.; Castranova, Vincent; Kreiss, Kathleen; Willard, Patsy A.; Friend, Sherri; Schwegler-Berry, Diane; Fluharty, Kara L.; Sriram, Krishnan

2013-01-01

Flavorings-related lung disease is a potentially disabling disease of food industry workers associated with exposure to the α-diketone butter flavoring, diacetyl (2,3-butanedione). To investigate the hypothesis that another α-diketone flavoring, 2,3-pentanedione, would cause airway damage, rats that inhaled air, 2,3-pentanedione (112, 241, 318, or 354 ppm), or diacetyl (240 ppm) for 6 hours were sacrificed the following day. Rats inhaling 2,3-pentanedione developed necrotizing rhinitis, tracheitis, and bronchitis comparable to diacetyl-induced injury. To investigate delayed toxicity, additional rats inhaled 318 (range, 317.9—318.9) ppm 2,3-pentanedione for 6 hours and were sacrificed 0 to 2, 12 to 14, or 18 to 20 hours after exposure. Respiratory epithelial injury in the upper nose involved both apoptosis and necrosis, which progressed through 12 to 14 hours after exposure. Olfactory neuroepithelial injury included loss of olfactory neurons that showed reduced expression of the 2,3-pentanedione–metabolizing enzyme, dicarbonyl/L-xylulose reductase, relative to sustentacular cells. Caspase 3 activation occasionally involved olfactory nerve bundles that synapse in the olfactory bulb (OB). An additional group of rats inhaling 270 ppm 2,3-pentanedione for 6 hours 41 minutes showed increased expression of IL-6 and nitric oxide synthase-2 and decreased expression of vascular endothelial growth factor A in the OB, striatum, hippocampus, and cerebellum using real-time PCR. Claudin-1 expression increased in the OB and striatum. We conclude that 2,3-pentanedione is a respiratory hazard that can also alter gene expression in the brain. PMID:22894831

Structure of the Cascadia Subduction Zone Imaged Using Surface Wave Tomography

NASA Astrophysics Data System (ADS)

Schaeffer, A. J.; Audet, P.

2017-12-01

Studies of the complete structure of the Cascadia subduction zone from the ridge to the arc have historically been limited by the lack of offshore ocean bottom seismograph (OBS) infrastructure. On land, numerous dense seismic deployments have illuminated detailed structures and dynamics associated with the interaction between the subducting oceanic plate and the overriding continental plate, including cycling of fluids, serpentinization of the overlying forearc mantle wedge, and the location of the upper surface of the Juan de Fuca plate as it subducts beneath the Pacific Northwest. In the last half-decade, the Cascadia Initiative (CI), along with Neptune (ONC) and several other OBS initiatives, have instrumented both the continental shelf and abyssal plains off shore of the Cascadia subduction zone, facilitating the construction of a complete picture of the subduction zone from ridge to trench and volcanic arc. In this study, we present a preliminary azimuthally anisotropic surface-wave phase-velocity based model of the complete system, capturing both the young, unaltered Juan de Fuca plate from the ridge, to its alteration as it enters the subduction zone, in addition to the overlying continent. This model is constructed from a combination of ambient noise cross-correlations and teleseismic two station interferometry, and combines together concurrently running offshore OBS and onshore stations. We furthermore perform a number of representative 1D depth inversions for shear velocity to categorize the pristine oceanic, subducted oceanic, and continental crust and lithospheric structure. In the future the dispersion dataset will be jointly inverted with receiver functions to constrain a 3D shear-velocity model of the complete region.

Soil moisture estimation by assimilating L-band microwave brightness temperature with geostatistics and observation localization.

PubMed

Han, Xujun; Li, Xin; Rigon, Riccardo; Jin, Rui; Endrizzi, Stefano

2015-01-01

The observation could be used to reduce the model uncertainties with data assimilation. If the observation cannot cover the whole model area due to spatial availability or instrument ability, how to do data assimilation at locations not covered by observation? Two commonly used strategies were firstly described: One is covariance localization (CL); the other is observation localization (OL). Compared with CL, OL is easy to parallelize and more efficient for large-scale analysis. This paper evaluated OL in soil moisture profile characterizations, in which the geostatistical semivariogram was used to fit the spatial correlated characteristics of synthetic L-Band microwave brightness temperature measurement. The fitted semivariogram model and the local ensemble transform Kalman filter algorithm are combined together to weight and assimilate the observations within a local region surrounding the grid cell of land surface model to be analyzed. Six scenarios were compared: 1_Obs with one nearest observation assimilated, 5_Obs with no more than five nearest local observations assimilated, and 9_Obs with no more than nine nearest local observations assimilated. The scenarios with no more than 16, 25, and 36 local observations were also compared. From the results we can conclude that more local observations involved in assimilation will improve estimations with an upper bound of 9 observations in this case. This study demonstrates the potentials of geostatistical correlation representation in OL to improve data assimilation of catchment scale soil moisture using synthetic L-band microwave brightness temperature, which cannot cover the study area fully in space due to vegetation effects.

The Role of Oncoplastic Breast Surgery in Breast Cancer Treatment

PubMed Central

Emiroğlu, Mustafa; Sert, İsmail; İnal, Abdullah

2015-01-01

The aim of this study is to discuss indications, advantages, disadvantages, oncologic and aesthetic results of Oncoplastic Surgery (OBS). Pubmed and Medline database were searched for articles published between 1998 and 2014 for keywords: oncoplastic breast surgery, therapeutic mammoplasty, oncoplastic breast reduction, synchrenous reconstructions. Role of OBS in breast cancer surgery, its aspects to be considered, its value and results have been interpreted. This technique has advantages by providing more extensive tumourectomy, yielding better aesthetic results compared with breast conserving surgery, allowing oncoplastic reduction in breast cancer patients with macromastia, with higher patient satisfaction and quality of life and by being inexpensive due to single session practice. As for its disadvantages are: re-excision is more difficult, risk for mastectomy is higher, it is depent on the Surgeron’s experience, it has a risk for delay in adjuvant therapies and its requirement for additional imaging studies during management. Main indications are patients with small tumour/breast volume, macromastia, multifocality, procedures which can disrupt breast cosmesis such as surgeries for upper inner breas tquadrient tumours. Contraindications are positive margin problems after wide excision, diffuse malign microcalsifications, inflammatory breast cancer, history of radiotherapy and patients’ preferences. Despite low evidence level, Oncoplastic Breast Surgery seems to be both reliable and acceptable in terms of oncologic and aesthetic aspects. Oncoplastic Breast Surgery increase the application rate of breast conserving surgery by obviating practical limitations and improve the results of breast conserving surgery. Correct patient and technique choice in OBS is vital for optimization of post surgical PMID:28331682

Soil Moisture Estimation by Assimilating L-Band Microwave Brightness Temperature with Geostatistics and Observation Localization

PubMed Central

Han, Xujun; Li, Xin; Rigon, Riccardo; Jin, Rui; Endrizzi, Stefano

2015-01-01

The observation could be used to reduce the model uncertainties with data assimilation. If the observation cannot cover the whole model area due to spatial availability or instrument ability, how to do data assimilation at locations not covered by observation? Two commonly used strategies were firstly described: One is covariance localization (CL); the other is observation localization (OL). Compared with CL, OL is easy to parallelize and more efficient for large-scale analysis. This paper evaluated OL in soil moisture profile characterizations, in which the geostatistical semivariogram was used to fit the spatial correlated characteristics of synthetic L-Band microwave brightness temperature measurement. The fitted semivariogram model and the local ensemble transform Kalman filter algorithm are combined together to weight and assimilate the observations within a local region surrounding the grid cell of land surface model to be analyzed. Six scenarios were compared: 1_Obs with one nearest observation assimilated, 5_Obs with no more than five nearest local observations assimilated, and 9_Obs with no more than nine nearest local observations assimilated. The scenarios with no more than 16, 25, and 36 local observations were also compared. From the results we can conclude that more local observations involved in assimilation will improve estimations with an upper bound of 9 observations in this case. This study demonstrates the potentials of geostatistical correlation representation in OL to improve data assimilation of catchment scale soil moisture using synthetic L-band microwave brightness temperature, which cannot cover the study area fully in space due to vegetation effects. PMID:25635771

iNOS inhibits hair regeneration in obese diabetic (ob/ob) mice.

PubMed

Sasaki, Mari; Shinozaki, Shohei; Morinaga, Hironobu; Kaneki, Masao; Nishimura, Emi; Shimokado, Kentaro

2018-07-02

Previous studies have shown that androgenic alopecia is associated with metabolic syndrome and diabetes. However, the detailed mechanism whereby diabetes causes alopecia still remains unclear. We focused on the inflammatory response that is caused by diabetes or obesity, given that inflammation is a risk factor for hair loss. Inducible nitric oxide synthase (iNOS) is known to be upregulated under conditions of acute or chronic inflammation. To clarify the potential role of iNOS in diabetes-related alopecia, we generated obese diabetic iNOS-deficient (ob/ob; iNOS-KO mice). We observed that ob/ob; iNOS-KO mice were potentiated for the transition from telogen (rest phase) to anagen (growth phase) in the hair cycle compared with iNOS-proficient ob/ob mice. To determine the effect of nitric oxide (NO) on the hair cycle, we administered an iNOS inhibitor intraperitoneally (compound 1400 W, 10 mg/kg) or topically (10% aminoguanidine) in ob/ob mice. We observed that iNOS inhibitors promoted anagen transition in ob/ob mice. Next, we administered an NO donor (S-nitrosoglutathione, GSNO), to test whether NO has the telogen elongation effects. The NO donor was sufficient to induce telogen elongation in wild-type mice. Together, our data indicate that iNOS-derived NO plays a role in telogen elongation under the inflammatory conditions associated with diabetes in mice. Copyright © 2018 The Authors. Published by Elsevier Inc. All rights reserved.

Deficient copper concentrations in dried-defatted hepatic tissue from ob/ob mice: A potential model for study of defective copper regulation in metabolic liver disease.

PubMed

Church, Stephanie J; Begley, Paul; Kureishy, Nina; McHarg, Selina; Bishop, Paul N; Bechtold, David A; Unwin, Richard D; Cooper, Garth J S

2015-05-08

Ob/ob mice provide an animal model for non-alcoholic fatty liver disease/non-alcoholic steatohepatitis (NAFLD/NASH) in patients with obesity and type-2 diabetes. Low liver copper has been linked to hepatic lipid build-up (steatosis) in animals with systemic copper deficiency caused by low-copper diets. However, hepatic copper status in patients with NAFLD or NASH is uncertain, and a validated animal model useful for the study of hepatic copper regulation in common forms of metabolic liver disease is lacking. Here, we report parallel measurements of essential metal levels in whole-liver tissue and defatted-dried liver tissue from ob/ob and non-obese control mice. Measurements in whole-liver tissue from ob/ob mice at an age when they have developed NAFLD/NASH, provide compelling evidence for factitious lowering of copper and all other essential metals by steatosis, and so cannot be used to study hepatic metal regulation in this model. By marked contrast, metal measurements in defatted-dried liver samples reveal that most essential metals were actually normal and indicate specific lowering of copper in ob/ob mice, consistent with hepatic copper deficiency. Thus ob/ob mice can provide a model useful for the study of copper regulation in NAFLD and NASH, provided levels are measured in defatted-dried liver tissue. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Tau hyperphosphorylation in the brain of ob/ob mice is due to hypothermia: Importance of thermoregulation in linking diabetes and Alzheimer's disease.

PubMed

Gratuze, Maud; El Khoury, Noura B; Turgeon, Andréanne; Julien, Carl; Marcouiller, François; Morin, Françoise; Whittington, Robert A; Marette, André; Calon, Frédéric; Planel, Emmanuel

2017-02-01

Over the last few decades, there has been a significant increase in epidemiological studies suggesting that type 2 diabetes (T2DM) is linked to a higher risk of Alzheimer's disease (AD). However, how T2DM affects AD pathology, such as tau hyperphosphorylation, is not well understood. In this study, we investigated the impact of T2DM on tau phosphorylation in ob/ob mice, a spontaneous genetic model of T2DM. Tau phosphorylation at the AT8 epitope was slightly elevated in 4-week-old ob/ob mice while 26-week-old ob/ob mice exhibited tau hyperphosphorylation at multiple tau phospho-epitopes (Tau1, CP13, AT8, AT180, PHF1). We then examined the mechanism of tau hyperphosphorylation and demonstrated that it is mostly due to hypothermia, as ob/ob mice were hypothermic and normothermia restored tau phosphorylation to control levels. As caffeine has been shown to be beneficial for diabetes, obesity and tau phosphorylation, we, therefore, used it as therapeutic treatment. Unexpectedly, chronic caffeine intake exacerbated tau hyperphosphorylation by promoting deeper hypothermia. Our data indicate that tau hyperphosphorylation is predominately due to hypothermia consequent to impaired thermoregulation in ob/ob mice. This study establishes a novel link between diabetes and AD, and reinforces the importance of recording body temperature to better assess the relationship between diabetes and AD. Copyright © 2016 Elsevier Inc. All rights reserved.

Cytochrome P450 (CYP) epoxygenases as potential targets in the management of impaired diabetic wound healing.

PubMed

Zhao, Huichen; Chen, Jicui; Chai, Jiachao; Zhang, Yuchao; Yu, Cong; Pan, Zhe; Gao, Peng; Zong, Chen; Guan, Qingbo; Fu, Yuqin; Liu, Yuantao

2017-07-01

Epoxyeicosatrienoic acids (EETs) are the epoxidation products of arachidonic acid catalyzed by cytochrome P450 (CYP) epoxygenases, which possess multiple biological activities. In the present study, we aimed to explore the role and effects of CYP epoxygenases/EETs in wound healing in ob/ob mice. Full-thickness skin dorsal wounds were made on ob/ob mice and C57BL/6 control mice. The mRNA and protein expression of CYP epoxygenases were determined in granulation tissues of wounds. Effects of EETs on wound healing were evaluated. Inflammation and angiogenesis in wounds were also observed. Compared with C57BL/6 mice, the mRNA and protein expression of CYP2C65 and CYP2J6 in the granulation tissues in ob/ob mice were significantly reduced. 11,12-EET treatment significantly improved wound healing in ob/ob mice, whereas 14,15-EEZE, an EET antagonist, showed the opposite effect. 11,12-EET treatment decreased neutrophil and macrophage infiltration to the wound sites, resulting in reduced production of inflammatory cytokines, decreased MMP-9 expression, and increased collagen accumulation in the granulation tissues of ob/ob mice. In addition, 11,12-EET increased angiogenesis in the granulation tissues of wounds in ob/ob mice. These findings indicate that reduced expression of CYP epoxygenases may contribute to impaired diabetic wound healing, and exogenous EETs may improve diabetic wound healing by modulating inflammation and angiogenesis.

The potential effects of Ocimum basilicum on health: a review of pharmacological and toxicological studies.

PubMed

Sestili, Piero; Ismail, Tariq; Calcabrini, Cinzia; Guescini, Michele; Catanzaro, Elena; Turrini, Eleonora; Layla, Anam; Akhtar, Saeed; Fimognari, Carmela

2018-07-01

Basil (Ocimum basilicum L., OB) is a plant world widely used as a spice and a typical ingredient of the healthy Mediterranean diet. In traditional medicine, OB is indicated for many maladies and conditions; OB-containing nutritional supplements are increasingly sold. Conversely, safety concerns have been raised about the promutagens and procarcinogens alkenylbenzenes contained in OB. Areas covered: A critical review of the current status of OB as a nutraceutical, the pharmacology of its bioactive components, the rationale for its indications, and its safety. Expert opinion: Due to the polyphenolic and flavonoidic content, OB can be considered as an important ingredient in healthy diets; OB preparations may be effective as chemopreventive agents or adjunctive therapy in the treatment of different clinical conditions. From a toxicological perspective, since the tumorigenic potential of alkenylbenzenes is counteracted by other OB constituents such as nevadensin, it can be concluded that OB consumption in food and preparations is safe. The only concern relates to OB essential oils: in this case, a concentration limit for alkenylbenzenes should be precautionary defined, and the use of plant chemotypes with no or low levels of these alkylbenzenes for the preparation of essential oils should be made compulsory.

Leptin Increases Striatal Dopamine D2 Receptor Binding in Leptin-Deficient Obese (ob/ob) Mice

DOE Office of Scientific and Technical Information (OSTI.GOV)

Pfaffly, J.; Michaelides, M.; Wang, G-J.

2010-06-01

Peripheral and central leptin administration have been shown to mediate central dopamine (DA) signaling. Leptin-receptor deficient rodents show decreased DA D2 receptor (D2R) binding in striatum and unique DA profiles compared to controls. Leptin-deficient mice show increased DA activity in reward-related brain regions. The objective of this study was to examine whether basal D2R-binding differences contribute to the phenotypic behaviors of leptin-deficient ob/ob mice, and whether D2R binding is altered in response to peripheral leptin treatment in these mice. Leptin decreased body weight, food intake, and plasma insulin concentration in ob/ob mice but not in wild-type mice. Basal striatal D2Rmore » binding (measured with autoradiography [{sup 3}H] spiperone) did not differ between ob/ob and wild-type mice but the response to leptin did. In wild-type mice, leptin decreased striatal D2R binding, whereas, in ob/ob mice, leptin increased D2R binding. Our findings provide further evidence that leptin modulates D2R expression in striatum and that these effects are genotype/phenotype dependent.« less

The Cygnus OB2 Star Forming Complex

NASA Astrophysics Data System (ADS)

Rybarczyk, Daniel R.; Bania, Thomas

2018-01-01

Almost all astrophysical systems—from planets to stars to supernovae to entire galaxies—are impacted by the process of star formation. The brightest, most massive stars (OB stars) form in hot young clusters called OB associations. Cygnus OB2 is an OB association containing over 160 OB stars, making it one of the largest in the Milky Way Galaxy. At a distance of less than 1.5 kpc, its proximity to the Sun makes it optimal for assessing the process of Galactic star formation and its implications for stellar evolution, Galactic structure, and Galactic chemical evolution. Using existing data sets, we derive comprehensive maps of the distribution of thermal continuum, atomic, and molecular emission from the interstellar gas in Cyg OB2. The thermal continuum emission stems from the plasma ionized by OB stars. The atomic gas is probed by emission from atomic hydrogen, HI, at 21 cm wavelength. The molecular gas is traced by emission from the CO molecule which is a proxy for molecular hydrogen, H2. We combine these atomic and molecular data to derive a map of the total proton column density distribution in Cyg OB2. We also analyze the velocity fields of the OB stars, the atomic and molecular hydrogen gas, and the HII regions' radio recombination emission. As expected, we find HII regions to be spatially coincident with zones of higher cloud density. Surrounding the greatest concentration of OB stars is a cavity in the radio continuum and CO emission. This results from shock waves produced by the combined action of the high HII region pressure and winds from the OB stars. Such a distribution implies that Cyg OB2 is old enough to have evolved to this state.

Ob/ob Mouse Livers Show Decreased Oxidative Phosphorylation Efficiencies and Anaerobic Capacities after Cold Ischemia

PubMed Central

Tagaloa, Sherry; Zhang, Linda; Dare, Anna J.; MacDonald, Julia R.; Yeong, Mee-Ling; Bartlett, Adam S. J. R.; Phillips, Anthony R. J.

2014-01-01

Background Hepatic steatosis is a major risk factor for graft failure in liver transplantation. Hepatic steatosis shows a greater negative influence on graft function following prolonged cold ischaemia. As the impact of steatosis on hepatocyte metabolism during extended cold ischaemia is not well-described, we compared markers of metabolic capacity and mitochondrial function in steatotic and lean livers following clinically relevant durations of cold preservation. Methods Livers from 10-week old leptin-deficient obese (ob/ob, n = 9) and lean C57 mice (n = 9) were preserved in ice-cold University of Wisconsin solution. Liver mitochondrial function was then assessed using high resolution respirometry after 1.5, 3, 5, 8, 12, 16 and 24 hours of storage. Metabolic marker enzymes for anaerobiosis and mitochondrial mass were also measured in conjunction with non-bicarbonate tissue pH buffering capacity. Results Ob/ob and lean mice livers showed severe (>60%) macrovesicular and mild (<30%) microvesicular steatosis on Oil Red O staining, respectively. Ob/ob livers had lower baseline enzymatic complex I activity but similar adenosine triphosphate (ATP) levels compared to lean livers. During cold storage, the respiratory control ratio and complex I-fueled phosphorylation deteriorated approximately twice as fast in ob/ob livers compared to lean livers. Ob/ob livers also demonstrated decreased ATP production capacities at all time-points analyzed compared to lean livers. Ob/ob liver baseline lactate dehydrogenase activities and intrinsic non-bicarbonate buffering capacities were depressed by 60% and 40%, respectively compared to lean livers. Conclusions Steatotic livers have impaired baseline aerobic and anaerobic capacities compared to lean livers, and mitochondrial function indices decrease particularly from after 5 hours of cold preservation. These data provide a mechanistic basis for the clinical recommendation of shorter cold storage durations in steatotic donor livers. PMID:24956382

iPLA2β deficiency attenuates obesity and hepatic steatosis in ob/ob mice through hepatic fatty-acyl phospholipid remodeling.

PubMed

Deng, Xiuling; Wang, Jiliang; Jiao, Li; Utaipan, Tanyarath; Tuma-Kellner, Sabine; Schmitz, Gerd; Liebisch, Gerhard; Stremmel, Wolfgang; Chamulitrat, Walee

2016-05-01

PLA2G6 or GVIA calcium-independent PLA2 (iPLA2β) is identified as one of the NAFLD modifier genes in humans, and thought to be a target for NAFLD therapy. iPLA2β is known to play a house-keeping role in phospholipid metabolism and remodeling. However, its role in NAFLD pathogenesis has not been supported by results obtained from high-fat feeding of iPLA2β-null (PKO) mice. Unlike livers of human NAFLD and genetically obese rodents, fatty liver induced by high-fat diet is not associated with depletion of hepatic phospholipids. We therefore tested whether iPLA2β could regulate obesity and hepatic steatosis in leptin-deficient mice by cross-breeding PKO with ob/ob mice to generate ob/ob-PKO mice. Here we observed an improvement in ob/ob-PKO mice with significant reduction in serum enzymes, lipids, glucose, insulin as well as improved glucose tolerance, and reduction in islet hyperplasia. The improvement in hepatic steatosis measured by liver triglycerides, fatty acids and cholesterol esters was associated with decreased expression of PPARγ and de novo lipogenesis genes, and the reversal of β-oxidation gene expression. Notably, ob/ob livers contained depleted levels of lysophospholipids and phospholipids, and iPLA2β deficiency in ob/ob-PKO livers lowers the former, but replenished the latter particularly phosphatidylethanolamine (PE) and phosphatidylcholine (PC) that contained arachidonic (AA) and docosahexaenoic (DHA) acids. Compared with WT livers, PKO livers also contained increased PE and PC containing AA and DHA. Thus, iPLA2β deficiency protected against obesity and ob/ob fatty liver which was associated with hepatic fatty-acyl phospholipid remodeling. Our results support the deleterious role of iPLA2β in severe obesity associated NAFLD. Copyright © 2016 Elsevier B.V. All rights reserved.

Clinical effect of four different ointment bases on healthy cat eyes.

PubMed

Eördögh, Réka; Schwendenwein, Ilse; Tichy, Alexander; Loncaric, Igor; Nell, Barbara

2016-07-01

To describe the effects of long-term treatment with four different eye ointment bases (OBs) in cats. Ten healthy cats. The study was performed in two periods. Four different OBs were tested. Hundred grams of OB contained the following: OB-A: 35.17 g liquid paraffin (lp), 64.83 g white petrolatum (wp); OB-B: 10.03 g lp, 84.95 g wp 5.02 g lanolin; OB-C: 18.34 g lp, 51.40 g wp, 25.00 mg KH2 PO4 , 57.00 mg K2 HPO4 , 18.90 g eucerinum anhydricum, 11.28 g water for injections; and OB-D: 70 g unguentum lanalcoli, 20 g lp, 10 g aqua conservans. One eye was treated, and the other served as a negative control. Cats received the OBs TID for 28 days. The two study periods were separated by a 4-month washout phase. Samples for conjunctival impression cytology, swabs for bacteriologic and mycologic examination, and cytobrush samples for FHV-1 and Chlamydophila felis PCR detection were obtained. Both eyes were examined daily. Severity of ocular symptoms was scored using a modified Draize eye irritation test. A total of five eyes were treated with OB-A, five with OB-B, four with OB-C, and five with OB-D. Treated eyes had significantly higher clinical scores. Eyes receiving OB-A had the highest overall clinical score. The results of bacteriologic and mycologic examination concur with the previously published data. All samples tested were negative for FHV-1 and Chlamydophila felis. There was no significant difference between treated and control eyes upon cytological examination. The application of OBs resulted in clinical symptoms in treated eyes. The long-term use of ointments is not well tolerated in cats and may lead to ocular irritation. © 2015 American College of Veterinary Ophthalmologists.

[Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].

PubMed

Kharlamova, A S; Barabanov, V M; Saveliev, S V

2015-01-01

We provide the data of the olfactory bulbs (OB) development in the human fetuses on the stages from 8 week to birth. Immunochistochemical markers of presynaptic terminals (anti-SNAP-25, -synapsin-I, -synaptophysin) were used to evaluate the maturation of the OB. Differentiation of the OB layers begins from periphery, which implicitly evidences that growth of the olfactory nerves fibers induses not only anatomical differentiation of the OB, but also differentiation of its functional layers. The sites of the developing glomerulus are revealed using the immunochistochemical prosedure on the stage before distinct glomerulus can be identified with common histological procedure. OB conductive system demonstrates immunoreactivity with the antibodies to the presynaptic proteins on the all stages from 10-11 weeks of fetus development. Four stages of the OB development are described. All functional layers of the OB are mature at the 22-weeks stage. Further differentiation of the OB neuroblasts, including lamina formation of the internal granular leyer, glomerular layer development, OB growth continue after 20-22 weeks stage until 38-40 weeks of the fetus develoment. Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development. Complete maturity of the human OB is achived at 38-40 weeks of the prenatal development.

Kinematics of OB-associations in Gaia epoch

NASA Astrophysics Data System (ADS)

Mel'nik, A. M.; Dambis, A. K.

2017-12-01

We use stellar proper motions from the Tycho-Gaia Astrometric Solution (TGAS) catalogue to study the kinematics of OB-associations. The TGAS proper motions of OB-associations generally agree well with the Hipparcos proper motions. The parameters of the Galactic rotation curve obtained with TGAS and Hipparcos proper motions agree within the errors. The average one-dimensional velocity dispersion inside 18 OB-associations with more than 10 TGAS stars is σv = 3.9 km s-1, which is considerably smaller, by a factor of 0.4, than the velocity dispersions derived from Hipparcos data. The effective contribution from orbital motions of binary OB-stars into the velocity dispersion σv inside OB-associations is σb = 1.2 km s-1. The median virial and stellar masses of OB-associations are equal to 7.1 × 105 and 9.0 × 103 M⊙, respectively. Thus, OB-associations must be unbound objects, provided they do not include a lot of dense gas. The median star-formation efficiency is ε = 2.1 per cent. Nearly one-third of stars of OB-associations must lie outside their tidal radius. We found that the Per OB1 and Car OB1 associations are expanding with the expansion started in a small region of 11-27 pc 7-10 Myr ago. The average expansion velocity is 6.3 km s-1.

New massive members of Cygnus OB2

NASA Astrophysics Data System (ADS)

Berlanas, S. R.; Herrero, A.; Comerón, F.; Pasquali, A.; Motta, C. Bertelli; Sota, A.

2018-04-01

Context. The Cygnus complex is one of the most powerful star forming regions at a close distance from the Sun ( 1.4 kpc). Its richest OB association Cygnus OB2 is known to harbor many tens of O-type stars and hundreds of B-type stars, providing a large homogeneous population of OB stars that can be analyzed. Many studies of its massive population have been developed in the last decades, although the total number of OB stars is still incomplete. Aim. Our aim is to increase the sample of O and B members of Cygnus OB2 and its surroundings by spectroscopically classifying 61 candidates as possible OB-type members of Cygnus OB2, using new intermediate resolution spectroscopy. Methods: We have obtained intermediate resolution (R 5000) spectra for all of the OB-type candidates between 2013 and 2017. We thus performed a spectral classification of the sample using HeI-II and metal lines rates, as well as the Marxist Ghost Buster (MGB) software for O-type stars and the IACOB standards catalog for B-type stars. Results: From the whole sample of 61 candidates, we have classified 42 stars as new massive OB-type stars, earlier than B3, in Cygnus OB2 and surroundings, including 11 O-type stars. The other candidates are discarded as they display later spectral types inconsistent with membership in the association. We have also obtained visual extinctions for all the new confirmed massive OB members, placing them in a Hertzsprung-Russell Diagram using calibrations for Teff and luminosity. Finally, we have studied the age and extinction distribution of our sample within the region. Conclusions: We have obtained new blue intermediate-resolution spectra suitable for spectral classification of 61 OB candidates in Cygnus OB2 and surroundings. The confirmation of 42 new OB massive stars (earlier than B3) in the region allows us to increase the young massive population known in the field. We have also confirmed the correlation between age and Galactic longitude previously found in the region. We conclude that many O and early B stars at B > 16 mag are still undiscovered in Cygnus.

The role of gap junctions in megakaryocyte-mediated osteoblast proliferation and differentiation.

PubMed

Ciovacco, Wendy A; Goldberg, Carolyn G; Taylor, Amanda F; Lemieux, Justin M; Horowitz, Mark C; Donahue, Henry J; Kacena, Melissa A

2009-01-01

Gap junctions (GJs) are membrane-spanning channels that facilitate intercellular communication by allowing small signaling molecules (e.g. calcium ions, inositol phosphates, and cyclic nucleotides) to pass from cell to cell. Over the past two decades, many studies have described a role for GJ intercellular communication (GJIC) in the proliferation and differentiation of many cells, including bone cells. Recently, we reported that megakaryocytes (MKs) enhance osteoblast (OB) proliferation by a juxtacrine signaling mechanism. Here we determine whether this response is facilitated by GJIC. First we demonstrate that MKs express connexin 43 (Cx43), the predominant GJ protein expressed by bone cells, including OBs. Next, we provide data showing that MKs can communicate with OBs via GJIC, and that the addition of two distinct GJ uncouplers, 18alpha-glycyrrhetinic acid (alphaGA) or oleamide, inhibits this communication. We then demonstrate that inhibiting MK-mediated GJIC further enhances the ability of MKs to stimulate OB proliferation. Finally, we show that while culturing MKs with OBs reduces gene expression of several differentiation markers/matrix proteins (type I collagen, osteocalcin, and alkaline phosphatase), reduces alkaline phosphatase enzymatic activity, and decreases mineralization in OBs, blocking GJIC does not result in MK-induced reductions in OB gene expression, enzymatic levels, or mineralized nodule formation. Overall, these data provide evidence that GJIC between MKs and OBs is functional, and that inhibiting GJIC in MK-OB cultures enhances OB proliferation without apparently altering differentiation when compared to similarly treated OB cultures. Thus, these observations regarding MK-OB GJIC inhibition may provide insight regarding potential novel targets for anabolic bone formation.

The Role of Gap Junctions in Megakaryocyte-Mediated Osteoblast Proliferation and Differentiation

PubMed Central

Ciovacco, Wendy A.; Goldberg, Carolyn G.; Taylor, Amanda F.; Lemieux, Justin M.; Horowitz, Mark C.; Donahue, Henry J.; Kacena, Melissa A.

2009-01-01

Gap junctions (GJs) are membrane-spanning channels that facilitate intercellular communication by allowing small signaling molecules (e.g. calcium ions, inositol phosphates, and cyclic nucleotides) to pass from cell to cell. Over the past two decades, many studies have described a role for GJ intercellular communication (GJIC) in the proliferation and differentiation of many cells, including bone cells. Recently, we reported that megakaryocytes (MKs) enhance osteoblast (OB) proliferation by a juxtacrine signaling mechanism. Here we determine whether that response is facilitated by GJIC. First we demonstrate that MKs express connexin 43 (Cx43), the predominant GJ protein expressed by bone cells, including OBs. Next, we provide data showing that MKs can communicate with OBs via GJIC, and that the addition of two distinct GJ uncouplers, 18α-glycyrrhetinic acid (αGA) or oleamide, inhibits this communication. We then demonstrate that inhibiting MK-mediated GJIC further enhances the ability of MK to stimulate OB proliferation. Finally, we show that while culturing MKs with OBs reduces gene expression of several differentiation markers/matrix proteins (type I collagen, osteocalcin, and alkaline phosphatase), reduces alkaline phosphatase enzymatic activity, and decreases mineralization in OBs, blocking GJIC does not result in MK-induced reductions in OB gene expression, enzymatic levels, or mineralized nodule formation. Overall, these data provide evidence that GJIC between MKs and OBs is functional, and that inhibiting GJIC in MK-OB cultures enhances OB proliferation without apparently altering differentiation when compared to similarly treated OB cultures. Thus, these observations regarding MK-OB GJIC inhibition may provide insight regarding potential novel targets for anabolic bone formation. PMID:18848655

Racial and Ethnic Disparities in Cardiovascular Disease: An Assessment of Obstetrician-Gynecologists' Knowledge, Attitudes, and Practice Patterns.

PubMed

Jones, Katherine M; Carter, Michele M; Schulkin, Jay

2015-06-01

African American and Hispanic women are disproportionately affected by cardiovascular disease (CVD) and its many risk factors. Obstetrician-gynecologists (OB/GYNs) play an integral role in well-woman care and have a unique opportunity to provide CVD counseling and screening to these at-risk and underserved groups. To assess whether OB/GYN race/ethnicity and OB/GYN practices with increasing minority patient populations predicted differences in OB/GYNs' knowledge, attitudes, and practice patterns relevant to racial/ethnic disparities in CVD. This study also sought to determine provider and patient-related barriers to CVD care. A questionnaire on CVD was mailed to 273 members of The American College of Obstetricians and Gynecologists in March-July 2013. African American and Hispanic OB/GYNs and OB/GYN practices with increasing minority patient populations were more knowledgeable of CVD disparities. These OB/GYNs reported greater concern for minority women's CVD risk relative to White OB/GYNs. Overall, OB/GYNs appear less knowledgeable and concerned with Hispanics' increased CVD risk relative to African Americans'. The most commonly reported provider and patient-related barriers to CVD care were time constraints, patient nonadherence to treatment recommendations, and inadequate training. It is likely that minority OB/GYNs and those with practices with increasing minority patient populations have greater exposure to women at risk for CVD. Dissemination of educational information regarding Hispanic women's CVD risk profile may improve OB/GYN knowledge, counseling, and screening. Increased training in CVD and multicultural competency during medical school and residency should help OB/GYNs overcome what they report as primary barriers to CVD care.

Overexpression of leptin receptor in human glioblastoma: Correlation with vasculogenic mimicry and poor prognosis

PubMed Central

Yue, Zhijian; Zhang, Yuhui; Wang, Laixing; Liu, Jianmin

2017-01-01

Vasculogenic mimicry (VM) was an important tumor blood supply to complement the endothelial cell-dependent angiogenesis, while leptin and receptor (ObR) involved in angiogenesis in glioblastoma has been reported on previous study, but the relationship between ObR expression and VM formation in human glioblastoma tissues, as well as their prognostic significance still remains unclear. In our study, we found that VM recognized by CD31-/PAS+ immunohistochemical staining in glioblastoma tissues showed a positive correlation with leptin expression (r = 0.58, P < 0.01), as well as ObR expression in glioblastoma tissues (r = 0.61, P < 0.01). Association of glial to mesenchymal transition (GMT)-related molecular with ObR expression and VM formation in glioblastoma tissues indicated that ObR-positive glioblastoma cells with GMT phenotype might be more likely to constitute VM, and co-expression of ObR and CD133 or Nestin to constitute the channel impliated that ObR-positive glioblastoma cells displayed glioblastoma stem cells (GSC) properties. Moreover, Kaplan–Meier statistical analysis showed that patients with more VM or ObR expression displayed poorer prognosis for overall survival times than patients with less expression (VMhigh vs. VMlow: P = 0.033; ObRhigh vs. ObRlow: P = 0.009). And ObR+ glioblastoma cells with GSC characteristic were mostly involved in VM formation, whereas a little part of cells were also related to microvascular density (MVD), which suggested that ObR was an important target for anticancer therapy, so further related studies were needed to improve glioblastoma treatment. PMID:28938545

DYNAMICAL MEASUREMENTS OF THE YOUNG UPPER SCORPIUS TRIPLE NTTS 155808-2219

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mace, G. N.; McLean, I. S.; Prato, L.

2012-08-15

The young, low-mass, triple system NTTS 155808-2219 (ScoPMS 20) was previously identified as a {approx}17 day period single-lined spectroscopic binary (SB) with a tertiary component at 0.21 arcsec. Using high-resolution infrared spectra, acquired with NIRSPEC on Keck II, both with and without adaptive optics (AO), we measured radial velocities (RVs) of all three components. Reanalysis of the single-lined visible light observations, made from 1987 to 1993, also yielded RV detections of the three stars. Combining visible light and infrared data to compute the orbital solution produces orbital parameters consistent with the single-lined solution and a mass ratio of q =more » 0.78 {+-} 0.01 for the SB. We discuss the consistency between our results and previously published data on this system, our RV analysis with both observed and synthetic templates, and the possibility that this system is eclipsing, providing a potential method for the determination of the stars' absolute masses. Over the {approx}20 year baseline of our observations, we have measured the acceleration of the SB's center of mass in its orbit with the tertiary. Long-term, AO imaging of the tertiary will eventually yield dynamical data useful for component mass estimates.« less

Directional Limits on Persistent Gravitational Waves from Advanced LIGO's First Observing Run.

PubMed

Abbott, B P; Abbott, R; Abbott, T D; Abernathy, M R; Acernese, F; Ackley, K; Adams, C; Adams, T; Addesso, P; Adhikari, R X; Adya, V B; Affeldt, C; Agathos, M; Agatsuma, K; Aggarwal, N; Aguiar, O D; Aiello, L; Ain, A; Ajith, P; Allen, B; Allocca, A; Altin, P A; Ananyeva, A; Anderson, S B; Anderson, W G; Appert, S; Arai, K; Araya, M C; Areeda, J S; Arnaud, N; Arun, K G; Ascenzi, S; Ashton, G; Ast, M; Aston, S M; Astone, P; Aufmuth, P; Aulbert, C; Avila-Alvarez, A; Babak, S; Bacon, P; Bader, M K M; Baker, P T; Baldaccini, F; Ballardin, G; Ballmer, S W; Barayoga, J C; Barclay, S E; Barish, B C; Barker, D; Barone, F; Barr, B; Barsotti, L; Barsuglia, M; Barta, D; Bartlett, J; Bartos, I; Bassiri, R; Basti, A; Batch, J C; Baune, C; Bavigadda, V; Bazzan, M; Beer, C; Bejger, M; Belahcene, I; Belgin, M; Bell, A S; Berger, B K; Bergmann, G; Berry, C P L; Bersanetti, D; Bertolini, A; Betzwieser, J; Bhagwat, S; Bhandare, R; Bilenko, I A; Billingsley, G; Billman, C R; Birch, J; Birney, R; Birnholtz, O; Biscans, S; Biscoveanu, A S; Bisht, A; Bitossi, M; Biwer, C; Bizouard, M A; Blackburn, J K; Blackman, J; Blair, C D; Blair, D G; Blair, R M; Bloemen, S; Bock, O; Boer, M; Bogaert, G; Bohe, A; Bondu, F; Bonnand, R; Boom, B A; Bork, R; Boschi, V; Bose, S; Bouffanais, Y; Bozzi, A; Bradaschia, C; Brady, P R; Braginsky, V B; Branchesi, M; Brau, J E; Briant, T; Brillet, A; Brinkmann, M; Brisson, V; Brockill, P; Broida, J E; Brooks, A F; Brown, D A; Brown, D D; Brown, N M; Brunett, S; Buchanan, C C; Buikema, A; Bulik, T; Bulten, H J; Buonanno, A; Buskulic, D; Buy, C; Byer, R L; Cabero, M; Cadonati, L; Cagnoli, G; Cahillane, C; Calderón Bustillo, J; Callister, T A; Calloni, E; Camp, J B; Campbell, W; Canepa, M; Cannon, K C; Cao, H; Cao, J; Capano, C D; Capocasa, E; Carbognani, F; Caride, S; Casanueva Diaz, J; Casentini, C; Caudill, S; Cavaglià, M; Cavalier, F; Cavalieri, R; Cella, G; Cepeda, C B; Cerboni Baiardi, L; Cerretani, G; Cesarini, E; Chamberlin, S J; Chan, M; Chao, S; Charlton, P; Chassande-Mottin, E; Cheeseboro, B D; Chen, H Y; Chen, Y; Cheng, H-P; Chincarini, A; Chiummo, A; Chmiel, T; Cho, H S; Cho, M; Chow, J H; Christensen, N; Chu, Q; Chua, A J K; Chua, S; Chung, S; Ciani, G; Clara, F; Clark, J A; Cleva, F; Cocchieri, C; Coccia, E; Cohadon, P-F; Colla, A; Collette, C G; Cominsky, L; Constancio, M; Conti, L; Cooper, S J; Corbitt, T R; Cornish, N; Corsi, A; Cortese, S; Costa, C A; Coughlin, E; Coughlin, M W; Coughlin, S B; Coulon, J-P; Countryman, S T; Couvares, P; Covas, P B; Cowan, E E; Coward, D M; Cowart, M J; Coyne, D C; Coyne, R; Creighton, J D E; Creighton, T D; Cripe, J; Crowder, S G; Cullen, T J; Cumming, A; Cunningham, L; Cuoco, E; Dal Canton, T; Danilishin, S L; D'Antonio, S; Danzmann, K; Dasgupta, A; Da Silva Costa, C F; Dattilo, V; Dave, I; Davier, M; Davies, G S; Davis, D; Daw, E J; Day, B; Day, R; De, S; DeBra, D; Debreczeni, G; Degallaix, J; De Laurentis, M; Deléglise, S; Del Pozzo, W; Denker, T; Dent, T; Dergachev, V; De Rosa, R; DeRosa, R T; DeSalvo, R; Devenson, J; Devine, R C; Dhurandhar, S; Díaz, M C; Di Fiore, L; Di Giovanni, M; Di Girolamo, T; Di Lieto, A; Di Pace, S; Di Palma, I; Di Virgilio, A; Doctor, Z; Dolique, V; Donovan, F; Dooley, K L; Doravari, S; Dorrington, I; Douglas, R; Dovale Álvarez, M; Downes, T P; Drago, M; Drever, R W P; Driggers, J C; Du, Z; Ducrot, M; Dwyer, S E; Edo, T B; Edwards, M C; Effler, A; Eggenstein, H-B; Ehrens, P; Eichholz, J; Eikenberry, S S; Essick, R C; Etienne, Z; Etzel, T; Evans, M; Evans, T M; Everett, R; Factourovich, M; Fafone, V; Fair, H; Fairhurst, S; Fan, X; Farinon, S; Farr, B; Farr, W M; Fauchon-Jones, E J; Favata, M; Fays, M; Fehrmann, H; Fejer, M M; Fernández Galiana, A; Ferrante, I; Ferreira, E C; Ferrini, F; Fidecaro, F; Fiori, I; Fiorucci, D; Fisher, R P; Flaminio, R; Fletcher, M; Fong, H; Forsyth, S S; Fournier, J-D; Frasca, S; Frasconi, F; Frei, Z; Freise, A; Frey, R; Frey, V; Fries, E M; Fritschel, P; Frolov, V V; Fulda, P; Fyffe, M; Gabbard, H; Gadre, B U; Gaebel, S M; Gair, J R; Gammaitoni, L; Gaonkar, S G; Garufi, F; Gaur, G; Gayathri, V; Gehrels, N; Gemme, G; Genin, E; Gennai, A; George, J; Gergely, L; Germain, V; Ghonge, S; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S; Giaime, J A; Giardina, K D; Giazotto, A; Gill, K; Glaefke, A; Goetz, E; Goetz, R; Gondan, L; González, G; Gonzalez Castro, J M; Gopakumar, A; Gorodetsky, M L; Gossan, S E; Gosselin, M; Gouaty, R; Grado, A; Graef, C; Granata, M; Grant, A; Gras, S; Gray, C; Greco, G; Green, A C; Groot, P; Grote, H; Grunewald, S; Guidi, G M; Guo, X; Gupta, A; Gupta, M K; Gushwa, K E; Gustafson, E K; Gustafson, R; Hacker, J J; Hall, B R; Hall, E D; Hammond, G; Haney, M; Hanke, M M; Hanks, J; Hanna, C; Hannam, M D; Hanson, J; Hardwick, T; Harms, J; Harry, G M; Harry, I W; Hart, M J; Hartman, M T; Haster, C-J; Haughian, K; Healy, J; Heidmann, A; Heintze, M C; Heitmann, H; Hello, P; Hemming, G; Hendry, M; Heng, I S; Hennig, J; Henry, J; Heptonstall, A W; Heurs, M; Hild, S; Hoak, D; Hofman, D; Holt, K; Holz, D E; Hopkins, P; Hough, J; Houston, E A; Howell, E J; Hu, Y M; Huerta, E A; Huet, D; Hughey, B; Husa, S; Huttner, S H; Huynh-Dinh, T; Indik, N; Ingram, D R; Inta, R; Isa, H N; Isac, J-M; Isi, M; Isogai, T; Iyer, B R; Izumi, K; Jacqmin, T; Jani, K; Jaranowski, P; Jawahar, S; Jiménez-Forteza, F; Johnson, W W; Jones, D I; Jones, R; Jonker, R J G; Ju, L; Junker, J; Kalaghatgi, C V; Kalogera, V; Kandhasamy, S; Kang, G; Kanner, J B; Karki, S; Karvinen, K S; Kasprzack, M; Katsavounidis, E; Katzman, W; Kaufer, S; Kaur, T; Kawabe, K; Kéfélian, F; Keitel, D; Kelley, D B; Kennedy, R; Key, J S; Khalili, F Y; Khan, I; Khan, S; Khan, Z; Khazanov, E A; Kijbunchoo, N; Kim, Chunglee; Kim, J C; Kim, Whansun; Kim, W; Kim, Y-M; Kimbrell, S J; King, E J; King, P J; Kirchhoff, R; Kissel, J S; Klein, B; Kleybolte, L; Klimenko, S; Koch, P; Koehlenbeck, S M; Koley, S; Kondrashov, V; Kontos, A; Korobko, M; Korth, W Z; Kowalska, I; Kozak, D B; Krämer, C; Kringel, V; Królak, A; Kuehn, G; Kumar, P; Kumar, R; Kuo, L; Kutynia, A; Lackey, B D; Landry, M; Lang, R N; Lange, J; Lantz, B; Lanza, R K; Lartaux-Vollard, A; Lasky, P D; Laxen, M; Lazzarini, A; Lazzaro, C; Leaci, P; Leavey, S; Lebigot, E O; Lee, C H; Lee, H K; Lee, H M; Lee, K; Lehmann, J; Lenon, A; Leonardi, M; Leong, J R; Leroy, N; Letendre, N; Levin, Y; Li, T G F; Libson, A; Littenberg, T B; Liu, J; Lockerbie, N A; Lombardi, A L; London, L T; Lord, J E; Lorenzini, M; Loriette, V; Lormand, M; Losurdo, G; Lough, J D; Lousto, C O; Lovelace, G; Lück, H; Lundgren, A P; Lynch, R; Ma, Y; Macfoy, S; Machenschalk, B; MacInnis, M; Macleod, D M; Magaña-Sandoval, F; Majorana, E; Maksimovic, I; Malvezzi, V; Man, N; Mandic, V; Mangano, V; Mansell, G L; Manske, M; Mantovani, M; Marchesoni, F; Marion, F; Márka, S; Márka, Z; Markosyan, A S; Maros, E; Martelli, F; Martellini, L; Martin, I W; Martynov, D V; Mason, K; Masserot, A; Massinger, T J; Masso-Reid, M; Mastrogiovanni, S; Matas, A; Matichard, F; Matone, L; Mavalvala, N; Mazumder, N; McCarthy, R; McClelland, D E; McCormick, S; McGrath, C; McGuire, S C; McIntyre, G; McIver, J; McManus, D J; McRae, T; McWilliams, S T; Meacher, D; Meadors, G D; Meidam, J; Melatos, A; Mendell, G; Mendoza-Gandara, D; Mercer, R A; Merilh, E L; Merzougui, M; Meshkov, S; Messenger, C; Messick, C; Metzdorff, R; Meyers, P M; Mezzani, F; Miao, H; Michel, C; Middleton, H; Mikhailov, E E; Milano, L; Miller, A L; Miller, A; Miller, B B; Miller, J; Millhouse, M; Minenkov, Y; Ming, J; Mirshekari, S; Mishra, C; Mitra, S; Mitrofanov, V P; Mitselmakher, G; Mittleman, R; Moggi, A; Mohan, M; Mohapatra, S R P; Montani, M; Moore, B C; Moore, C J; Moraru, D; Moreno, G; Morriss, S R; Mours, B; Mow-Lowry, C M; Mueller, G; Muir, A W; Mukherjee, Arunava; Mukherjee, D; Mukherjee, S; Mukund, N; Mullavey, A; Munch, J; Muniz, E A M; Murray, P G; Mytidis, A; Napier, K; Nardecchia, I; Naticchioni, L; Nelemans, G; Nelson, T J N; Neri, M; Nery, M; Neunzert, A; Newport, J M; Newton, G; Nguyen, T T; Nielsen, A B; Nissanke, S; Nitz, A; Noack, A; Nocera, F; Nolting, D; Normandin, M E N; Nuttall, L K; Oberling, J; Ochsner, E; Oelker, E; Ogin, G H; Oh, J J; Oh, S H; Ohme, F; Oliver, M; Oppermann, P; Oram, Richard J; O'Reilly, B; O'Shaughnessy, R; Ottaway, D J; Overmier, H; Owen, B J; Pace, A E; Page, J; Pai, A; Pai, S A; Palamos, J R; Palashov, O; Palomba, C; Pal-Singh, A; Pan, H; Pankow, C; Pannarale, F; Pant, B C; Paoletti, F; Paoli, A; Papa, M A; Paris, H R; Parker, W; Pascucci, D; Pasqualetti, A; Passaquieti, R; Passuello, D; Patricelli, B; Pearlstone, B L; Pedraza, M; Pedurand, R; Pekowsky, L; Pele, A; Penn, S; Perez, C J; Perreca, A; Perri, L M; Pfeiffer, H P; Phelps, M; Piccinni, O J; Pichot, M; Piergiovanni, F; Pierro, V; Pillant, G; Pinard, L; Pinto, I M; Pitkin, M; Poe, M; Poggiani, R; Popolizio, P; Post, A; Powell, J; Prasad, J; Pratt, J W W; Predoi, V; Prestegard, T; Prijatelj, M; Principe, M; Privitera, S; Prodi, G A; Prokhorov, L G; Puncken, O; Punturo, M; Puppo, P; Pürrer, M; Qi, H; Qin, J; Qiu, S; Quetschke, V; Quintero, E A; Quitzow-James, R; Raab, F J; Rabeling, D S; Radkins, H; Raffai, P; Raja, S; Rajan, C; Rakhmanov, M; Rapagnani, P; Raymond, V; Razzano, M; Re, V; Read, J; Regimbau, T; Rei, L; Reid, S; Reitze, D H; Rew, H; Reyes, S D; Rhoades, E; Ricci, F; Riles, K; Rizzo, M; Robertson, N A; Robie, R; Robinet, F; Rocchi, A; Rolland, L; Rollins, J G; Roma, V J; Romano, J D; Romano, R; Romie, J H; Rosińska, D; Rowan, S; Rüdiger, A; Ruggi, P; Ryan, K; Sachdev, S; Sadecki, T; Sadeghian, L; Sakellariadou, M; Salconi, L; Saleem, M; Salemi, F; Samajdar, A; Sammut, L; Sampson, L M; Sanchez, E J; Sandberg, V; Sanders, J R; Sassolas, B; Sathyaprakash, B S; Saulson, P R; Sauter, O; Savage, R L; Sawadsky, A; Schale, P; Scheuer, J; Schlassa, S; Schmidt, E; Schmidt, J; Schmidt, P; Schnabel, R; Schofield, R M S; Schönbeck, A; Schreiber, E; Schuette, D; Schutz, B F; Schwalbe, S G; Scott, J; Scott, S M; Sellers, D; Sengupta, A S; Sentenac, D; Sequino, V; Sergeev, A; Setyawati, Y; Shaddock, D A; Shaffer, T J; Shahriar, M S; Shapiro, B; Shawhan, P; Sheperd, A; Shoemaker, D H; Shoemaker, D M; Siellez, K; Siemens, X; Sieniawska, M; Sigg, D; Silva, A D; Singer, A; Singer, L P; Singh, A; Singh, R; Singhal, A; Sintes, A M; Slagmolen, B J J; Smith, B; Smith, J R; Smith, R J E; Son, E J; Sorazu, B; Sorrentino, F; Souradeep, T; Spencer, A P; Srivastava, A K; Staley, A; Steinke, M; Steinlechner, J; Steinlechner, S; Steinmeyer, D; Stephens, B C; Stevenson, S P; Stone, R; Strain, K A; Straniero, N; Stratta, G; Strigin, S E; Sturani, R; Stuver, A L; Summerscales, T Z; Sun, L; Sunil, S; Sutton, P J; Swinkels, B L; Szczepańczyk, M J; Tacca, M; Talukder, D; Tanner, D B; Tao, D; Tápai, M; Taracchini, A; Taylor, R; Theeg, T; Thomas, E G; Thomas, M; Thomas, P; Thorne, K A; Thrane, E; Tippens, T; Tiwari, S; Tiwari, V; Tokmakov, K V; Toland, K; Tomlinson, C; Tonelli, M; Tornasi, Z; Torrie, C I; Töyrä, D; Travasso, F; Traylor, G; Trifirò, D; Trinastic, J; Tringali, M C; Trozzo, L; Tse, M; Tso, R; Turconi, M; Tuyenbayev, D; Ugolini, D; Unnikrishnan, C S; Urban, A L; Usman, S A; Vahlbruch, H; Vajente, G; Valdes, G; van Bakel, N; van Beuzekom, M; van den Brand, J F J; Van Den Broeck, C; Vander-Hyde, D C; van der Schaaf, L; van Heijningen, J V; van Veggel, A A; Vardaro, M; Varma, V; Vass, S; Vasúth, M; Vecchio, A; Vedovato, G; Veitch, J; Veitch, P J; Venkateswara, K; Venugopalan, G; Verkindt, D; Vetrano, F; Viceré, A; Viets, A D; Vinciguerra, S; Vine, D J; Vinet, J-Y; Vitale, S; Vo, T; Vocca, H; Vorvick, C; Voss, D V; Vousden, W D; Vyatchanin, S P; Wade, A R; Wade, L E; Wade, M; Walker, M; Wallace, L; Walsh, S; Wang, G; Wang, H; Wang, M; Wang, Y; Ward, R L; Warner, J; Was, M; Watchi, J; Weaver, B; Wei, L-W; Weinert, M; Weinstein, A J; Weiss, R; Wen, L; Weßels, P; Westphal, T; Wette, K; Whelan, J T; Whiting, B F; Whittle, C; Williams, D; Williams, R D; Williamson, A R; Willis, J L; Willke, B; Wimmer, M H; Winkler, W; Wipf, C C; Wittel, H; Woan, G; Woehler, J; Worden, J; Wright, J L; Wu, D S; Wu, G; Yam, W; Yamamoto, H; Yancey, C C; Yap, M J; Yu, Hang; Yu, Haocun; Yvert, M; Zadrożny, A; Zangrando, L; Zanolin, M; Zendri, J-P; Zevin, M; Zhang, L; Zhang, M; Zhang, T; Zhang, Y; Zhao, C; Zhou, M; Zhou, Z; Zhu, S J; Zhu, X J; Zucker, M E; Zweizig, J

2017-03-24

We employ gravitational-wave radiometry to map the stochastic gravitational wave background expected from a variety of contributing mechanisms and test the assumption of isotropy using data from the Advanced Laser Interferometer Gravitational Wave Observatory's (aLIGO) first observing run. We also search for persistent gravitational waves from point sources with only minimal assumptions over the 20-1726 Hz frequency band. Finding no evidence of gravitational waves from either point sources or a stochastic background, we set limits at 90% confidence. For broadband point sources, we report upper limits on the gravitational wave energy flux per unit frequency in the range F_{α,Θ}(f)<(0.1-56)×10^{-8}    erg cm^{-2} s^{-1} Hz^{-1}(f/25  Hz)^{α-1} depending on the sky location Θ and the spectral power index α. For extended sources, we report upper limits on the fractional gravitational wave energy density required to close the Universe of Ω(f,Θ)<(0.39-7.6)×10^{-8}  sr^{-1}(f/25  Hz)^{α} depending on Θ and α. Directed searches for narrowband gravitational waves from astrophysically interesting objects (Scorpius X-1, Supernova 1987 A, and the Galactic Center) yield median frequency-dependent limits on strain amplitude of h_{0}<(6.7,5.5,  and  7.0)×10^{-25}, respectively, at the most sensitive detector frequencies between 130-175 Hz. This represents a mean improvement of a factor of 2 across the band compared to previous searches of this kind for these sky locations, considering the different quantities of strain constrained in each case.

Occupant behavior models: A critical review of implementation and representation approaches in building performance simulation programs

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hong, Tianzhen; Chen, Yixing; Belafi, Zsofia

Occupant behavior (OB) in buildings is a leading factor influencing energy use in buildings. Quantifying this influence requires the integration of OB models with building performance simulation (BPS). This study reviews approaches to representing and implementing OB models in today’s popular BPS programs, and discusses weaknesses and strengths of these approaches and key issues in integrating of OB models with BPS programs. Two of the key findings are: (1) a common data model is needed to standardize the representation of OB models, enabling their flexibility and exchange among BPS programs and user applications; the data model can be implemented usingmore » a standard syntax (e.g., in the form of XML schema), and (2) a modular software implementation of OB models, such as functional mock-up units for co-simulation, adopting the common data model, has advantages in providing a robust and interoperable integration with multiple BPS programs. Such common OB model representation and implementation approaches help standardize the input structures of OB models, enable collaborative development of a shared library of OB models, and allow for rapid and widespread integration of OB models with BPS programs to improve the simulation of occupant behavior and quantification of their impact on building performance.« less

Occupant behavior models: A critical review of implementation and representation approaches in building performance simulation programs

DOE PAGES

Hong, Tianzhen; Chen, Yixing; Belafi, Zsofia; ...

2017-07-27

Occupant behavior (OB) in buildings is a leading factor influencing energy use in buildings. Quantifying this influence requires the integration of OB models with building performance simulation (BPS). This study reviews approaches to representing and implementing OB models in today’s popular BPS programs, and discusses weaknesses and strengths of these approaches and key issues in integrating of OB models with BPS programs. Two of the key findings are: (1) a common data model is needed to standardize the representation of OB models, enabling their flexibility and exchange among BPS programs and user applications; the data model can be implemented usingmore » a standard syntax (e.g., in the form of XML schema), and (2) a modular software implementation of OB models, such as functional mock-up units for co-simulation, adopting the common data model, has advantages in providing a robust and interoperable integration with multiple BPS programs. Such common OB model representation and implementation approaches help standardize the input structures of OB models, enable collaborative development of a shared library of OB models, and allow for rapid and widespread integration of OB models with BPS programs to improve the simulation of occupant behavior and quantification of their impact on building performance.« less

Neutralizing IL-17 Prevents Obliterative Bronchiolitis in Murine Orthotopic Lung Transplantation

PubMed Central

Fan, Lin; Benson, Heather L.; Vittal, Ragini; Mickler, Elizabeth A.; Presson, Robin; Jo Fisher, Amanda; Cummings, Oscar W.; Heidler, Kathleen M.; Keller, Melissa R.; Burlingham, William J.; Wilkes, David S.

2011-01-01

Obliterative bronchiolitis (OB) is the key impediment to the long term survival of lung transplant recipients and the lack of a robust pre-clinical model precludes examining OB immunopathogenesis. In the current study, lungs from C57BL/10 H-2b mice that are MHC compatible, but minor histocompatability antigen incompatible, were transplanted into C57BL/6 mice. Histological features and cytokine profiles of OB were assessed. Moderate rejection (grade A3) developed by day 14, with evidence of OB at that time point. At 21 days, OB was present in 55% of grafts and moderate to severe rejection (Grade A3-A4) was present in all mice. At 28 days, OB was present in 44% of mice and severe rejection (Grade A4) was present in all. IL-17A, but not IL-17F, splenic mRNA transcripts and serum protein levels were increased only in mice that developed OB, whereas IL-10 transcripts and protein were increased only in non-OB mice. Neutralizing IL-17 prevented OB, down regulated acute rejection, and upregulated systemic IL-10. Collectively, these data show that transplantation of minor histoincompatible lungs from C57BL/10 mice into C57BL/6 mice results in a highly reproducible pre-clinical model of OB. In addition, these data indicate that neutralizing IL-17A or augmenting IL-10 could be therapeutic interventions to prevent OB. PMID:21521466

The Overt Behaviour Scale-Self-Report (OBS-SR) for acquired brain injury: exploratory analysis of reliability and validity.

PubMed

Kelly, Glenn; Simpson, Grahame K; Brown, Suzanne; Kremer, Peter; Gillett, Lauren

2017-05-23

The objectives were to test the properties, via a psychometric study, of the Overt Behaviour Scale-Self-Report (OBS-SR), a version of the OBS-Adult Scale developed to provide a client perspective on challenging behaviours after acquired brain injury. Study sample 1 consisted of 37 patients with primary brain tumour (PBT) and a family-member informant. Sample 2 consisted of 34 clients with other acquired brain injury (mixed brain injury, MBI) and a service-provider informant. Participants completed the OBS-SR (at two time points), and the Awareness Questionnaire (AQ) and Mayo Portland Adaptability Inventory-III (MPAI-III) once; informants completed the OBS-Adult and AQ once only. PBT-informant dyads displayed "good" levels of agreement (ICC 2,k  = .74; OBS-SR global index). Although MBI-informant dyads displayed no agreement (ICC 2,k  = .22; OBS-SR global index), the sub-group (17/29) rated by clinicians as having moderate to good levels of awareness displayed "fair" agreement (ICC 2,k  = .58; OBS-SR global index). Convergent/divergent validity was demonstrated by significant correlations between OBS-SR subscales and MPAI-III subscales with behavioural content (coefficients in the range .36 -.61). Scores had good reliability across one week (ICC 2,k  = .69). The OBS-SR took approximately 15 minutes to complete. It was concluded that the OBS-SR demonstrated acceptable reliability and validity, providing a useful resource in understanding clients' perspectives about their behaviour.

HIERARCHICAL ORGANIZATION OF OSTEOBLASTS REVEALS THE SIGNIFICANT ROLE OF CD166 IN HEMATOPOIETIC STEM CELL MAINTANANCE AND FUNCTION

PubMed Central

Chitteti, Brahmananda R.; Cheng, Ying-Hua; Kacena, Melissa A.; Srour, Edward F.

2013-01-01

The role of osteoblasts (OB) in maintaining hematopoietic stem cells (HSC) in their niche is well elucidated, but the exact definition, both phenotypically and hierarchically of OB responsible for these functions is not clearly known. We previously demonstrated that OB maturational status influences HSC function whereby immature OB with high Runx2 expression promote hematopoietic expansion. Here, we show that Activated Leukocyte Cell Adhesion Molecule (ALCAM) or CD166 expression on OB is directly correlated with Runx2 expression and high hematopoiesis enhancing activity (HEA). Fractionation of OB with lineage markers: Sca1, osteopontin (OPN), CD166, CD44, and CD90 revealed that Lin-Sca1-OPN+CD166+ cells (CD166+) and their subpopulations fractionated with CD44 and CD90 expressed high levels of Runx2 and low levels of osteocalcin (OC) demonstrating the relatively immature status of these cells. Conversely, the majority of the Lin-Sca1-OPN+CD166− cells (CD166−) expressed high OC levels suggesting that CD166− OB are more mature. In vitro hematopoietic potential of LSK cells co-cultured for 7 days with fresh OB or OB pre-cultured for 1, 2, or 3 weeks declined precipitously with increasing culture duration concomitant with loss of CD166 expression. Importantly, LSK cells co-cultured with CD166+CD44+CD90+ OB maintained their in vivo repopulating potential through primary and secondary transplantation, suggesting that robust HEA activity is best mediated by immature CD166+ OB with high Runx2 and low OC expression. These studies begin to define the hierarchical organization of osteoblastic cells and provide a more refined definition of OB that can mediate HEA. PMID:23369988

Reduced inflammatory response and increased microcirculatory disturbances during hepatic ischemia-reperfusion injury in steatotic livers of ob/ob mice

PubMed Central

Hasegawa, Tadashi; Ito, Yoshiya; Wijeweera, Jayanthika; Liu, Jie; Malle, Ernst; Farhood, Anwar; McCuskey, Robert S.; Jaeschke, Hartmut

2016-01-01

Steatosis is a major risk factor for complications after liver surgery. Since neutrophil cytotoxicity is critical for ischemia-reperfusion injury in normal livers, the aim of the present study was to evaluate whether an exaggerated inflammatory response could cause the increased injury in steatotic livers. In C57Bl/6 mice, 60 min of warm hepatic ischemia triggered a gradual increase in hepatic neutrophil accumulation during reperfusion with peak levels of 100-fold over baseline at 12 h of reperfusion. Neutrophil extravasation and a specific neutrophil-induced oxidant stress (immunostaining for hypochlorous acid-modified epitopes) started at 6 h of reperfusion and peaked at 12–24 h. Ob/ob mice, which had a severe macrovesicular steatosis, suffered significantly higher injury (alanine transaminase activity: 18,000 ± 2,100 U/l; 65% necrosis) compared with lean littermates (alanine transaminase activity: 4,900 ± 720 U/l; 24% necrosis) at 6 h of reperfusion. However, 62% fewer neutrophils accumulated in steatotic livers. This correlated with an attenuated increase in mRNA levels of several proinflammatory genes in ob/ob mice during reperfusion. In contrast, sham-operated ob/ob mice had a 50% reduction in liver blood flow and 35% fewer functional sinusoids compared with lean littermates. These deficiencies in liver blood flow and the microcirculation were further aggravated only in ob/ob mice during reperfusion. The attenuated inflammatory response and reduced neutrophil-induced oxidant stress observed in steatotic livers during reperfusion cannot be responsible for the dramatically increased injury in ob/ob mice. In contrast, the aggravated injury appears to be mediated by ischemic necrosis due to massive impairment of blood and oxygen supply in the steatotic livers. PMID:17307725

Plasma lipoproteins and the synthesis and turnover of plasma triglyceride in normal and genetically obese mice

PubMed Central

Salmon, D. Michael W.; Hems, Douglas A.

1973-01-01

1. Lipoproteins in the plasma of mice were characterized by agarose-gel chromatography and polyacrylamide-gel electrophoresis: genetically obese (ob/ob) mice exhibited hyperlipoproteinaemia (compared with lean mice), largely owing to an increase in the concentration of cholesterol in high-density lipoprotein. Plasma concentrations of triglyceride and phospholipid were not markedly increased in genetically obese mice. 2. The formation of glycerolipids in liver and plasma was investigated with 14C-labelled precursors. The synthesis of hepatic triglyceride and phospholipid from glucose or palmitate was enhanced in ob/ob mice, compared with lean mice. The rate of entry of triglyceride into plasma, calculated from the time-course of incorporation of 14C from [14C]palmitate into plasma triglyceride, was increased in ob/ob mice (0.5μmol of fatty acid/min, compared with 0.2 in lean mice). 3. The removal from plasma of murine lipoprotein triglyceride-[14C]fatty acid was increased in ob/ob mice (half-time 2.2min, compared with 7.2min in lean mice). Similar results were obtained with an injected lipid emulsion (Intralipid). 4. From these measurements, estimates of the rates of turnover of plasma triglyceride in mice (fed on a mixed diet, female, 3 months old) are about 1.0μmol of fatty acid/min in ob/ob mice, and 0.25 in lean mice. 5. The major precursor of hepatic and plasma triglyceride in lean and ob/ob mice was calculated to be plasma free fatty acid. 6. These results are discussed, in connexion with the role of the liver in triglyceride metabolism in mice, especially in relation to genetic obesity. PMID:4360712

Norepinephrine regulates hepatic innate immune system in leptin-deficient mice with nonalcoholic steatohepatitis.

PubMed

Li, Zhiping; Oben, Jude A; Yang, Shiqi; Lin, Huizhi; Stafford, Elizabeth A; Soloski, Mark J; Thomas, Steven A; Diehl, Anna Mae

2004-08-01

It is not known why natural killer T (NKT) cells, which modulate liver injury by regulating local cytokine production, are reduced in leptin-deficient ob/ob mice. NKT cells express adrenoceptors. Thus, we hypothesize that the low norepinephrine (NE) activity of ob/ob mice promotes depletion of liver NKT cells, thereby sensitizing ob/ob livers to lipopolysaccharide (LPS) toxicity. To evaluate this hypothesis, hepatic NKT cells were quantified in wild-type mice before and after treatment with NE inhibitors, and in dopamine beta-hydroxylase knockout mice (which cannot synthesize NE) and ob/ob mice before and after 4 weeks of NE supplementation. Decreasing NE activity consistently reduces liver NKT cells, while increasing NE has the opposite effect. Analysis of hepatic and thymic NKT cells in mice of different ages demonstrate an age-related accumulation of hepatic NKT cells in normal mice, while liver NKT cells become depleted after birth in ob/ob mice, which have increased apoptosis of hepatic NKT cells. NE treatment inhibits apoptosis and restores hepatic NKT cells. In ob/ob mice with reduced hepatic NKT cells, hepatic T and NKT cells produce excessive T helper (Th)-1 proinflammatory cytokines and the liver is sensitized to LPS toxicity. NE treatment decreases Th-1 cytokines, increases production of Th-2 cytokines, and reduces hepatotoxicity. Studies of CD1d-deficient mice, which lack the receptor required for NKT cell development, demonstrate that they are also unusually sensitive to LPS hepatotoxicity. In conclusion, low NE activity increases hepatic NKT cell apoptosis and depletes liver NKT cells, promoting proinflammatory polarization of hepatic cytokine production that sensitizes the liver to LPS toxicity. Copyright 2004 American Association for the Study of Liver Diseases

Sucrose diet induced enzymatic and hormonal responses affecting carbohydrate, lipid and energy metabolism in two species differing in insulin availability: spiny and ob/ob mice.

PubMed

Shafrir, E; Trostler, N

1984-01-01

The low-insulin responding spiny mice (Acomys cahirinus), maintained on a 50% sucrose diet vs isocaloric regular diet, responded with an impressive increase in the activity of hepatic enzymes of glycolysis and lipogenesis and in hyperlipidemia. There was no hyperinsulinemia or hyperglycemia and spiny mice did not gain weight on sucrose due to loss of adipose tissue. Serum T3 levels rose 1.8 fold and the activity of the hepatic mitochondrial FAD-glycerol-3-phosphate oxidase became induced 2.6 fold representing the enhancement of multiple, T3-dependent, energy-consuming metabolic cycles. An increased TG lipolysis in adipose tissue was also observed. C57BL/6J ob/ob mice were markedly hyperinsulinemic and gained weight on sucrose almost as much as those on regular diet, without changes in serum glucose or insulin. Serum triglyceride level decreased, whereas liver triglycerides accumulated markedly. The extent of the increase in hepatic enzyme activities related to lipogenesis was much lower both in the ob/ob mice and their lean siblings, than in spiny mice, but the basal enzyme activities in ob/ob mice were remarkably elevated. Serum T3 level was also elevated already on the regular diet and rose only slightly on sucrose. Basal glycerol phosphate oxidase activity in ob/ob mice exceeded that in spiny mice and rose only marginally on sucrose. Adipose tissue lipolysis was not increased. Thus, sucrose diet by enhancing the T3 production appeared to activate protective mechanism against weight gain in normoinsulinemic spiny mice, whereas the full expression of these mechanisms appeared to be precluded by the hyperinsulinemia of ob/ob mice.(ABSTRACT TRUNCATED AT 250 WORDS)

In vivo evidence for unidentified leptin-induced circulating factors that control white fat mass.

PubMed

Harris, Ruth B S

2015-12-15

Fat transplants increase body fat mass without changing the energy status of an animal and provide a tool for investigating control of total body fat. Early transplant studies found that small pieces of transplanted fat took on the morphology of the transplant recipient. Experiments described here tested whether this response was dependent upon expression of leptin receptors in either transplanted fat or the recipient mouse. Fat from leptin receptor deficient db/db mice or wild-type mice was placed subcutaneously in db/db mice. After 12 wk, cell size distribution in the transplant was the same as in endogenous fat of the recipient. Thus, wild-type fat cells, which express leptin receptors, were enlarged in a hyperleptinemic environment, indicating that leptin does not directly control adipocyte size. By contrast, db/db or wild-type fat transplanted into wild-type mice decreased in size, suggesting that a functional leptin system in the recipient is required for body fat mass to be controlled. In the final experiment, wild-type fat was transplanted into a db/db mouse parabiosed to either another db/db mouse to an ob/ob mouse or in control pairs in which both parabionts were ob/ob mice. Transplants increased in size in db/db-db/db pairs, decreased in db/db-ob/ob pairs and did not change in ob/ob-ob/ob pairs. We propose that leptin from db/db parabionts activated leptin receptors in their ob/ob partners. This, in turn, stimulated release of unidentified circulating factors, which travelled back to the db/db partner and acted on the transplant to reduce fat cell size. Copyright © 2015 the American Physiological Society.

Leptin and leucine synergistically regulate protein metabolism in C2C12 myotubes and mouse skeletal muscles.

PubMed

Mao, Xiangbing; Zeng, Xiangfang; Huang, Zhimin; Wang, Junjun; Qiao, Shiyan

2013-07-28

Leucine and leptin play important roles in regulating protein synthesis and degradation in skeletal muscles in vitro and in vivo. However, the objective of the present study was to determine whether leptin and leucine function synergistically in regulating protein metabolism of skeletal muscles. In the in vitro experiment, C2C12 myotubes were cultured for 2 h in the presence of 5 mm-leucine and/or 50 ng/ml of leptin. In the in vivo experiment, C57BL/6 and ob/ob mice were randomly assigned to be fed a non-purified diet supplemented with 3 % L-leucine or 2·04 % L-alanine (isonitrogenous control) for 14 d. Ob/ob mice were injected intraperitoneally with sterile PBS or recombinant mouse leptin (0·1 μg/g body weight) for 14 d. In C57BL/6 mice, dietary leucine supplementation increased (P< 0·05) plasma leptin, leptin receptor expression and protein synthesis in skeletal muscles, but reduced (P< 0·05) plasma urea and protein degradation in skeletal muscles. Dietary leucine supplementation and leptin injection increased the relative weight of the gastrocnemius and soleus muscles in ob/ob mice. Moreover, leucine and leptin treatments stimulated (P< 0·05) protein synthesis and inhibited (P< 0·05) protein degradation in C2C12 myotubes and skeletal muscles of ob/ob mice. There were interactions (P< 0·05) between the leucine and leptin treatments with regard to protein metabolism in C2C12 myotubes and soleus muscles of ob/ob mice but not in the gastrocnemius muscles of ob/ob mice. Collectively, these results suggest that leptin and leucine synergistically regulate protein metabolism in skeletal muscles both in vitro and in vivo.

Diversity in olfactory bulb size in birds reflects allometry, ecology, and phylogeny

PubMed Central

Corfield, Jeremy R.; Price, Kasandra; Iwaniuk, Andrew N.; Gutierrez-Ibañez, Cristian; Birkhead, Tim; Wylie, Douglas R.

2015-01-01

The relative size of olfactory bulbs (OBs) is correlated with olfactory capabilities across vertebrates and is widely used to assess the relative importance of olfaction to a species’ ecology. In birds, variations in the relative size of OBs are correlated with some behaviors; however, the factors that have led to the high level of diversity seen in OB sizes across birds are still not well understood. In this study, we use the relative size of OBs as a neuroanatomical proxy for olfactory capabilities in 135 species of birds, representing 21 orders. We examine the scaling of OBs with brain size across avian orders, determine likely ancestral states and test for correlations between OB sizes and habitat, ecology, and behavior. The size of avian OBs varied with the size of the brain and this allometric relationship was for the most part isometric, although species did deviate from this trend. Large OBs were characteristic of more basal species and in more recently derived species the OBs were small. Living and foraging in a semi-aquatic environment was the strongest variable driving the evolution of large OBs in birds; olfaction may provide cues for navigation and foraging in this otherwise featureless environment. Some of the diversity in OB sizes was also undoubtedly due to differences in migratory behavior, foraging strategies and social structure. In summary, relative OB size in birds reflect allometry, phylogeny and behavior in ways that parallel that of other vertebrate classes. This provides comparative evidence that supports recent experimental studies into avian olfaction and suggests that olfaction is an important sensory modality for all avian species. PMID:26283931

Biphasic positive effect of formononetin on metabolic activity of human normal and osteoarthritic subchondral osteoblasts.

PubMed

Huh, Jeong-Eun; Seo, Dong-Min; Baek, Yong-Hyeon; Choi, Do-Young; Park, Dong-Suk; Lee, Jae-Dong

2010-04-01

Osteoarthritis is a multifactorial disease characterized by loss of articular cartilage and subchondral plate thickening. Therefore, biochemical analysis of the underlying bone tissue has provided important information for treatment of osteoarthritis. In this study, we determined the potential role of formononetin, a phytoestrogen isolated from Astragalus membranaceus to alter the expression of metabolic markers and cytokine production of human normal osteoblasts (Obs) and osteoarthritis subchondral osteoblasts (OA Obs). Human OA Obs and normal Obs were cultured for 3days, 7days or 14days in the present medium only or were treated with various doses of formononetin. Cells were analyzed for viability by WST-8 assay, alkaline phosphatase (ALP) activity, osteogenic markers (osteocalcin (OCN) and type I collagen (Col I)) and cytokines (interleukin-6 (IL-6), vascular endothelial growth factor (VEGF), bone morphogenic protein-2 (BMP-2)). The level of IL-6, VEGF, BMP-2, OCN and Col I was increased in OA Obs compared with normal Obs. Formononetin dose-dependently decreased ALP, IL-6, VEGF, BMP-2, OCN and Col I in OA Obs, while markedly increased ALP, VEGF, BMP-2, OCN and Col I in normal Obs. Interestingly, formononetin markedly increased the expression of VEGF and BMP-2 for 3days of culture and significantly increased OCN and Col I at 14days in human normal Obs. The remodeling effect of formononetin on osteogenic markers and cytokines of inflammatory mediators was more striking in OA Obs as well. Taken together, these results could suggest that formononetin has biphasic positive effects on normal Obs and OA Obs by modifying their biological synthetic capacities. Crown Copyright 2010. Published by Elsevier B.V. All rights reserved.

A MULTIPLICITY CENSUS OF INTERMEDIATE-MASS STARS IN SCORPIUS-CENTAURUS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Janson, Markus; Lafreniere, David; Jayawardhana, Ray

2013-08-20

Stellar multiplicity properties have been studied for the lowest and the highest stellar masses, but intermediate-mass stars from F-type to late A-type have received relatively little attention. Here, we report on a Gemini/NICI snapshot imaging survey of 138 such stars in the young Scorpius-Centaurus (Sco-Cen) region, for the purpose of studying multiplicity with sensitivity down to planetary masses at wide separations. In addition to two brown dwarfs and a companion straddling the hydrogen-burning limit which we reported previously, here we present 26 new stellar companions and determine a multiplicity fraction within 0.''1-5.''0 of 21% {+-} 4%. Depending on the adoptedmore » semimajor axis distribution, our results imply a total multiplicity in the range of {approx}60%-80%, which further supports the known trend of a smooth continuous increase in the multiplicity fraction as a function of primary stellar mass. A surprising feature in the sample is a distinct lack of nearly equal-mass binaries, for which we discuss possible reasons. The survey yielded no additional companions below or near the deuterium-burning limit, implying that their frequency at >200 AU separations is not quite as high as might be inferred from previous detections of such objects within the Sco-Cen region.« less

Large-scale magnetic topologies of mid M dwarfs

NASA Astrophysics Data System (ADS)

Morin, J.; Donati, J.-F.; Petit, P.; Delfosse, X.; Forveille, T.; Albert, L.; Aurière, M.; Cabanac, R.; Dintrans, B.; Fares, R.; Gastine, T.; Jardine, M. M.; Lignières, F.; Paletou, F.; Ramirez Velez, J. C.; Théado, S.

2008-10-01

We present in this paper, the first results of a spectropolarimetric analysis of a small sample (~20) of active stars ranging from spectral type M0 to M8, which are either fully convective or possess a very small radiative core. This study aims at providing new constraints on dynamo processes in fully convective stars. This paper focuses on five stars of spectral type ~M4, i.e. with masses close to the full convection threshold (~=0.35Msolar), and with short rotational periods. Tomographic imaging techniques allow us to reconstruct the surface magnetic topologies from the rotationally modulated time-series of circularly polarized profiles. We find that all stars host mainly axisymmetric large-scale poloidal fields. Three stars were observed at two different epochs separated by ~1 yr; we find the magnetic topologies to be globally stable on this time-scale. We also provide an accurate estimation of the rotational period of all stars, thus allowing us to start studying how rotation impacts the large-scale magnetic field. Based on observations obtained at the Canada-France-Hawaii Telescope (CFHT) and the Télescope Bernard Lyot (TBL). CFHT is operated by the National Research Council of Canada, the Institut National des Science de l'Univers of the Centre National de la Recherche Scientifique of France (INSU/CNRS) and the University of Hawaii, while the TBL is operated by CNRS/INSU. E-mail: jmorin@ast.obs-mip.fr (JM); donati@ast.obs-mip.fr (J-FD); petit@ast.obs-mip.fr (PP); xavier.delfosse@obs.ujf-grenoble.fr (XD); thierry.forveille@obs.ujf-grenoble.fr (TF); albert@cfht.hawaii.edu (LA); auriere@ast.obs-mip.fr (MA); remi.cabanac@ast.obs-mip.fr (RC); dintrans@ast.obs-mip.fr (BD); rfares@ast.obs-mip.fr (RF); tgastine@ast.obs-mip.fr (TG); mmj@st-andrews.ac.uk (MMJ); ligniere@ast.obs-mip.fr (FL); fpaletou@ast.obs-mip.fr (FP); jramirez@mesiog.obspm.fr (JR); sylvie.theado@ast.obs-mip.fr (ST)

Oral delivery of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, synthetic peptide leptin mimetics: Immunofluorescent localization in the mouse hypothalamus.

PubMed

Anderson, Brian M; Jacobson, Lauren; Novakovic, Zachary M; Grasso, Patricia

2017-06-01

This study describes the localization of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, synthetic peptide leptin mimetics, in the hypothalamus of Swiss Webster and C57BL/6J wild-type mice, leptin-deficient ob/ob mice, and leptin-resistant diet-induced obese (DIO) mice. The mice were given [D-Leu-4]-OB3 or MA-[D-Leu-4]-OB3 in 0.3% dodecyl maltoside by oral gavage. Once peak serum concentrations were reached, the mice received a lethal dose of pentobarbital and were subjected to intracardiac perfusion fixation. The brains were excised, post-fixed in paraformaldehyde, and cryo-protected in sucrose. Free-floating frozen coronal sections were cut at 25-µm and processed for imaging by immunofluorescence microscopy. In all four strains of mice, dense staining was concentrated in the area of the median eminence, at the base and/or along the inner wall of the third ventricle, and in the brain parenchyma at the level of the arcuate nucleus. These results indicate that [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 cross the blood-brain barrier and concentrate in an area of the hypothalamus known to regulate energy balance and glucose homeostasis. Most noteworthy is the localization of [D-Leu-4]-OB3 immunoreactivity within the hypothalamus of DIO mice via a conduit that is closed to leptin in this rodent model, and in most cases of human obesity. Together with our previous studies describing the effects of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on energy balance, glucose regulation, and signal transduction pathway activation, these findings are consistent with a central mechanism of action for these synthetic peptide leptin mimetics, and suggest their potential usefulness in the management of leptin-resistant obesity and type 2 diabetes in humans. Copyright © 2017 Elsevier B.V. All rights reserved.

Biological interference of optical backscatterance sensors in Tampa Bay, Florida

USGS Publications Warehouse

Schoellhamer, D.H.

1993-01-01

Optical backscatterance (OBS, D&A Instruments, Inc.1 1 Use of brand, firm, or trade names in this paper is for identification purposes only and does not constitute endorsement by the U.S. Geological Survey.) sensors for measuring suspended-solids concentrations have been deployed in Tampa Bay to monitor resuspension of bottom sediments. This paper describes biological factors that affected the OBS sensors deployed in Tampa Bay and discusses deployment strategies that minimize biological interference. Phytoplankton may interfere with the OBS sensors when the suspended-solids concentration is near or below the sensor response threshold. Fish swimming in front of the OBS sensors caused spikes in the OBS sensor output, so the median average was more appropriate than the mean average. An algal slime on the OBS sensors caused excessive backscatterance that dominated the backscatterance from suspended material. Because of the fouling problem, deployments were limited to less than a week, and OBS sensors were cleaned daily, if possible. Calibration of OBS sensors with water samples collected from Tampa Bay was satisfactory when biological interference was not significant. When properly deployed, the OBS sensors can successfully monitor sediment resuspension in Tampa Bay and similar subtropical estuaries. ?? 1993.

Olfactory bulb volume in Taiwanese patients with posttraumatic anosmia.

PubMed

Jiang, Rong-San; Chai, Jyh-Wen; Chen, Wen-Hsien; Fuh, Wen-Bin; Chiang, Chin-Ming; Chen, Clayton Chi-Chang

2009-01-01

Olfactory bulb (OB) volume has been shown to be an indicator of olfactory function. However, few studies have been done in Asia to investigate the influence of different disorders on OB volume. Data from patients with posttraumatic anosmia were collected in our department. Their olfactory thresholds were assessed by the phenyl ethyl alcohol threshold test. They were treated with a course of high-dose steroid, and followed up for at least 3 months without any olfactory improvement. Magnetic resonance imaging was subsequently used to measure patients' OB volumes. Subjects who self-reported their olfactory function was normal were also included in the control group for comparison. Fifty-four patients with posttraumatic anosmia and 30 subjects who self-reported their olfactory function was normal were enrolled in this study. The mean right OB volume was 45.2 mm3, and the mean left OB volume was 46.3 mm3 in patients with posttraumatic anosmia. The mean right OB volume was 59.7 mm3, and the mean left OB volume was 66.0 mm3 in control subjects. The OB volumes were significantly lower in patients with posttraumatic anosmia. OB volumes were significantly lower in Taiwanese patients with posttraumatic anosmia.

Leptin produced by obese adipose stromal/stem cells enhances proliferation and metastasis of estrogen receptor positive breast cancers.

PubMed

Strong, Amy L; Ohlstein, Jason F; Biagas, Brandi A; Rhodes, Lyndsay V; Pei, Dorothy T; Tucker, H Alan; Llamas, Claire; Bowles, Annie C; Dutreil, Maria F; Zhang, Shijia; Gimble, Jeffrey M; Burow, Matthew E; Bunnell, Bruce A

2015-08-19

The steady increase in the incidence of obesity among adults has been paralleled with higher levels of obesity-associated breast cancer. While recent studies have suggested that adipose stromal/stem cells (ASCs) isolated from obese women enhance tumorigenicity, the mechanism(s) by which this occurs remains undefined. Evidence suggests that increased adiposity results in increased leptin secretion from adipose tissue, which has been shown to increased cancer cell proliferation. Previously, our group demonstrated that ASCs isolated from obese women (obASCs) also express higher levels of leptin relative to ASCs isolated from lean women (lnASCs) and that this obASC-derived leptin may account for enhanced breast cancer cell growth. The current study investigates the impact of inhibiting leptin expression in lnASCs and obASCs on breast cancer cell (BCC) growth and progression. Estrogen receptor positive (ER+) BCCs were co-cultured with leptin shRNA lnASCs or leptin shRNA obASCs and changes in the proliferation, migration, invasion, and gene expression of BCCs were investigated. To assess the direct impact of leptin inhibition in obASCs on BCC proliferation, MCF7 cells were injected alone or mixed with control shRNA obASCs or leptin shRNA obASCs into SCID/beige mice. ER+ BCCs were responsive to obASCs during direct co-culture, whereas lnASCs were unable to increase ER(+) BCC growth. shRNA silencing of leptin in obASCs negated the enhanced proliferative effects of obASC on BCCs following direct co-culture. BCCs co-cultured with obASCs demonstrated enhanced expression of epithelial-to-mesenchymal transition (EMT) and metastasis genes (SERPINE1, MMP-2, and IL-6), while BCCs co-cultured with leptin shRNA obASCs did not display similar levels of gene induction. Knockdown of leptin significantly reduced tumor volume and decreased the number of metastatic lesions to the lung and liver. These results correlated with reduced expression of both SERPINE1 and MMP-2 in tumors formed with MCF7 cells mixed with leptin shRNA obASCs, when compared to tumors formed with MCF7 cells mixed with control shRNA obASCs. This study provides mechanistic insight as to how obesity enhances the proliferation and metastasis of breast cancer cells; specifically, obASC-derived leptin contributes to the aggressiveness of breast cancer in obese women.

[D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, small molecule synthetic peptide leptin mimetics, improve glycemic control in diet-induced obese (DIO) mice.

PubMed

Wang, Anke; Anderson, Brian M; Novakovic, Zachary M; Grasso, Patricia

2018-03-01

We have previously shown that following oral delivery in dodecyl maltoside (DDM), [D-Leu-4]-OB3 and its myristic acid conjugate, MA-[D-Leu-4]-OB3, improved energy balance and glucose homeostasis in genetically obese/diabetic mouse models. More recently, we have provided immunohistochemical evidence indicating that these synthetic peptide leptin mimetics cross the blood-brain barrier and concentrate in the area of the arcuate nucleus of the hypothalamus in normal C57BL/6J and Swiss Webster mice, in genetically obese ob/ob mice, and in diet-induced obese (DIO) mice. In the present study, we describe the effects of oral delivery of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on glycemic control in diet-induced (DIO) mice, a non-genetic rodent model of obesity and its associated insulin resistance, which more closely recapitulates common obesity and diabetes in humans. Male C57BL/6J and DIO mice, 17, 20, and 28 weeks of age, were maintained on a low-fat or high-fat diet and given vehicle (DDM) alone or [D-Leu-4]-OB3 or MA-[D-Leu-4]-OB3 in DDM by oral gavage for 12 or 14 days. Body weight gain, food and water intake, fasting blood glucose, oral glucose tolerance, and serum insulin levels were measured. Our data indicate that (1) [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 restore glucose tolerance in male DIO mice maintained on a high-fat diet to levels comparable to those of non-obese C57BL/6J wild-type mice of the same age and sex maintained on a low-fat diet; and (2) the influence of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on glycemic control appears to be independent of their effects on energy balance. These results suggest that [D-Leu-4]-OB3 and/or MA-[D-Leu-4]-OB3 may have application to the management of the majority of cases of common obesity in humans, a state characterized at least in part, by leptin resistance resulting from a defect in leptin transport across the blood-brain barrier. They further suggest that these small molecule synthetic peptide leptin mimetics, through their influence on glycemic control, may prevent the pre-diabetic state associated with most cases of common obesity from escalating into overt type 2 diabetes mellitus. Copyright © 2017 Elsevier Inc. All rights reserved.

A study on the reproducibility of cephalometric landmarks when undertaking a three-dimensional (3D) cephalometric analysis

PubMed Central

Llamas, José M.; Cibrián, Rosa; Gandia, José L.; Paredes, Vanessa

2012-01-01

Objectives: Cone Beam Computerized Tomography (CBCT) allows the possibility of modifying some of the diagnostic tools used in orthodontics, such as cephalometry. The first step must be to study the characteristics of these devices in terms of accuracy and reliability of the most commonly used landmarks. The aims were 1- To assess intra and inter-observer reliability in the location of anatomical landmarks belonging to hard tissues of the skull in images taken with a CBCT device, 2- To determine which of those landmarks are more vs. less reliable and 3- To introduce planes of reference so as to create cephalometric analyses appropriated to the 3D reality. Study design: Fifteen patients who had a CBCT (i-CAT®) as a diagnostic register were selected. To assess the reproducibility on landmark location and the differences in the measurements of two observers at different times, 41 landmarks were defined on the three spatial axes (X,Y,Z) and located. 3.690 measurements were taken and, as each determination has 3 coordinates, 11.070 data were processed with SPSS® statistical package. To discover the reproducibility of the method on landmark location, an ANOVA was undertaken using two variation factors: time (t1, t2 and t3) and observer (Ob1 and Ob2) for each axis (X, Y and Z) and landmark. The order of the CBCT scans submitted to the observers (Ob1, Ob2) at t1, t2, and t3, were different and randomly allocated. Multiple comparisons were undertaken using the Bonferroni test. The intra- and inter-examiner ICC´s were calculated. Results: Intra- and inter-examiner reliability was high, both being ICC ≥ 0.99, with the best frequency on axis Z. Conclusions: The most reliable landmarks were: Nasion, Sella, Basion, left Porion, point A, anterior nasal spine, Pogonion, Gnathion, Menton, frontozygomatic sutures, first lower molars and upper and lower incisors. Those with less reliability were the supraorbitals, right zygion and posterior nasal spine. Key words:Cone Beam Computed Tomography, cephalometry, landmark, orthodontics, reliability. PMID:22322503

Olfactory bulb and olfactory sulcus depths are associated with disease duration and attack frequency in multiple sclerosis patients.

PubMed

Tanik, Nermin; Serin, Halil Ibrahim; Celikbilek, Asuman; Inan, Levent Ertugrul; Gundogdu, Fatma

2015-11-15

Multiple sclerosis (MS) is a neuroinflammatory and neurodegenerative disease that progresses to axonal loss and demyelinization. Olfactory dysfunction in patients with MS has been reported frequently. We were interested in the associations of olfactory bulb (OB) and olfactory sulcus depth (OSD) with disease duration and attack frequency. We included 25 patients with MS and 30 age- and sex-matched controls in this study. The Expanded Disability Status Scale, Beck Depression Inventory, and Mini Mental State Examination were applied. OB, OSD, and magnetic resonance imaging plaque numbers were calculated. OB volume and OSD in patients with MS were significantly lower than those in the control group (right and left OB: p<0.001; right OSD: p=0.001; and left OSD: p=0.039). Disease duration was negatively correlated with right and left OB volume (right OB: r=-0.434, p=0.030 and left OB: r=-0.518, p=0.008). Attack frequency was negatively correlated with left OB volume and left OSD (left OB: r=-0.428, p=0.033 and left OSD: r=-0.431, p=0.032). The OB and OSD were atrophied significantly in patients with MS, and this was correlated with disease duration and attack frequency. The left side tended to be dominant. Copyright © 2015 Elsevier B.V. All rights reserved.

Oil Bodies Extracted from High-Fat and Low-Fat Soybeans: Stability and Composition During Storage.

PubMed

Wang, Qiu Ling; Li Cui, Chun; Jiang, Lian Zhou; Liu, Yue; Liang, Xin Ting; Hou, Jun Cai

2017-06-01

Soybeans contain oil bodies (OBs) that encapsulate triacylglycerols (TAGs) with a phospholipid monolayer carrying scattered proteins. In nature, soybean OBs can form natural emulsions in aqueous media and may serve as natural, minimally processed, stable, and pre-emulsified oil for addition into appropriate food systems. In this study, OBs were obtained by aqueous extraction from the mature seeds of 2 soybean crop cultivars, high-fat soybean and low-fat soybeans. The compositions of the extracted OBs were analyzed during storage at room temperature up to 14 d (pH = 7). The oxidative stability of these OBs, stored at 60 °C, was evaluated by measuring the presence of primary (lipid hydroperoxides) and secondary lipid oxidation products (malondialdehyde) by determining the standard peroxide value (PV) and thiobarbituric acid-reactive substances (TBARS) value. During storage, the contents of unsaturated fatty acids, phospholipids, and tocopherols declined in both OBs, while their mean particle diameters (d 32 ) and ζ-potentials increased. The changes in PV and TBARS values exhibited a similar trend for both OBs, but the OBs from low-fat soybeans had significantly lower PV and higher TBARS values than the OBs from high-fat soybean cultivars (P < 0.05). Overall, the OBs from both soybean cultivars had good stability during storage. © 2017 Institute of Food Technologists®.

Surface Observation Climatic Summaries (SOCS) For Mather AFB, California

DTIC Science & Technology

1992-02-01

1100 SPEND (RTS) CE14 GEIS GE25 OBS GE14 GEl8 GE25 OBS GE14 GEl8 GE25 OBS GE14 GEl8 GE25 OBS CATEGORY A 1.7 .5 .1 930 1.6 .6 .1 930 1.6 .4 930 3.4 1.0...ITS) GE14 0E18 GE25 ORS GE14 GEIS GE25 OS GE14 GEl8 GE25 OBS GE14 GE18 GE25 OBS CATEGORY A 5.7 2.4 930 5.2 1.3 .2 930 1.7 .5 .2 930 1.5 .5 .1 930...TIME (LST) 0600 - 2000 ALL HOURS SPEED K75 GE14 GEl8 GE25 OBS GE14 GEl8 UE25 OS CAT Y A 3.5 1.1 .1 4650 2.8 .9

Genetic ablation of phosphatidylcholine transfer protein/StarD2 in ob/ob mice improves glucose tolerance without increasing energy expenditure.

PubMed

Krisko, Tibor I; LeClair, Katherine B; Cohen, David E

2017-03-01

Phosphatidylcholine transfer protein (PC-TP; synonym StarD2) is highly expressed in liver and oxidative tissues. PC-TP promotes hepatic glucose production during fasting and aggravates glucose intolerance in high fat fed mice. However, because PC-TP also suppresses thermogenesis in brown adipose tissue (BAT), its direct contribution to obesity-associated diabetes in mice remains unclear. Here we examined the effects of genetic PC-TP ablation on glucose homeostasis in leptin-deficient ob/ob mice, which exhibit both diabetes and altered thermoregulation. Mice lacking both PC-TP and leptin (Pctp -/- ;ob/ob) were prepared by crossing Pctp -/- with ob/+ mice. Glucose homeostasis was assessed by standard assays, and energy expenditure was determined by indirect calorimetry using a comprehensive laboratory animal monitoring system, which also recorded physical activity and food intake. Body composition was determined by NMR and hepatic lipids by enzymatic assays. Core body temperature was measured using a rectal thermocouple probe. Pctp -/- ;ob/ob mice demonstrated improved glucose homeostasis, as evidenced by markedly improved glucose and pyruvate tolerance tests, without changes in insulin tolerance. However, there were no differences in EE at any ambient temperature. There were also no effects of PC-TP expression on physical activity, food intake or core body temperature. Improved glucose tolerance in Pctp -/- ;ob/ob mice in the absence of increases in energy expenditure or core body temperature indicates a direct pathogenic role for PC-TP in diabetes in leptin deficient mice. Copyright © 2016 Elsevier Inc. All rights reserved.

Leptin differentially regulates STAT3 activation in the ob/ob mice adipose mesenchymal stem cells

USDA-ARS?s Scientific Manuscript database

Leptin-deficient genetically obese ob/ob mice exhibit adipocyte hypertrophy and hyperplasia as well as elevated adipose tissue and systemic inflammation. Studies have shown that multipotent stem cells isolated from adult adipose tissue can differentiate into adipocytes ex vivo and thereby contribute...

Correction of clock errors in seismic data using noise cross-correlations

NASA Astrophysics Data System (ADS)

Hable, Sarah; Sigloch, Karin; Barruol, Guilhem; Hadziioannou, Céline

2017-04-01

Correct and verifiable timing of seismic records is crucial for most seismological applications. For seismic land stations, frequent synchronization of the internal station clock with a GPS signal should ensure accurate timing, but loss of GPS synchronization is a common occurrence, especially for remote, temporary stations. In such cases, retrieval of clock timing has been a long-standing problem. The same timing problem applies to Ocean Bottom Seismometers (OBS), where no GPS signal can be received during deployment and only two GPS synchronizations can be attempted upon deployment and recovery. If successful, a skew correction is usually applied, where the final timing deviation is interpolated linearly across the entire operation period. If GPS synchronization upon recovery fails, then even this simple and unverified, first-order correction is not possible. In recent years, the usage of cross-correlation functions (CCFs) of ambient seismic noise has been demonstrated as a clock-correction method for certain network geometries. We demonstrate the great potential of this technique for island stations and OBS that were installed in the course of the Réunion Hotspot and Upper Mantle - Réunions Unterer Mantel (RHUM-RUM) project in the western Indian Ocean. Four stations on the island La Réunion were affected by clock errors of up to several minutes due to a missing GPS signal. CCFs are calculated for each day and compared with a reference cross-correlation function (RCF), which is usually the average of all CCFs. The clock error of each day is then determined from the measured shift between the daily CCFs and the RCF. To improve the accuracy of the method, CCFs are computed for several land stations and all three seismic components. Averaging over these station pairs and their 9 component pairs reduces the standard deviation of the clock errors by a factor of 4 (from 80 ms to 20 ms). This procedure permits a continuous monitoring of clock errors where small clock drifts (1 ms/day) as well as large clock jumps (6 min) are identified. The same method is applied to records of five OBS stations deployed within a radius of 150 km around La Réunion. The assumption of a linear clock drift is verified by correlating OBS for which GPS-based skew corrections were available with land stations. For two OBS stations without skew estimates, we find clock drifts of 0.9 ms/day and 0.4 ms/day. This study salvages expensive seismic records from remote regions that would be otherwise lost for seismicity or tomography studies.

Shoreline-crossing shear-velocity structure of the Juan de Fuca plate and Cascadia subduction zone from surface waves and receiver functions

NASA Astrophysics Data System (ADS)

Janiszewski, Helen; Gaherty, James; Abers, Geoffrey; Gao, Haiying

2017-04-01

The Cascadia subduction zone (CSZ) is the site of the onshore-offshore Cascadia Initiative, which deployed seismometers extending from the Juan de Fuca ridge to the subduction zone and onshore beyond the volcanic arc. This array allows the unique opportunity to seismically image the evolution and along-strike variation of the crust and mantle of the entire CSZ. We compare teleseismic receiver functions, ambient-noise Rayleigh-wave phase velocities in the 10-20 s period band, and earthquake-source Rayleigh-wave phase velocities from 20-100 s, to determine shear-velocity structure in the upper 200 km. Receiver functions from both onshore and shallow-water offshore sites provide constraints on crustal and plate interface structure. Spectral-domain fitting of ambient-noise empirical Green's functions constrains shear velocity of the crust and shallow mantle. An automated multi-channel cross-correlation analysis of teleseismic Rayleigh waves provides deeper lithosphere and asthenosphere constraints. The amphibious nature of the array means it is essential to examine the effect of noise variability on data quality. Ocean bottom seismometers (OBS) are affected by tilt and compliance noise. Removal of this noise from the vertical components of the OBS is essential for the teleseismic Rayleigh waves; this stabilizes the output phase velocity maps particularly along the coastline where observations are predominately from shallow water OBS. Our noise-corrected phase velocity maps reflect major structures and tectonic transitions including the transition from high-velocity oceanic lithosphere to low-velocity continental lithosphere, high velocities associated with the subducting slab, and low velocities beneath the ridge and arc. We interpret the resulting shear-velocity model in the context of temperature and compositional variation in the incoming plate and along the strike of the CSZ.

Shoreline-Crossing Shear-Velocity Structure of the Juan de Fuca Plate and Cascadia Subduction Zone from Surface Waves and Receiver Functions

NASA Astrophysics Data System (ADS)

Janiszewski, H. A.; Gaherty, J. B.; Abers, G. A.; Gao, H.

2016-12-01

The Cascadia subduction zone (CSZ) is the site of the onshore-offshore Cascadia Initiative, which deployed seismometers extending from the Juan de Fuca ridge to the subduction zone and onshore beyond the volcanic arc. This array allows the unique opportunity to seismically image the evolution and along-strike variation of the crust and mantle of the entire CSZ. We compare teleseismic receiver functions, ambient-noise Rayleigh-wave phase velocities in the 10-20 s period band, and earthquake-source Rayleigh-wave phase velocities from 20-100 s, to determine shear-velocity structure in the upper 200 km. Receiver functions from both onshore and shallow-water offshore sites provide constraints on crustal and plate interface structure. Spectral-domain fitting of ambient-noise empirical Green's functions constrains shear velocity of the crust and shallow mantle. An automated multi-channel cross-correlation analysis of teleseismic Rayleigh waves provides deeper lithosphere and asthenosphere constraints. The amphibious nature of the array means it is essential to examine the effect of noise variability on data quality. Ocean bottom seismometers (OBS) are affected by tilt and compliance noise. Removal of this noise from the vertical components of the OBS is essential for the teleseismic Rayleigh waves; this stabilizes the output phase velocity maps particularly along the coastline where observations are predominately from shallow water OBS. Our noise-corrected phase velocity maps reflect major structures and tectonic transitions including the transition from high-velocity oceanic lithosphere to low-velocity continental lithosphere, high velocities associated with the subducting slab, and low velocities beneath the ridge and arc. We interpret the resulting shear-velocity model in the context of temperature and compositional variation in the incoming plate and along the strike of the CSZ.

Accurate ocean bottom seismometer positioning method inspired by multilateration technique

USGS Publications Warehouse

Benazzouz, Omar; Pinheiro, Luis M.; Matias, Luis M. A.; Afilhado, Alexandra; Herold, Daniel; Haines, Seth S.

2018-01-01

The positioning of ocean bottom seismometers (OBS) is a key step in the processing flow of OBS data, especially in the case of self popup types of OBS instruments. The use of first arrivals from airgun shots, rather than relying on the acoustic transponders mounted in the OBS, is becoming a trend and generally leads to more accurate positioning due to the statistics from a large number of shots. In this paper, a linearization of the OBS positioning problem via the multilateration technique is discussed. The discussed linear solution solves jointly for the average water layer velocity and the OBS position using only shot locations and first arrival times as input data.

Automated identification of OB associations in M31

NASA Technical Reports Server (NTRS)

Magnier, Eugene A.; Battinelli, Paolo; Lewin, Walter H. G.; Haiman, Zoltan; Paradijs, Jan Van; Hasinger, Guenther; Pietsch, Wolfgang; Supper, Rodrigo; Truemper, Joachim

1993-01-01

A new identification of OB associations in M31 has been performed using the Path Linkage Criterion (PLC) technique of Battinelli (1991). We found 174 associations with a very small contamination (less than 5%) by random clumps of stars. The expected total number and average size of OB associations in the region of M 31 covered by our data set (Magnier et al. 1992) are approximately 280 and approximately 90 pc, respectively. M31 associations therefore have sizes similar to those of OB associations observed in nearby galaxies, so that we can consider them to be classical OB associations. This list of OB associations will be used for the study of the spatial distribution of OB associations and their correlation with other objects. Taking into account the fact that we do not cover the entire disk of M31, we extrapolate a total number of association in M31 of approximately 420.

Organic brain syndrome and aging. A six-year follow-up of surviving twins.

PubMed

Jarvik, L F; Ruth, V; Matsuyama, S S

1980-03-01

The development of organic brain syndrome (OBS) was studied in a small group of survivors from a longitudinal investigation of aging twins. At the time of initial evaluation, the frequency of moderate to severe OBS was 25%. Among the 22 survivors who had a second psychiatric evaluation after approximately six years, the corrected rate for the development of OBS among those without it at the initial examination was 16%. Thus, the vast majority of those diagnosed as being without OBS at about the age of 80 years remained asymptomatic in subsequent years, supporting the view that OBS is not a necessary concomitant of old age, but the result of disease for which prevention and cure should be sought. Persons originally diagnosed as having OBS had the higher mortality, an observation in accord with prior reports in the literature. In the present study, the increased mortality was related to the severity of OBS but apparently independent of coexisting physical illness, again supporting the argument that OBS represents pathological as distinct from physiological aging.

Structural anatomy of telomere OB proteins.

PubMed

Horvath, Martin P

2011-10-01

Telomere DNA-binding proteins protect the ends of chromosomes in eukaryotes. A subset of these proteins are constructed with one or more OB folds and bind with G+T-rich single-stranded DNA found at the extreme termini. The resulting DNA-OB protein complex interacts with other telomere components to coordinate critical telomere functions of DNA protection and DNA synthesis. While the first crystal and NMR structures readily explained protection of telomere ends, the picture of how single-stranded DNA becomes available to serve as primer and template for synthesis of new telomere DNA is only recently coming into focus. New structures of telomere OB fold proteins alongside insights from genetic and biochemical experiments have made significant contributions towards understanding how protein-binding OB proteins collaborate with DNA-binding OB proteins to recruit telomerase and DNA polymerase for telomere homeostasis. This review surveys telomere OB protein structures alongside highly comparable structures derived from replication protein A (RPA) components, with the goal of providing a molecular context for understanding telomere OB protein evolution and mechanism of action in protection and synthesis of telomere DNA.

Structural anatomy of telomere OB proteins

PubMed Central

Horvath, Martin P.

2015-01-01

Telomere DNA-binding proteins protect the ends of chromosomes in eukaryotes. A subset of these proteins are constructed with one or more OB folds and bind with G+T-rich single-stranded DNA found at the extreme termini. The resulting DNA-OB protein complex interacts with other telomere components to coordinate critical telomere functions of DNA protection and DNA synthesis. While the first crystal and NMR structures readily explained protection of telomere ends, the picture of how single-stranded DNA becomes available to serve as primer and template for synthesis of new telomere DNA is only recently coming into focus. New structures of telomere OB fold proteins alongside insights from genetic and biochemical experiments have made significant contributions towards understanding how protein-binding OB proteins collaborate with DNA-binding OB proteins to recruit telomerase and DNA polymerase for telomere homeostasis. This review surveys telomere OB protein structures alongside highly comparable structures derived from replication protein A (RPA) components, with the goal of providing a molecular context for understanding telomere OB protein evolution and mechanism of action in protection and synthesis of telomere DNA. PMID:21950380

Oral Administration of Apple Procyanidins Ameliorates Insulin Resistance via Suppression of Pro-Inflammatory Cytokine Expression in Liver of Diabetic ob/ob Mice.

PubMed

Ogura, Kasane; Ogura, Masahito; Shoji, Toshihiko; Sato, Yuichi; Tahara, Yumiko; Yamano, Gen; Sato, Hiroki; Sugizaki, Kazu; Fujita, Naotaka; Tatsuoka, Hisato; Usui, Ryota; Mukai, Eri; Fujimoto, Shimpei; Inagaki, Nobuya; Nagashima, Kazuaki

2016-11-23

Procyanidins, the main ingredient of apple polyphenols, are known to possess antioxidative and anti-inflammatory effects associated closely with the pathophysiology of insulin resistance and type 2 diabetes. We investigated the effects of orally administered apple procyanidins (APCs) on glucose metabolism using diabetic ob/ob mice. We found no difference in body weight or body composition between mice treated with APCs and untreated mice. A 4 week oral administration of APCs containing water [0.5% (w/v)] ameliorated glucose tolerance, insulin resistance, and hepatic gluconeogenesis in ob/ob mice. APCs also suppressed the increase in the level of the pancreatic β-cell. Insulin-stimulated Akt phosphorylation was significantly enhanced; pro-inflammatory cytokine expression levels were significantly decreased, and c-Jun N-terminal kinase phosphorylation was downregulated in the liver of those mice treated with APCs. In conclusion, APCs ameliorate insulin resistance by improving hepatic insulin signaling through suppression of hepatic inflammation in ob/ob mice, which may be a mechanism with possible beneficial health effects of APCs in disturbed glucose metabolism.

Oligoclonal bands and periventricular lesions in multiple sclerosis will not increase blood-brain barrier permeability.

PubMed

Akaishi, Tetsuya; Takahashi, Toshiyuki; Nakashima, Ichiro

2018-04-15

To elucidate the etiology and clinical significance of periventricular lesions (PVLs) and oligoclonal bands (OB) in multiple sclerosis (MS). We enrolled a total of 97 MS patients (67 OB-positive and 30 OB-negative) who were negative both for anti-aquaporin-4 (AQP4) autoantibody and anti-myelin oligodendrocyte glycoprotein (MOG) antibody. In these patients, comprehensive data including clinical, laboratory, and MRI were collected to investigate the significance of OB and PVLs. Within the MS patients, OB-positivity and the number of PVLs were associated each other. Both of OB-positivity and PVLs did not affect clinical severity or relapse rate, though the patients with ≥3 PVLs showed faster cerebral atrophy than those with <3 PVLs. The patients with OB or ≥3 PVLs showed lower values of quotient of albumin (QAlb), a biomarker of blood-brain barrier (BBB)-permeability and possibly reflects the ongoing disease activity, and lower protein levels in cerebrospinal fluid (CSF). The causal relationship between the decreased QAlb and OB or ≥3 PVLs was not determined. OB and PVLs were associated each other, but they did not affect the clinical course or increased the BBB-permeability within MS patients. Copyright © 2018 Elsevier B.V. All rights reserved.

Oil Bodies and Oleosins in Physcomitrella Possess Characteristics Representative of Early Trends in Evolution1[W][OA

PubMed Central

Huang, Chien-Yu; Chung, Chun-I; Lin, Yao-Cheng; Hsing, Yue-Ie Caroline; Huang, Anthony H.C.

2009-01-01

Searches of sequenced genomes of diverse organisms revealed that the moss Physcomitrella patens is the most primitive organism possessing oleosin genes. Microscopy examination of Physcomitrella revealed that oil bodies (OBs) were abundant in the photosynthetic vegetative gametophyte and the reproductive spore. Chromatography illustrated the neutral lipids in OBs isolated from the gametophyte to be largely steryl esters and triacylglycerols, and SDS-PAGE showed the major proteins to be oleosins. Reverse transcription-PCR revealed the expression of all three oleosin genes to be tissue specific. This tissue specificity was greatly altered via alternative splicing, a control mechanism of oleosin gene expression unknown in higher plants. During the production of sex organs at the tips of gametophyte branches, the number of OBs in the top gametophyte tissue decreased concomitant with increases in the number of peroxisomes and level of transcripts encoding the glyoxylate cycle enzymes; thus, the OBs are food reserves for gluconeogenesis. In spores during germination, peroxisomes adjacent to OBs, along with transcripts encoding the glyoxylate cycle enzymes, appeared; thus, the spore OBs are food reserves for gluconeogenesis and equivalent to seed OBs. The one-cell-layer gametophyte could be observed easily with confocal microscopy for the subcellular OBs and other structures. Transient expression of various gene constructs transformed into gametophyte cells revealed that all OBs were linked to the endoplasmic reticulum (ER), that oleosins were synthesized in extended regions of the ER, and that two different oleosins were colocated in all OBs. PMID:19420327

Macronutrients and micronutrients of soybean oil bodies extracted at different pH.

PubMed

Chen, Yeming; Cao, Yanyun; Zhao, Luping; Kong, Xiangzhen; Hua, Yufei

2014-07-01

In this study, the macronutrients and micronutrients of pH 6.8, 8.0, 9.5, and 11.0 extracted soybean oil bodies (OBs) were examined, revealing that soybean OBs might be used as a natural carrier for bioactive components (unsaturated fatty acids, phospholipid, tocopherol, and phytosterol). pH 6.8 extracted OBs (dry basis) contained 85.88% neutral lipid, 8.18% protein, and 5.85% polar lipid (mainly phospholipid) by gravimetric analysis. The percentage of neutral lipid was increased, while those of protein and polar lipid were decreased with increasing pH. Tocopherol (about 75 mg/100 g neutral lipid of OBs) was not affected, while phytosterol was decreased (136 to 110 mg/100 g neutral lipid of OBs) with increasing pH. The detectable total monosaccaride (galactosamine, glucosamine, and glucose) content of extracted OBs was low and also decreased (35.80 to 6.13 mg/100 g neutral lipid of OBs) with increasing pH. The protein of extracted OBs had higher percentage of essential amino acids than soybean protein isolate with tryptophan and methionine as limited amino acids. The fatty acid composition of extracted OBs was rich in linoleic acid (about 59%), oleic acid (about 20%), and α-linolenic acid (about 7%). Oil bodies (OBs) from soybean and other plant seeds are greatly examined owing to their potential utilizations in food ingredients. The determination of its macronutrients and micronutrients would be very meaningful for its efficient utilization in the future. © 2014 Institute of Food Technologists®

Sirtuin-2 Regulates Sepsis Inflammation in ob/ob Mice

PubMed Central

Wang, Xianfeng; Buechler, Nancy L.; Martin, Ayana; Wells, Jonathan; Yoza, Barbara; McCall, Charles E.; Vachharajani, Vidula

2016-01-01

Objective Obesity increases morbidity and resource utilization in sepsis patients. Sepsis transitions from early/hyper-inflammatory to late/hypo-inflammatory phase. Majority of sepsis-mortality occurs during the late sepsis; no therapies exist to treat late sepsis. In lean mice, we have shown that sirtuins (SIRTs) modulate this transition. Here, we investigated the role of sirtuins, especially the adipose-tissue abundant SIRT-2 on transition from early to late sepsis in obese with sepsis. Methods Sepsis was induced using cecal ligation and puncture (CLP) in ob/ob mice. We measured microvascular inflammation in response to lipopolysaccharide/normal saline re-stimulation as a “second-hit” (marker of immune function) at different time points to track phases of sepsis in ob/ob mice. We determined SIRT-2 expression during different phases of sepsis. We studied the effect of SIRT-2 inhibition during the hypo-inflammatory phase on immune function and 7-day survival. We used a RAW264.7 (RAW) cell model of sepsis for mechanistic studies. We confirmed key findings in diet induced obese (DIO) mice with sepsis. Results We observed that the ob/ob-septic mice showed an enhanced early inflammation and a persistent and prolonged hypo-inflammatory phase when compared to WT mice. Unlike WT mice that showed increased SIRT1 expression, we found that SIRT2 levels were increased in ob/ob mice during hypo-inflammation. SIRT-2 inhibition in ob/ob mice during the hypo-inflammatory phase of sepsis reversed the repressed microvascular inflammation in vivo via activation of endothelial cells and circulating leukocytes and significantly improved survival. We confirmed the key finding of the role of SIRT2 during hypo-inflammatory phase of sepsis in this project in DIO-sepsis mice. Mechanistically, in the sepsis cell model, SIRT-2 expression modulated inflammatory response by deacetylation of NFκBp65. Conclusion SIRT-2 regulates microvascular inflammation in obese mice with sepsis and may provide a novel treatment target for obesity with sepsis. PMID:27500833

Impact of diet on the cardiovascular risk profile of Japanese immigrants living in Brazil: contributions of World Health Organization CARDIAC and MONALISA studies.

PubMed

Moriguchi, E H; Moriguchi, Y; Yamori, Y

2004-12-01

1. Japanese immigrants from Okinawa living in Brazil have a higher mortality from cardiovascular diseases and have their mean life expectancy shortened compared with their counterparts living in Japan. 2. A cross-sectional study comparing Okinawans living in Okinawa (OO) and Okinawan immigrants living in Brazil (OB) was designed to characterize the dietary factors that could interfere with the profile of cardiovascular risk factors and with this reduction on the life expectancy when Okinawans emigrate to Brazil. 3. In total, 234 OO and 160 OB (aged 45-59 years) were recruited to the present study to undergo medical and dietary history, blood pressure measurement, electrocardiograph (ECG), blood tests and 24 h food/urine collection. 4. In the present study, OO subjects presented with 37% less obesity and 50% less systemic hypertension than OB. The OB subjects used threefold more antihypertensive medication than OO. Meat intake was 34% higher in OB than OO, whereas fish intake was sevenfold higher in OO than OB. Serum potassium levels were 10% higher in OO than OB. Urinary taurine (an index of seafood intake) was 43% higher in OO than OB. Urinary isoflavones (an index of the intake of soy products) were significantly lower in OB than in OO. Of acid (20:5) and docosahexaenoic acid (22:6) were two- and threefold higher in OO than OB, respectively. 5. The rate of ischaemic ECG changes in OO subjects was only 50% of that of OB subjects. 6. There were no differences in the smoking rate between OO and OB subjects. 7. The results of the present study suggest that coronary risk factors and cardiovascular health are not only regulated by genetic factors, but that the impact of lifestyle (mainly diet) can be large enough to modulate the expression of genes.

Importance of reward and prefrontal circuitry in hunger and satiety: Prader-Willi syndrome vs simple obesity.

PubMed

Holsen, L M; Savage, C R; Martin, L E; Bruce, A S; Lepping, R J; Ko, E; Brooks, W M; Butler, M G; Zarcone, J R; Goldstein, J M

2012-05-01

The majority of research on obesity (OB) has focused primarily on clinical features (eating behavior, adiposity measures) or peripheral appetite-regulatory peptides (leptin, ghrelin). However, recent functional neuroimaging studies have demonstrated that some reward circuitry regions that are associated with appetite-regulatory hormones are also involved in the development and maintenance of OB. Prader-Willi syndrome (PWS), characterized by hyperphagia and hyperghrelinemia reflecting multi-system dysfunction in inhibitory and satiety mechanisms, serves as an extreme model of genetic OB. Simple (non-PWS) OB represents an OB-control state. This study investigated subcortical food motivation circuitry and prefrontal inhibitory circuitry functioning in response to food stimuli before and after eating in individuals with PWS compared with OB. We hypothesized that groups would differ in limbic regions (that is, hypothalamus, amygdala) and prefrontal regions associated with cognitive control (that is, dorsolateral prefrontal cortex (DLPFC), orbitofrontal cortex (OFC) after eating. A total of 14 individuals with PWS, 14 BMI- and age-matched individuals with OB, and 15 age-matched healthy-weight controls viewed food and non-food images while undergoing functional MRI before (pre-meal) and after (post-meal) eating. Using SPM8, group contrasts were tested for hypothesized regions: hypothalamus, nucleus accumbens (NAc), amygdala, hippocampus, OFC, medial PFC and DLPFC. Compared with OB and HWC, PWS demonstrated higher activity in reward/limbic regions (NAc, amygdala) and lower activity in the hypothalamus and hippocampus in response to food (vs non-food) images pre-meal. Post meal, PWS exhibited higher subcortical activation (hypothalamus, amygdala, hippocampus) compared with OB and HWC. OB showed significantly higher activity versus PWS and HWC in cortical regions (DLPFC, OFC) associated with inhibitory control. In PWS, compared with OB per se, results suggest hyperactivations in subcortical reward circuitry and hypoactivations in cortical inhibitory regions after eating, which provides evidence of neural substrates associated with variable abnormal food motivation phenotypes in PWS and simple OB.

Soluble Leptin Receptor Predicts Insulin Sensitivity and Correlates With Upregulation of Metabolic Pathways in Men.

PubMed

Sommer, Christine; Lee, Sindre; Gulseth, Hanne Løvdal; Jensen, Jørgen; Drevon, Christian A; Birkeland, Kåre Inge

2018-03-01

Plasma soluble leptin receptor (sOb-R) seems protective of gestational and type 2 diabetes in observational studies, but the mechanisms are unknown. sOb-R is formed by ectodomain shedding of membrane-bound leptin receptors (Ob-Rs), but its associations with messenger RNA (mRNA) expression are scarcely explored. To explore associations between plasma levels of sOb-R and (1) insulin sensitivity, (2) mRNA pathways in adipose tissue and skeletal muscle, and (3) mRNA of candidate genes for sOb-R generation in adipose tissue and skeletal muscle. The MyoGlu study included 26 sedentary, middle-aged men who underwent a 12-week intensive exercise intervention. We measured plasma sOb-R with enzyme-linked immunosorbent assay, insulin sensitivity with a hyperinsulinemic euglycemic clamp, and mRNA in skeletal muscle and adipose tissue with high-throughput sequencing. Baseline plasma sOb-R was strongly associated with baseline glucose infusion rate (GIR) [β (95% confidence interval), 1.19 (0.57 to 1.82) mg/kg/min, P = 0.0006] and GIR improvement after the exercise intervention [0.58 (0.03 to 1.12) mg/kg/min, P = 0.039], also independently of covariates, including plasma leptin. In pathway analyses, high plasma sOb-R correlated with upregulation of metabolic pathways and downregulation of inflammatory pathways in both adipose tissue and skeletal muscle. In skeletal muscle, mRNA of LEPROT and LEPROTL1 (involved in Ob-R cell surface expression) and ADAM10 and ADAM17 (involved sOb-R-shedding) increased after the exercise intervention. Higher plasma sOb-R was associated with improved GIR, upregulation of metabolic pathways, and downregulation of inflammatory pathways, which may be possible mechanisms for the seemingly protective effect of plasma sOb-R on subsequent risk of gestational and type 2 diabetes found in observational studies.

Gender Dimorphism in Skeletal Muscle Leptin Receptors, Serum Leptin and Insulin Sensitivity

PubMed Central

Guerra, Borja; Fuentes, Teresa; Delgado-Guerra, Safira; Guadalupe-Grau, Amelia; Olmedillas, Hugo; Santana, Alfredo; Ponce-Gonzalez, Jesus Gustavo; Dorado, Cecilia; Calbet, José A. L.

2008-01-01

To determine if there is a gender dimorphism in the expression of leptin receptors (OB-R170, OB-R128 and OB-R98) and the protein suppressor of cytokine signaling 3 (SOCS3) in human skeletal muscle, the protein expression of OB-R, perilipin A, SOCS3 and alpha-tubulin was assessed by Western blot in muscle biopsies obtained from the m. vastus lateralis in thirty-four men (age = 27.1±6.8 yr) and thirty-three women (age = 26.7±6.7 yr). Basal serum insulin concentration and HOMA were similar in both genders. Serum leptin concentration was 3.4 times higher in women compared to men (P<0.05) and this difference remained significant after accounting for the differences in percentage of body fat or soluble leptin receptor. OB-R protein was 41% (OB-R170, P<0.05) and 163% (OB-R128, P<0.05) greater in women than men. There was no relationship between OB-R expression and the serum concentrations of leptin or 17β-estradiol. In men, muscle OB-R128 protein was inversely related to serum free testosterone. In women, OB-R98 and OB-R128 were inversely related to total serum testosterone concentration, and OB-R128 to serum free testosterone concentration. SOCS3 protein expression was similar in men and women and was not related to OB-R. In women, there was an inverse relationship between the logarithm of free testosterone and SCOS3 protein content in skeletal muscle (r = −0.46, P<0.05). In summary, there is a gender dimorphism in skeletal muscle leptin receptors expression, which can be partly explained by the influence of testosterone. SOCS3 expression in skeletal muscle is not up-regulated in women, despite very high serum leptin concentrations compared to men. The circulating form of the leptin receptor can not be used as a surrogate measure of the amount of leptin receptors expressed in skeletal muscles. PMID:18941624

Aquatic Habitat Studies on the Lower Mississippi River, River Mile 480 to 530. Report 1. Introduction.

DTIC Science & Technology

1981-03-01

allidlllIiml-llaatl Ila 1,I1 1 It s Kud kes (I like f II s , iiit cvet I el htitksI i ri tte l(ir HlI,i ss 5I pp IP ki I ;IwIti it ob)c t ti ves...vegetated with mixed lowland trees, shrubs, and grasses. At its deepest point Lake Port was 17 ft deep; the upper one- third consisted of a shallow mud flat...Arkansas, and Washington County, Mississippi. Lake Lee was about 6 miles long, shallow at both ends, and up to 40 ft deep in the center two- thirds

An Analysis of the Impact of Outward Bound on Twelve High Schools.

ERIC Educational Resources Information Center

Schulze, Joseph R.

Describing and analyzing the impact of Outward Bound (OB) programs on 12 high schools which reflect OB involvement varying from 1 to 5 years and include urban, suburban, and rural (public, private, boarding, and day) schools, this 1970-71 report is aimed at furthering OB philosophy and method. The report presents OB program: background; evaluation…

Complete Genome Sequence of Escherichia coli Strain M8, Isolated from ob/ob Mice

PubMed Central

Siddharth, Jay; Membrez, Mathieu; Chakrabarti, Anirikh; Betrisey, Bertrand; Chou, Chieh Jason

2017-01-01

ABSTRACT Escherichia coli is one of the common inhabitants of the mammalian gastrointestinal track. We isolated a strain from an ob/ob mouse and performed whole-genome sequencing, which yielded a chromosome of ~5.1 Mb and three plasmids of ~160 kb, ~6 kb, and ~4 kb. PMID:28572322

The effect of spaceflight on mouse olfactory bulb volume, neurogenesis, and cell death indicates the protective effect of novel environment.

PubMed

Latchney, Sarah E; Rivera, Phillip D; Mao, Xiao W; Ferguson, Virginia L; Bateman, Ted A; Stodieck, Louis S; Nelson, Gregory A; Eisch, Amelia J

2014-06-15

Space missions necessitate physiological and psychological adaptations to environmental factors not present on Earth, some of which present significant risks for the central nervous system (CNS) of crewmembers. One CNS region of interest is the adult olfactory bulb (OB), as OB structure and function are sensitive to environmental- and experience-induced regulation. It is currently unknown how the OB is altered by spaceflight. In this study, we evaluated OB volume and neurogenesis in mice shortly after a 13-day flight on Space Shuttle Atlantis [Space Transport System (STS)-135] relative to two groups of control mice maintained on Earth. Mice housed on Earth in animal enclosure modules that mimicked the conditions onboard STS-135 (AEM-Ground mice) had greater OB volume relative to mice maintained in standard housing on Earth (Vivarium mice), particularly in the granule (GCL) and glomerular (GL) cell layers. AEM-Ground mice also had more OB neuroblasts and fewer apoptotic cells relative to Vivarium mice. However, the AEM-induced increase in OB volume and neurogenesis was not seen in STS-135 mice (AEM-Flight mice), suggesting that spaceflight may have negated the positive effects of the AEM. In fact, when OB volume of AEM-Flight mice was considered, there was a greater density of apoptotic cells relative to AEM-Ground mice. Our findings suggest that factors present during spaceflight have opposing effects on OB size and neurogenesis, and provide insight into potential strategies to preserve OB structure and function during future space missions. Copyright © 2014 the American Physiological Society.

G Protein–Coupled Receptor Kinase 2, With β-Arrestin 2, Impairs Insulin-Induced Akt/Endothelial Nitric Oxide Synthase Signaling in ob/ob Mouse Aorta

PubMed Central

Taguchi, Kumiko; Matsumoto, Takayuki; Kamata, Katsuo; Kobayashi, Tsuneo

2012-01-01

In type 2 diabetes, impaired insulin-induced Akt/endothelial nitric oxide synthase (eNOS) signaling may decrease the vascular relaxation response. Previously, we reported that this response was negatively regulated by G protein–coupled receptor kinase 2 (GRK2). In this study, we investigated whether/how in aortas from ob/ob mice (a model of type 2 diabetes) GRK2 and β-arrestin 2 might regulate insulin-induced signaling. Endothelium-dependent relaxation was measured in aortic strips. GRK2, β-arrestin 2, and Akt/eNOS signaling pathway proteins and activities were mainly assayed by Western blotting. In ob/ob (vs. control [Lean]) aortas: 1) insulin-induced relaxation was reduced, and this deficit was prevented by GRK2 inhibitor, anti-GRK2 antibody, and an siRNA specifically targeting GRK2. The Lean aorta relaxation response was reduced to the ob/ob level by pretreatment with an siRNA targeting β-arrestin 2. 2) Insulin-stimulated Akt and eNOS phosphorylations were decreased. 3) GRK2 expression in membranes was elevated, and, upon insulin stimulation, this expression was further increased, but β-arrestin 2 was decreased. In ob/ob aortic membranes under insulin stimulation, the phosphorylations of Akt and eNOS were augmented by GRK2 inhibitor. In mouse aorta, GRK2 may be, upon translocation, a key negative regulator of insulin responsiveness and an important regulator of the β-arrestin 2/Akt/eNOS signaling, which is implicated in diabetic endothelial dysfunction. PMID:22688330

G protein-coupled receptor kinase 2, with β-arrestin 2, impairs insulin-induced Akt/endothelial nitric oxide synthase signaling in ob/ob mouse aorta.

PubMed

Taguchi, Kumiko; Matsumoto, Takayuki; Kamata, Katsuo; Kobayashi, Tsuneo

2012-08-01

In type 2 diabetes, impaired insulin-induced Akt/endothelial nitric oxide synthase (eNOS) signaling may decrease the vascular relaxation response. Previously, we reported that this response was negatively regulated by G protein-coupled receptor kinase 2 (GRK2). In this study, we investigated whether/how in aortas from ob/ob mice (a model of type 2 diabetes) GRK2 and β-arrestin 2 might regulate insulin-induced signaling. Endothelium-dependent relaxation was measured in aortic strips. GRK2, β-arrestin 2, and Akt/eNOS signaling pathway proteins and activities were mainly assayed by Western blotting. In ob/ob (vs. control [Lean]) aortas: 1) insulin-induced relaxation was reduced, and this deficit was prevented by GRK2 inhibitor, anti-GRK2 antibody, and an siRNA specifically targeting GRK2. The Lean aorta relaxation response was reduced to the ob/ob level by pretreatment with an siRNA targeting β-arrestin 2. 2) Insulin-stimulated Akt and eNOS phosphorylations were decreased. 3) GRK2 expression in membranes was elevated, and, upon insulin stimulation, this expression was further increased, but β-arrestin 2 was decreased. In ob/ob aortic membranes under insulin stimulation, the phosphorylations of Akt and eNOS were augmented by GRK2 inhibitor. In mouse aorta, GRK2 may be, upon translocation, a key negative regulator of insulin responsiveness and an important regulator of the β-arrestin 2/Akt/eNOS signaling, which is implicated in diabetic endothelial dysfunction.

Remarkably efficient production of a highly insecticidal Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV) isolate in its homologous host.

PubMed

Bernal, Alexandra; Simón, Oihane; Williams, Trevor; Muñoz, Delia; Caballero, Primitivo

2018-01-03

A Chrysodeixis chalcites nucleopolyhedrovirus from the Canary Islands (ChchNPV-TF1) has proved to be effective for control of Chrysodeixis chalcites on banana crops. Commercialization of this virus as a bioinsecticide requires an efficient production system. The sixth instar (L 6 ) was the most suitable for virus production, producing 1.80 × 10 11 occlusion bodies (OB)/larva and showed a lower prevalence of cannibalism (5.4%) than fourth (L 4 ) or fifth (L 5 ) instars. Inoculation of L 6 at 24 h post molting produced six times more OB (5.72 × 10 11 OB/larva) than recently molted L 6 larvae (1.00 × 10 11 OB/larva). No significant differences were recorded in mean time to death (165-175 h) or OB production per larva (3.75 × 10 11 to 5.97 × 10 11 ) or per mg larval weight (1.30 × 10 11 to 2.11 × 10 9 ), in larvae inoculated with a range of inoculum concentrations (LC 50 -LC 90 ). Groups of infected L 6 larvae reared at a density of 150 larvae/container produced a greater total number of OBs (8.07 × 10 13 OB/container) than lower densities (25, 50 and 100 OB/container), and a similar number to containers with 200 inoculated larvae (8.43 × 10 13 OB/container). The processes described here allow efficient production of sufficient OBs to treat ∼ 40 ha of banana crops using the insects from a single container. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

Autophagy in osteoblasts is involved in mineralization and bone homeostasis

PubMed Central

Nollet, Marie; Santucci-Darmanin, Sabine; Breuil, Véronique; Al-Sahlanee, Rasha; Cros, Chantal; Topi, Majlinda; Momier, David; Samson, Michel; Pagnotta, Sophie; Cailleteau, Laurence; Battaglia, Séverine; Farlay, Delphine; Dacquin, Romain; Barois, Nicolas; Jurdic, Pierre; Boivin, Georges; Heymann, Dominique; Lafont, Frank; Lu, Shi Shou; Dempster, David W; Carle, Georges F; Pierrefite-Carle, Valérie

2014-01-01

Bone remodeling is a tightly controlled mechanism in which osteoblasts (OB), the cells responsible for bone formation, osteoclasts (OC), the cells specialized for bone resorption, and osteocytes, the multifunctional mechanosensing cells embedded in the bone matrix, are the main actors. Increased oxidative stress in OB, the cells producing and mineralizing bone matrix, has been associated with osteoporosis development but the role of autophagy in OB has not yet been addressed. This is the goal of the present study. We first show that the autophagic process is induced in OB during mineralization. Then, using knockdown of autophagy-essential genes and OB-specific autophagy-deficient mice, we demonstrate that autophagy deficiency reduces mineralization capacity. Moreover, our data suggest that autophagic vacuoles could be used as vehicles in OB to secrete apatite crystals. In addition, autophagy-deficient OB exhibit increased oxidative stress and secretion of the receptor activator of NFKB1 (TNFSF11/RANKL), favoring generation of OC, the cells specialized in bone resorption. In vivo, we observed a 50% reduction in trabecular bone mass in OB-specific autophagy-deficient mice. Taken together, our results show for the first time that autophagy in OB is involved both in the mineralization process and in bone homeostasis. These findings are of importance for mineralized tissues which extend from corals to vertebrates and uncover new therapeutic targets for calcified tissue-related metabolic pathologies. PMID:25484092

Effect of Caloric Restriction and AMPK Activation on Hepatic Nuclear Receptor, Biotransformation Enzyme, and Transporter Expression in Lean and Obese Mice

PubMed Central

Kulkarni, Supriya R.; Xu, Jialin; Donepudi, Ajay C.; Wei, Wei

2014-01-01

Purpose Fatty liver alters liver transporter expression. Caloric restriction (CR), the recommended therapy to reverse fatty liver, increases Sirtuin1 deacetylase activity in liver. This study evaluated whether CR and CR mimetics reversed obesity-induced transporter expression in liver and hepatocytes. Methods mRNA and protein expression was determined in adult lean (lean) and leptin-deficient obese (OB) mice fed ad libitum or placed on 40% (kCal) reduced diet. Hepatocytes were isolated from lean and OB mice, treated with AMP Kinase activators, and gene expression was determined. Results CR decreased Oatp1a1, Oatp1b2, and Abcb11 mRNA expression in lean, but not OB mice. CR increased Abcc2 mRNA OB livers, whereas protein expression increased in both genotypes. CR increased Abcc3 protein expression increased in OB livers. CR did not alter Abcc1, 4 and 5 mRNA expression in lean mice but decreased expression in livers of OB mice. CR increased Abcc4 protein in lean, but not OB mice. Conclusions CR restriction reversed the expression of some, but not all transporters in livers of OB mice. Overall, these data indicate a potential for CR to restore some hepatic transporter changes in OB mice, but suggest a functional leptin axis is needed for reversal of expression for some transporters. PMID:23949303

Effects of bleach activator, sodium alkyl acyloxybenzene sulfonate, on house dust mites (Dermatophagoides farinae).

PubMed

Tobe, Seiichi; Kamezaki, Hiroki; Watanabe, Toshiyuki; Takaoka, Hiromitsu; Sakaguchi, Masahiro

2010-01-01

House dust mites (Dermatophagoides farinae) in bedding and clothes are a major allergen. However, house dust mites cannot be killed by general washing conditions under 50 degrees C. Therefore, low-temperature washing conditions must be improved to eliminate house dust mites. Sodium alkyl acyloxybenzene sulfonate (OBS) is a bleach activator that is used to intensify the bleaching effects of some laundry products. The purpose of this study was to evaluate the effect of OBS on the elimination of house dust mites in low-temperature washing conditions. D. farinae was soaked in solutions containing different types of OBS for various durations and at various temperatures. The miticidal effects of the various washing conditions were also evaluated for D. farinae. Then sodium lauroyloxybenzene sulfonate (OBS-12) produced the highest D. farinae mortality rate among the OBS solutions that were examined and had a stronger miticidal effect than available chlorine under general washing conditions. OBS exhibited miticidal effects under general washing conditions at low temperatures. Since OBS is already used as an additive in some laundry products to increase the bleaching activity, OBS can be easily used to kill house dust mites under general washing conditions.

Identification of the Relationship between Oil Body Morphology and Oil Content by Microstructure Comparison Combining with QTL Analysis in Brassica napus

PubMed Central

Gu, Jianwei; Chao, Hongbo; Wang, Hao; Li, Yonghong; Li, Dianrong; Xiang, Jun; Gan, Jianping; Lu, Guangyuan; Zhang, Xuekun; Long, Yan; Li, Maoteng

2017-01-01

Oil bodies (OBs) are relatively simple but very important organelles comprising a matrix of triacylglycerol (TAG) surrounded by a phospholipid monolayer embedded and covered with unique proteins. The OB structure in Brassica napus with different oil content and the relationship between the oil content and the OB structure needs to be better understood. In this paper, the characteristics of OBs in the embryo of a series of B. napus materials with different oil content ranging from 34% to over 60% were studied. The results indicated that the OB size was significantly positively correlated with the oil content but was significantly negatively correlated with the glucosinolates and the protein content. Many genes associated with TAG synthesis, OB-membrane proteins, and the cell progress regulatory pathway were identified in the confidence interval of co-located QTLs for oil content, fatty acid (FA) compositions, and protein content. Our results suggested that the morphology of OBs might be directly controlled by the genes associated with OB-membrane proteins and indirectly controlled by the genes associated with TAG synthesis and cell progress regulatory pathway. PMID:28111582

Identification of the Relationship between Oil Body Morphology and Oil Content by Microstructure Comparison Combining with QTL Analysis in Brassica napus.

PubMed

Gu, Jianwei; Chao, Hongbo; Wang, Hao; Li, Yonghong; Li, Dianrong; Xiang, Jun; Gan, Jianping; Lu, Guangyuan; Zhang, Xuekun; Long, Yan; Li, Maoteng

2016-01-01

Oil bodies (OBs) are relatively simple but very important organelles comprising a matrix of triacylglycerol (TAG) surrounded by a phospholipid monolayer embedded and covered with unique proteins. The OB structure in Brassica napus with different oil content and the relationship between the oil content and the OB structure needs to be better understood. In this paper, the characteristics of OBs in the embryo of a series of B. napus materials with different oil content ranging from 34% to over 60% were studied. The results indicated that the OB size was significantly positively correlated with the oil content but was significantly negatively correlated with the glucosinolates and the protein content. Many genes associated with TAG synthesis, OB-membrane proteins, and the cell progress regulatory pathway were identified in the confidence interval of co-located QTLs for oil content, fatty acid (FA) compositions, and protein content. Our results suggested that the morphology of OBs might be directly controlled by the genes associated with OB-membrane proteins and indirectly controlled by the genes associated with TAG synthesis and cell progress regulatory pathway.

Oil body proteins sequentially accumulate throughout seed development in Brassica napus.

PubMed

Jolivet, Pascale; Boulard, Céline; Bellamy, Annick; Valot, Benoît; d'Andréa, Sabine; Zivy, Michel; Nesi, Nathalie; Chardot, Thierry

2011-11-15

Despite the importance of seed oil bodies (OBs) as enclosed compartments for oil storage, little is known about lipid and protein accumulation in OBs during seed formation. OBs from rapeseed (Brassica napus) consist of a triacylglycerol (TAG) core surrounded by a phospholipid monolayer embedded with integral proteins which confer high stability to OBs in the mature dry seed. In the present study, we investigated lipid and protein accumulation patterns throughout seed development (from 5 to 65 days after pollination [DAP]) both in the whole seed and in purified OBs. Deposition of the major proteins (oleosins, caleosins and steroleosins) into OBs was assessed through (i) gene expression pattern, (ii) proteomics analysis, and (iii) protein immunodetection. For the first time, a sequential deposition of integral OB proteins was established. Accumulation of oleosins and caleosins was observed starting from early stages of seed development (12-17 DAP), while steroleosins accumulated later (~25 DAP) onwards. Copyright © 2011 Elsevier GmbH. All rights reserved.

The Puppis region and the last crusade for faint OB stars

NASA Astrophysics Data System (ADS)

Orsatti, Ana M.

1992-08-01

UBV photoelectric and photographic measurements of OB stars from a list of 397 OB stars and 5 early-type supergiants and from the Luminous Stars Survey are presented. The galactic distribution of the OB stars in the region shows concentrations around the open clusters Ruprecht 44 and Ruprecht 55, and the presence of an important grouping of young stars located far below the plane. The distribution in latitude shows that young stars in the region are not restricted to a thin sheet around the plane but are spread over negative latitudes reaching at least b = -5 deg. In longitude, the OB distribution exhibits a concentration of Ob stars in the interval 244-251 deg; this is argued to be due to the presence of the local arm extension.

What is an Obstetrics/Gynecology Hospitalist?

PubMed

McCue, Brigid

2015-09-01

The obstetrics/gynecology (OB/GYN) hospitalist is the latest subspecialist to evolve from obstetrics and gynecology. Starting in 2002, academic leaders recognized the impact of such coalescing forces as the pressure to reduce maternal morbidity and mortality, stagnant reimbursements and the increasing cost of private practice, the decrease in applications for OB/GYN residencies, and the demand among practicing OB/GYNs for work/life balance. Initially coined laborist, the concept of the OB/GYN hospitalist emerged. Thinking of becoming an OB/GYN hospitalist? Here is what you need to know. Copyright © 2015 Elsevier Inc. All rights reserved.

In obese mice, exercise training increases 11β-HSD1 expression, contributing to glucocorticoid activation and suppression of pulmonary inflammation.

PubMed

Du, Shu-Fang; Yu, Qing; Chuan, Kai; Ye, Chang-Lin; He, Ze-Jia; Liu, Shu-Juan; Zhu, Xiao-Yan; Liu, Yu-Jian

2017-10-01

Exercise training is advocated for treating chronic inflammation and obesity-related metabolic syndromes. Glucocorticoids (GCs), the anti-inflammatory hormones, are synthesized or metabolized in extra-adrenal organs. This study aims to examine whether exercise training affects obesity-associated pulmonary inflammation by regulating local GC synthesis or metabolism. We found that sedentary obese ( ob/ob ) mice exhibited increased levels of interleukin (IL)-1β, IL-18, monocyte chemotactic protein (MCP)-1, and leukocyte infiltration in lung tissues compared with lean mice, which was alleviated by 6 wk of exercise training. Pulmonary corticosterone levels were decreased in ob/ob mice. Exercise training increased pulmonary corticosterone levels in both lean and ob/ob mice. Pulmonary corticosterone levels were negatively correlated with IL-1β, IL-18, and MCP-1. Immunohistochemical staining of the adult mouse lung sections revealed positive immunoreactivities for the steroidogenic acute regulatory protein, the cholesterol side-chain cleavage enzyme (CYP11A1), the steroid 21-hydroxylase (CYP21), 3β-hydroxysteroid dehydrogenase (3β-HSD), and type 1 and type 2 11β-hydroxysteroid dehydrogenase (11β-HSD) but not for 11β-hydroxylase (CYP11B1). Exercise training significantly increased pulmonary 11β-HSD1 expression in both lean and ob/ob mice. In contrast, exercise training per se had no effect on pulmonary 11β-HSD2 expression, although pulmonary 11β-HSD2 levels in ob/ob mice were significantly higher than in lean mice. RU486, a glucocorticoid receptor antagonist, blocked the anti-inflammatory effects of exercise training in lung tissues of obese mice and increased inflammatory cytokines in lean exercised mice. These findings indicate that exercise training increases pulmonary expression of 11β-HSD1, thus contributing to local GC activation and suppression of pulmonary inflammation in obese mice. NEW & NOTEWORTHY Treadmill training leads to a significant increase in pulmonary corticosterone levels in ob/ob mice, which is in parallel with the favorable effects of exercise on obesity-associated pulmonary inflammation. Exercise training increases pulmonary 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1) expression but has no significant effect on 11β-HSD2 expression in both lean and ob/ob mice. These findings indicate that exercise training increases pulmonary expression of 11β-HSD1, thus contributing to local glucocorticoid activation and suppression of pulmonary inflammation in obese mice. Copyright © 2017 the American Physiological Society.

A Characterization of Movement Skills in Obese Children with and without Prader-Willi Syndrome

ERIC Educational Resources Information Center

Lam, Melanie Y.; Rubin, Daniela A.; Duran, Andrea T.; Chavoya, Frank A.; White, Elizabeth; Rose, Debra J.

2016-01-01

Purpose: The aim of this study was twofold: (a) to measure and compare motor proficiency in obese children with Prader-Willi syndrome (OB-PWS) to that in obese children without PWS (OB), and (b) to compare motor proficiency in OB-PWS and OB to normative data. Method: Motor proficiency was measured using the Bruininks-Oseretsky Test of Motor…

Comparative genomic insights into ecophysiology of neutrophilic, microaerophilic iron oxidizing bacteria

DOE PAGES

Kato, Shingo; Ohkuma, Moriya; Powell, Deborah H.; ...

2015-11-13

Neutrophilic microaerophilic iron-oxidizing bacteria (FeOB) are thought to play a significant role in cycling of carbon, iron and associated elements in both freshwater and marine iron-rich environments. However, the roles of the neutrophilic microaerophilic FeOB are still poorly understood due largely to the difficulty of cultivation and lack of functional gene markers. Here, we analyze the genomes of two freshwater neutrophilic microaerophilic stalk-forming FeOB, Ferriphaselus amnicola OYT1 and Ferriphaselus strain R-1. Phylogenetic analyses confirm that these are distinct species within Betaproteobacteria; we describe strain R-1 and propose the name F. globulitus. We compare the genomes to those of two freshwatermore » Betaproteobacterial and three marine Zetaproteobacterial FeOB isolates in order to look for mechanisms common to all FeOB, or just stalk-forming FeOB. The OYT1 and R-1 genomes both contain homologs to cyc2, which encodes a protein that has been shown to oxidize Fe in the acidophilic FeOB, Acidithiobacillus ferrooxidans. This c-type cytochrome common to all seven microaerophilic FeOB isolates, strengthening the case for its common utility in the Fe oxidation pathway. In contrast, the OYT1 and R-1 genomes lack mto genes found in other freshwater FeOB. OYT1 and R-1 both have genes that suggest they can oxidize sulfur species. Both have the genes necessary to fix carbon by the Calvin–Benson– Basshom pathway, while only OYT1 has the genes necessary to fix nitrogen. The stalk-forming FeOB share xag genes that may help form the polysaccharide structure of stalks. Both OYT1 and R-1 make a novel biomineralization structure, short rod-shaped Fe oxyhydroxides much smaller than their stalks; these oxides are constantly shed, and may be a vector for C, P, and metal transport to downstream environments. Lastly, our results show that while different FeOB are adapted to particular niches, freshwater and marine FeOB likely share common mechanisms for Fe oxidation electron transport and biomineralization pathways.« less

Modulation of insulin-like growth factor 1 levels in human osteoarthritic subchondral bone osteoblasts.

PubMed

Massicotte, Frédéric; Fernandes, Julio Cesar; Martel-Pelletier, Johanne; Pelletier, Jean-Pierre; Lajeunesse, Daniel

2006-03-01

Human osteoarthritis (OA) is characterized by cartilage loss, bone sclerosis, osteophyte formation and inflammation of the synovial membrane. We previously reported that OA osteoblasts (Ob) show abnormal phenotypic characteristics possibly responsible for bone sclerosis and that two subgroups of OA patients can be identified by low or high endogenous production of prostaglandin E2 (PGE2) by OA Ob. Here, we determined that the elevated PGE2 levels in the high OA subgroup were linked with enhanced cyclooxygenase-2 (COX-2) protein levels compared to normal and low OA Ob. A linear relationship was observed between endogenous PGE2 levels and insulin-like growth factor 1 (IGF-1) levels in OA Ob. As parathyroid hormone (PTH) and PGE2 are known stimulators of IGF-1 production in Ob, we next evaluated their effect in OA Ob. Both subgroups increased their IGF-1 production similarly in response to PGE2, while the high OA subgroup showed a blunted response to PTH compared to the low OA group. Conversely, only the high OA group showed a significant inhibition of IGF-1 production when PGE2 synthesis was reduced with Naproxen, a non-steroidal antiinflammatory drug (NSAID) that inhibits cyclooxygenases (COX). The PGE2-dependent stimulation of IGF-1 synthesis was due in part to the cAMP/protein kinase A pathway since both the direct inhibition of this pathway with H-89 and the inhibition of EP2 or EP4 receptors, linked to cAMP production, reduced IGF-1 synthesis. The production of the most abundant IGF-1 binding proteins (IGFBPs) in bone tissue, IGFBP-3, -4, and -5, was lower in OA compared to normal Ob independently of the OA group. Under basal condition, OA Ob expressed similar IGF-1 mRNA to normal Ob; however, PGE2 stimulated IGF-1 mRNA expression more in OA than normal Ob. These data suggest that increased IGF-1 levels correlate with elevated endogenous PGE2 levels in OA Ob and that higher IGF-1 levels in OA Ob could be important for bone sclerosis in OA.

Effect of hypothalamic electrolytic lesions in White Leghorn and broiler male cockerels.

PubMed

Arnon, E; Snapir, N; Robinzon, B; Heiblum, R

2004-06-01

1. This study compared the effect of bilateral electrolytic lesions of the basomedial hypothalamus (HL) in broiler and White Leghorn (WL) males. 2. Hypothalamic lesions were placed in WL at 10 weeks of age (body weight 1.1 kg) and in broilers, either at 6 weeks (body weight 1.5kg) or at 10 weeks of age (body weight 3.4kg). They were fed ad libitum until autopsy at 16 and 17 weeks of age for broilers and WL, respectively. 3. Hypothalamic lesions caused obesity (high percentage weight of abdominal adipose tissue) in both strains. Obese fowls with unimpaired reproductive systems were classified as OB and those with functional castration as FC (functionally castrated) or FCLC (functionally castrated with large comb). 4. All post-HL syndromes-OB, FC and FCLC-were present in WL, whereas all obese broilers (which are immature at this age) were classified as OB. 5. The percentage weight of abdominal adipose tissue in OB broilers was lower than in OB WL (3% vs 5%, respectively). 6. Daily food intake of OB broilers was higher than control at 12 to 15 weeks of age, regardless of time of placement of HL, whereas daily food intake of OB WL was significantly higher than that of control WL only during the first 2 weeks following HL. 7. Body weight of OB broilers at autopsy was 20% higher than control broilers, whereas body weight of OB WL was not significantly affected. 8. An additional group of broilers was reared to sexual maturity under food restriction until 28 weeks of age. HL were placed at 10 weeks of age (body weight 1.7 kg). Autopsy was performed after a 4-week period of ad libitum feeding. 9. There were OB as well as FC and FCLC among the HL, food-restricted broilers. Percentage weight of testes and spleen were reduced in OB fowls of both strains, but more so in OB WL. 10. Hyperphagia and weight gain were not observed during the ad libitum feeding period of those obese broilers after HL, indicating that hyperphagia and weight gain are secondary to obesity.

Functional imaging of cortical feedback projections to the olfactory bulb

PubMed Central

Rothermel, Markus; Wachowiak, Matt

2014-01-01

Processing of sensory information is substantially shaped by centrifugal, or feedback, projections from higher cortical areas, yet the functional properties of these projections are poorly characterized. Here, we used genetically-encoded calcium sensors (GCaMPs) to functionally image activation of centrifugal projections targeting the olfactory bulb (OB). The OB receives massive centrifugal input from cortical areas but there has been as yet no characterization of their activity in vivo. We focused on projections to the OB from the anterior olfactory nucleus (AON), a major source of cortical feedback to the OB. We expressed GCaMP selectively in AON projection neurons using a mouse line expressing Cre recombinase (Cre) in these neurons and Cre-dependent viral vectors injected into AON, allowing us to image GCaMP fluorescence signals from their axon terminals in the OB. Electrical stimulation of AON evoked large fluorescence signals that could be imaged from the dorsal OB surface in vivo. Surprisingly, odorants also evoked large signals that were transient and coupled to odorant inhalation both in the anesthetized and awake mouse, suggesting that feedback from AON to the OB is rapid and robust across different brain states. The strength of AON feedback signals increased during wakefulness, suggesting a state-dependent modulation of cortical feedback to the OB. Two-photon GCaMP imaging revealed that different odorants activated different subsets of centrifugal AON axons and could elicit both excitation and suppression in different axons, indicating a surprising richness in the representation of odor information by cortical feedback to the OB. Finally, we found that activating neuromodulatory centers such as basal forebrain drove AON inputs to the OB independent of odorant stimulation. Our results point to the AON as a multifunctional cortical area that provides ongoing feedback to the OB and also serves as a descending relay for other neuromodulatory systems. PMID:25071454

Clinical Variability in Cardiovascular Disease Risk Factor Screening and Management in Adolescent and Young Adult Women with Polycystic Ovary Syndrome.

PubMed

Baer, Tamara E; Milliren, Carly E; Walls, Courtney; DiVasta, Amy D

2015-10-01

To review the clinical presentation, evaluation, and management of normal-weight (NW), overweight (OW), and obese (OB) adolescent and young adult women with polycystic ovary syndrome (PCOS) during a 2-year follow-up. Retrospective chart review. One hundred seventy-three adolescent and young adult women, aged 12-22 years, diagnosed with PCOS. Demographic, health data, and laboratory measures were abstracted from 3 clinic visits: baseline and 1- and 2-year follow-up. Subjects were classified as NW, OW, or OB. Longitudinal data were analyzed using repeated-measures analysis of variance. Body mass index, self-reported concerns, and lifestyle changes. Most patients (73%) were OW or OB. Family history of type 2 diabetes was greater in OW (38%) and OB (53%) patients compared with NW (22%) patients (P = .002). Acanthosis nigricans was identified in OW (62%) and OB (21%) patients but not in NW patients (0%; P < .001). OW and OB patients had higher fasting insulin (P < .001) and lower high-density lipoprotein cholesterol (P = .005) levels than NW patients, although screening rates were low. Body mass index Z-scores decreased in both OW and OB patients over time (0.07 unit/yr, P < .001). Most patients with PCOS were OW or OB. Substantial clinical variability existed in cardiovascular disease (CVD) screening; among those screened, OW and OB patients had greater CVD risk factors. Despite self-reported concerns about weight and diabetes risk among OW and OB patients, no clinically significant change in body mass index percentile occurred. Evidence-based interventions and recommendations for screening tests are needed to address CVD risk in adolescents and young adults with PCOS. Copyright © 2015 North American Society for Pediatric and Adolescent Gynecology. Published by Elsevier Inc. All rights reserved.

Tumour necrosis factor-α inhibition with lenalidomide alleviates tissue oxidative injury and apoptosis in ob/ob obese mice.

PubMed

Zhu, Xiaoling; Jiang, Shasha; Hu, Nan; Luo, Fuling; Dong, Hailong; Kang, Yu-Ming; Jones, Kyla R; Zou, Yunzeng; Xiong, Lize; Ren, Jun

2014-07-01

Lenalidomide (Revlimid; Selleck Chemicals, Houston, TX, USA), an analogue of thalidomide, possesses potent cytokine modulatory capacity through inhibition of cytokines such as tumour necrosis factor (TNF)-α, a cytokine pivotal for the onset and development of complications in obesity and diabetes mellitus. The present study was designed to evaluate the effect of lenalidomide on oxidative stress, protein and DNA damage in multiple organs in an ob/ob murine model of obesity. To this end, C57BL/6 lean and ob/ob obese mice were administered lenalidomide (50 mg/kg per day, p.o.) for 5 days. Oxidative stress, protein and DNA damage were assessed using the conversion of reduced glutathione (GSH) to oxidized glutathione (GSSG), carbonyl formation and Comet assay, respectively. Apoptosis was evaluated using caspase 3 activity, and levels of Bax, Bcl-2, Bip, caspase 8, caspase 9 and TNF-α were assessed using western blot analysis. Lenalidomide treatment did not affect glucose clearance in lean or ob/ob mice. Obese mice exhibited a reduced GSH/GSSG ratio in the liver, gastrocnemius skeletal muscle and small intestine, as well as enhanced protein carbonyl formation, DNA damage and caspase 3 activity in the liver, kidney, skeletal muscle and intestine; these effects were alleviated by lenalidomide, with the exception of obesity-associated DNA damage in the liver and kidney. Western blot analysis revealed elevated TNF-α, Bax, Bcl-2, Bip, caspase 8 and caspase 9 in ob/ob mice with various degrees of reversal by lenalidomide treatment. Together, these data indicate that lenalidomide protects against obesity-induced tissue injury and protein damage, possibly in association with antagonism of cytokine production and cytokine-induced apoptosis and oxidative stress. © 2014 Wiley Publishing Asia Pty Ltd.

Determinant Factors in the Production of a Co-Occluded Binary Mixture of Helicoverpa armigera Alphabaculovirus (HearNPV) Genotypes with Desirable Insecticidal Characteristics.

PubMed

Arrizubieta, Maite; Simón, Oihane; Williams, Trevor; Caballero, Primitivo

2016-01-01

A co-occluded binary mixture of Helicoverpa armigera nucleopolyhedrovirus genotypes HearSP1B and HearLB6 at a 1:1 ratio (HearSP1B+HearLB6) was selected for the development of a virus-based biological insecticide, which requires an efficient large-scale production system. In vivo production systems require optimization studies in each host-virus pathosystem. In the present study, the effects of larval instar, rearing density, timing of inoculation, inoculum concentration and temperature on the production of HearSP1B+HearLB6 in its homologous host were evaluated. The high prevalence of cannibalism in infected larvae (40-87%) indicated that insects require individual rearing to avoid major losses in OB production. The OB production of recently molted fifth instars (7.0 x 109 OBs/larva), combined with a high prevalence of mortality (85.7%), resulted in the highest overall OB yield (6.0 x 1011 OBs/100 inoculated larvae), compared to those of third or fourth instars. However, as inoculum concentration did not influence final OB yield, the lowest concentration, LC80 (5.5 x 106 OBs/ml), was selected. Incubation temperature did not significantly influence OB yield, although larvae maintained at 30°C died 13 and 34 hours earlier than those incubated at 26°C and 23°C, respectively. We conclude that the efficient production of HearSP1B+HearLB6 OBs involves inoculation of recently molted fifth instars with a LC80 concentration of OBs followed by individual rearing at 30°C.

Obesity-metabolic derangement exacerbates cardiomyocyte loss distal to moderate coronary artery stenosis in pigs without affecting global cardiac function.

PubMed

Li, Zi-Lun; Ebrahimi, Behzad; Zhang, Xin; Eirin, Alfonso; Woollard, John R; Tang, Hui; Lerman, Amir; Wang, Shen-Ming; Lerman, Lilach O

2014-04-01

Obesity associated with metabolic derangements (ObM) worsens the prognosis of patients with coronary artery stenosis (CAS), but the underlying cardiac pathophysiologic mechanisms remain elusive. We tested the hypothesis that ObM exacerbates cardiomyocyte loss distal to moderate CAS. Obesity-prone pigs were randomized to four groups (n = 6 each): lean-sham, ObM-sham, lean-CAS, and ObM-CAS. Lean and ObM pigs were maintained on a 12-wk standard or atherogenic diet, respectively, and left circumflex CAS was then induced by placing local-irritant coils. Cardiac structure, function, and myocardial oxygenation were assessed 4 wk later by computed-tomography and blood oxygenation level dependent (BOLD) MRI, the microcirculation with micro-computed-tomography, and injury mechanisms by immunoblotting and histology. ObM pigs showed obesity, dyslipidemia, and insulin resistance. The degree of CAS (range, 50-70%) was similar in lean and ObM pigs, and resting myocardial perfusion and global cardiac function remained unchanged. Increased angiogenesis distal to the moderate CAS observed in lean was attenuated in ObM pigs, which also showed microvascular dysfunction and increased inflammation (M1-macrophages, TNF-α expression), oxidative stress (gp91), hypoxia (BOLD-MRI), and fibrosis (Sirius-red and trichrome). Furthermore, lean-CAS showed increased myocardial autophagy, which was blunted in ObM pigs (downregulated expression of unc-51-like kinase-1 and autophagy-related gene-12; P < 0.05 vs. lean CAS) and associated with marked apoptosis. The interaction diet xstenosis synergistically inhibited angiogenic, autophagic, and fibrogenic activities. ObM exacerbates structural and functional myocardial injury distal to moderate CAS with preserved myocardial perfusion, possibly due to impaired cardiomyocyte turnover.

A SEARCH FOR STELLAR-MASS BLACK HOLES VIA ASTROMETRIC MICROLENSING

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lu, J. R.; Sinukoff, E.; Ofek, E. O.

While dozens of stellar-mass black holes (BHs) have been discovered in binary systems, isolated BHs have eluded detection. Their presence can be inferred when they lens light from a background star. We attempt to detect the astrometric lensing signatures of three photometrically identified microlensing events, OGLE-2011-BLG-0022, OGLE-2011-BLG-0125, and OGLE-2012-BLG-0169 (OB110022, OB110125, and OB120169), located toward the Galactic Bulge. These events were selected because of their long durations, which statistically favors more massive lenses. Astrometric measurements were made over one to two years using laser-guided adaptive optics observations from the W. M. Keck Observatory. Lens model parameters were first constrained bymore » the photometric light curves. The OB120169 light curve is well fit by a single-lens model, while both OB110022 and OB110125 light curves favor binary lens models. Using the photometric fits as prior information, no significant astrometric lensing signal was detected and all targets were consistent with linear motion. The significant lack of astrometric signal constrains the lens mass of OB110022 to 0.05–1.79 M {sub ⊙} in a 99.7% confidence interval, which disfavors a BH lens. Fits to OB110125 yielded a reduced Einstein crossing time and insufficient observations during the peak, so no mass limits were obtained. Two degenerate solutions exist for OB120169, which have a lens mass between 0.2–38.8 M {sub ⊙} and 0.4–39.8 M {sub ⊙} for a 99.7% confidence interval. Follow-up observations of OB120169 will further constrain the lens mass. Based on our experience, we use simulations to design optimal astrometric observing strategies and show that with more typical observing conditions the detection of BHs is feasible.« less

Kefir improves fatty liver syndrome by inhibiting the lipogenesis pathway in leptin-deficient ob/ob knockout mice.

PubMed

Chen, H-L; Tung, Y-T; Tsai, C-L; Lai, C-W; Lai, Z-L; Tsai, H-C; Lin, Y-L; Wang, C-H; Chen, C-M

2014-09-01

Fatty liver disease is commonly associated with obesity, insulin resistance and diabetes. Severe fatty liver is sometimes accompanied by steatohepatitis and may lead to the development of hepatocellular carcinoma. At present, there is no effective treatment for non-alcoholic fatty liver disease (NAFLD); thus, recent investigations have focused on developing effective therapeutics to treat this condition. This study aimed to evaluate the effects of kefir on the hepatic lipid metabolism of ob/ob mice, which are commonly used to model fatty liver disease. In this study, we used leptin receptor-deficient ob/ob mice as an animal disease model of NAFLD. Six-week-old ob/ob mice were orally administered the dairy product kefir (140 mg kg(-1) of body weight (BW) per day) for 4 weeks. The data demonstrated that kefir improved fatty liver syndrome on BW, energy expenditure and basal metabolic rate by inhibiting serum glutamate oxaloacetate transaminase (GOT) and glutamate pyruvate transaminase (GPT) activities (P<0.05) and by decreasing the triglyceride (TG) and total cholesterol (TC) contents of the liver (P<0.05). Oral kefir administration also significantly reduced the macrovesicular fat quantity in liver tissue. In addition, kefir markedly decreased the expression of the genes sterol regulatory element-binding protein 1 (SREBP1), fatty acid synthase (FAS) and acetyl-CoA carboxylase (ACC) (P<0.05) but not the expression of peroxisome proliferator-activated receptor α (PPARα) or hepatic carnitine palmitoyltransferase-1α (CPT1α) in the livers of ob/ob mice. On the basis of these results, we conclude that kefir improves NAFLD on BW, energy expenditure and basal metabolic rate by inhibiting the lipogenesis pathway and that kefir may have the potential for clinical application to the prevention or treatment of NAFLD.

Oligoclonal bands in patients with multiple myeloma: Its emergence per se could not be translated to improved survival

PubMed Central

Fujisawa, Manabu; Seike, Keisuke; Fukumoto, Kouta; Suehara, Yasuhito; Fukaya, Masafumi; Sugihara, Hiroki; Takeuchi, Masami; Matsue, Kosei

2014-01-01

The emergence of oligoclonal bands (OB) has been reported in patients with multiple myeloma (MM) after stem cell transplantation (SCT) or successful chemotherapy. However, their clinical relevance remains unclear. We reviewed the clinical records of MM patients from January 2006 to May 2014. Treatment response was evaluated by International Working Group (IMWG) criteria. Serum immunofixation tests were performed at least every 3 months if the patient achieved more than very good partial response (VGPR). Free light chain (FLC) and minimal residual disease measurement by multicolor flow cytometry (MFC) were performed to evaluate the response to treatment. Among the 163 patients included in the study, 40 developed OB. Detection rates of OB in patients with complete response (CR), VGPR and partial response (PR) or less were 51.8, 36.3 and 0%, respectively. Patients with OB showed better progression-free survival (PFS) and overall survival (OS) rates than those without OB (P = 0.028 and P < 0.001, respectively). However, if the patients were limited to ≥VGPR or CR, development of OB did not affect PFS (P = 0.621 and P = 0.646, respectively) or OS (P = 0.189 and P = 0.766, respectively). OB was observed in 60% of patients after SCT, and in 36.6% of patients with more than VGPR without SCT (P < 0.001). Patients with OB tended to have less minimal residual disease than those without OB (P = 0.054) and its presence may affect the stringent CR criteria. In conclusion, the emergence of OB was seen exclusively in patients with favorable responses, but its emergence per se could not be translated to improved survival. PMID:25182124

oligoclonal bands in patients with multiple myeloma: its emergence per se could not be translated to improved survival.

PubMed

Fujisawa, Manabu; Seike, Keisuke; Fukumoto, Kouta; Suehara, Yasuhito; Fukaya, Masafumi; Sugihara, Hiroki; Takeuchi, Masami; Matsue, Kosei

2014-11-01

The emergence of oligoclonal bands (OB) has been reported in patients with multiple myeloma (MM) after stem cell transplantation (SCT) or successful chemotherapy. However, their clinical relevance remains unclear. We reviewed the clinical records of MM patients from January 2006 to May 2014. Treatment response was evaluated by International Working Group (IMWG) criteria. Serum immunofixation tests were performed at least every 3 months if the patient achieved more than very good partial response (VGPR). Free light chain (FLC) and minimal residual disease measurement by multicolor flow cytometry (MFC) were performed to evaluate the response to treatment. Among the 163 patients included in the study, 40 developed OB. Detection rates of OB in patients with complete response (CR), VGPR and partial response (PR) or less were 51.8, 36.3 and 0%, respectively. Patients with OB showed better progression-free survival (PFS) and overall survival (OS) rates than those without OB (P = 0.028 and P < 0.001, respectively). However, if the patients were limited to ≥VGPR or CR, development of OB did not affect PFS (P = 0.621 and P = 0.646, respectively) or OS (P = 0.189 and P = 0.766, respectively). OB was observed in 60% of patients after SCT, and in 36.6% of patients with more than VGPR without SCT (P < 0.001). Patients with OB tended to have less minimal residual disease than those without OB (P = 0.054) and its presence may affect the stringent CR criteria. In conclusion, the emergence of OB was seen exclusively in patients with favorable responses, but its emergence per se could not be translated to improved survival. © 2014 The Authors. Cancer Science published by Wiley Publishing Asia Pty Ltd on behalf of Japanese Cancer Association.

Is there altered sensitivity to ghrelin-receptor ligands in leptin-deficient mice?: importance of satiety state and time of day.

PubMed

Finger, Beate C; Schellekens, Harriët; Dinan, Timothy G; Cryan, John F

2011-08-01

Several fine-tuned and interconnected hypothalamic peptidergic systems orchestrate the regulation of energy homeostasis in the body. The orexigenic peptide ghrelin and the anorexigenic peptide leptin are among the most important, and both have been implicated in the development of eating disorders from obesity to anorexia nervosa. The goal of these studies was to examine the response of leptin-deficient ob/ob mice in ghrelin-receptor ligands in a food intake task. Changes in cumulative food intake were measured after peripheral administration of ghrelin (1 and 2 nmol/10 g) and the ghrelin-receptor antagonist (D-Lys(3))-GHRP-6 (66.6 and 133.3 nmol/10 g) in obese and lean control mice during the light and dark cycle as well as in a state of food restriction. Hypothalamic ghrelin and ghrelin-receptor expression was measured in ob/ob and lean mice at two different timepoints. Ghrelin increased food intake in lean and obese mice in the light and dark cycle, whereas the ghrelin-receptor antagonist caused significantly stronger reduction in food intake in obese mice only in the dark cycle. After fasting, ob/ob mice displayed decreased light cycle sensitivity to the anorexigenic effects of the ghrelin-receptor antagonist. Hypothalamic expression levels of ghrelin were unaltered during the light cycle but decreased during the dark cycle in ob/ob mice; whereas, although unchanged in the light cycle, ghrelin-receptor expression was increased in the dark cycle in obese mice. The functionality and sensitivity of the ghrelinergic system is dependent on the time of day and the satiety state in leptin-deficient ob/ob mice.

Impaired steroidogenesis in the testis of leptin-deficient mice (ob/ob -/-).

PubMed

Martins, Fabiane Ferreira; Aguila, Marcia Barbosa; Mandarim-de-Lacerda, Carlos Alberto

2017-06-01

The obesity and its comorbidities, including resistance to leptin, impacts the reproductive function. Testes express leptin receptors in the germ cells and Leydig cells. Then, leptin-deficient animals are obese and infertile. We aimed to evaluate the structure and steroidogenic pathway of the testis of deficient leptin mice. Three months old male C57BL/6 mice (wild-type, WT) and deficient leptin (ob/ob) mice had their testes dissected and prepared for analyses. Compared to the WT group, the ob/ob group showed a greater body mass with smaller testes, and alterations in the germinative epithelium: fewer spermatogonia, spermatocytes, and spermatids. The Sertoli cells and the germ cells showed condensed nuclei and nuclear fragmentation indicating cell death, in agreement with a low expression of the proliferating cell nuclear antigen and a high expression of Caspase3. In the ob/ob group, the sperm was absent in the seminiferous tubules, and the steroidogenic pathway was compromised (low 3Beta hydroxysteroid dehydrogenase and steroidogenic acute regulatory protein). Further, all hormone receptors involved in the testicular function were down expressed (androgen, estrogen, follicle-stimulating, luteinizing, aromatase, and nicotinamide adenine dinucleotide phosphate). In conclusion, the findings indicate significant morphological, hormonal and enzymatic changes in the testis of the ob/ob mice. The shifts in the enzymatic steroidogenic pathway and the enzymes related to spermatic activity support the insights about the failures in the fertility of these animals. The study provides new evidence and contributes to the understanding of how the lack of leptin and obesity might negatively modulate the testicular function leading to infertility. Copyright © 2017 Elsevier GmbH. All rights reserved.

Determinant Factors in the Production of a Co-Occluded Binary Mixture of Helicoverpa armigera Alphabaculovirus (HearNPV) Genotypes with Desirable Insecticidal Characteristics

PubMed Central

Arrizubieta, Maite; Simón, Oihane; Williams, Trevor; Caballero, Primitivo

2016-01-01

A co-occluded binary mixture of Helicoverpa armigera nucleopolyhedrovirus genotypes HearSP1B and HearLB6 at a 1:1 ratio (HearSP1B+HearLB6) was selected for the development of a virus-based biological insecticide, which requires an efficient large-scale production system. In vivo production systems require optimization studies in each host-virus pathosystem. In the present study, the effects of larval instar, rearing density, timing of inoculation, inoculum concentration and temperature on the production of HearSP1B+HearLB6 in its homologous host were evaluated. The high prevalence of cannibalism in infected larvae (40–87%) indicated that insects require individual rearing to avoid major losses in OB production. The OB production of recently molted fifth instars (7.0 x 109 OBs/larva), combined with a high prevalence of mortality (85.7%), resulted in the highest overall OB yield (6.0 x 1011 OBs/100 inoculated larvae), compared to those of third or fourth instars. However, as inoculum concentration did not influence final OB yield, the lowest concentration, LC80 (5.5 x 106 OBs/ml), was selected. Incubation temperature did not significantly influence OB yield, although larvae maintained at 30°C died 13 and 34 hours earlier than those incubated at 26°C and 23°C, respectively. We conclude that the efficient production of HearSP1B+HearLB6 OBs involves inoculation of recently molted fifth instars with a LC80 concentration of OBs followed by individual rearing at 30°C. PMID:27732657

Altered insulin response to an acute bout of exercise in pediatric obesity.

PubMed

Tran, Brian D; Leu, Szu-Yun; Oliver, Stacy; Graf, Scott; Vigil, Diana; Galassetti, Pietro

2014-11-01

Pediatric obesity typically induces insulin resistance, often later evolving into type 2 diabetes. While exercise, enhancing insulin sensitivity, is broadly used to prevent this transition, it is unknown whether alterations in the exercise insulin response pattern occur in obese children. Therefore, we measured exercise insulin responses in 57 healthy weight (NW), 20 overweight (OW), and 56 obese (Ob) children. Blood samples were drawn before and after 30 min of intermittent (2 min on, 1 min off) cycling at ~80% VO2max. In a smaller group (14 NW, 6 OW, 15 Ob), a high-fat meal was ingested 45 min preexercise. Baseline glycemia was similar and increased slightly and similarly in all groups during exercise. Basal insulin (pmol/L) was significantly higher in Ob vs. other groups; postexercise, insulin increased in NW (+7± 3) and OW (+5 ± 8), but decreased in Ob (-15±5, p < .0167 vs. NW). This insulin drop in Ob was disproportionately more pronounced in the half of Ob children with higher basal insulin (Ob-H). In all groups, high-fat feeding caused a rapid rise in insulin, promptly corrected by exercise. In Ob, however, insulin rose again 30 min postexercise. Our data indicates a distinct pattern of exercise-induced insulin modulation in pediatric obesity, possibly modulated by basal insulin concentrations.

A Novel Phase Sensitive Quantum Well Nanostructure Scheme for Controlling Optical Bistability

NASA Astrophysics Data System (ADS)

Raheli, Ali

2018-04-01

A novel four-level lambda-type quantum well (QW) nanostructure is proposed based on phase sensitive optical bistability (OB) and multistability (OM) with a closed-loop configuration. The influence of controlling parameters of the system on OB and OM is investigated. In particular, it is found that the OB behavior is strongly sensitive to the relative phase of applied fields. It is also shown that under certain parametric conditions, the OB can be switched to OM or vice versa. The controllability of OB/OM in such a QW nanostructure may bring some new possibilities for technological applications in solid-state quantum information science and optoelectronics.

Virucidal effects of bleach activators, sodium alkyl acyloxybenzene sulfonate and acyloxybenzoic acid, against Feline calicivirus.

PubMed

Tobe, Seiichi; Hoshi, Marika; Iizuka, Kinue; Tadenuma, Hirohiko; Takaoka, Hiromitsu; Komoriya, Tomoe; Kohno, Hideki

2012-01-01

Noroviruses (NVs) are major causative pathogens of gastroenteritis. The disinfection of contaminated clothing during common household washing is desirable. The virucidal effects of 2 bleach activators, sodium alkyl acyloxybenzene sulfonate (OBS) and alkyl acyloxybenzoic acid (OBC), were studied using Feline calicivirus (FCV) as a surrogate for NVs. FCV was added to solutions containing either OBS or OBC and sodium percarbonate at various temperatures and for varying lengths of time. OBS and OBC, which generate long carbon chain peroxy acids, enhanced the virucidal effect of sodium percarbonate (PC). In particular, sodium lauroyloxybenzene sulfonate (OBS-12) and decanoyloxybenzoic acid (OBC-10) showed superior virucidal effects. Although the virucidal effect of 38-200 mg/L OBS-12 was maintained with 2-5% (v/v) horse serum, there was less of an effect with the same concentration of available chlorine. OBS and OBC have been used as ingredients in some laundry products to increase bleaching activity. It is expected that the use of OBS and OBC is also effective for the inactivation of NVs under common household washing conditions.

Discovery of new dipper stars with K2: a window into the inner disc region of T Tauri stars

NASA Astrophysics Data System (ADS)

Hedges, Christina; Hodgkin, Simon; Kennedy, Grant

2018-05-01

In recent years, a new class of young stellar object (YSO) has been defined, referred to as dippers, where large transient drops in flux are observed. These dips are too large to be attributed to stellar variability, last from hours to days and can reduce the flux of a star by 10-50 per cent. This variability has been attributed to occultations by warps or accretion columns near the inner edge of circumstellar discs. Here, we present 95 dippers in the Upper Scorpius association and ρ Ophiuchus cloud complex found in K2 Campaign 2 data using supervised machine learning with a random forest classifier. We also present 30 YSOs that exhibit brightening events on the order of days, known as bursters. Not all dippers and bursters are known members, but all exhibit infrared excesses and are consistent with belonging to either of the two young star-forming regions. We find 21.0 ± 5.5 per cent of stars with discs are dippers for both regions combined. Our entire dipper sample consists only of late-type (KM) stars, but we show that biases limit dipper discovery for earlier spectral types. Using the dipper properties as a proxy, we find that the temperature at the inner disc edge is consistent with interferometric results for similar and earlier type stars.

M Dwarf Rotation from the K2 Young Clusters to the Field. I. A Mass-Rotation Correlation at 10 Myr

NASA Astrophysics Data System (ADS)

Somers, Garrett; Stauffer, John; Rebull, Luisa; Cody, Ann Marie; Pinsonneault, Marc

2017-12-01

Recent observations of the low-mass (0.1-0.6 {M}⊙ ) rotation distributions of the Pleiades and Praesepe clusters have revealed a ubiquitous correlation between mass and rotation, such that late M dwarfs rotate an order-of-magnitude faster than early M dwarfs. In this paper, we demonstrate that this mass-rotation correlation is present in the 10 Myr Upper Scorpius association, as revealed by new K2 rotation measurements. Using rotational evolution models, we show that the low-mass rotation distribution of the 125 Myr Pleiades cluster can only be produced if it hosted an equally strong mass-rotation correlation at 10 Myr. This suggests that physical processes important in the early pre-main sequence (PMS; star formation, accretion, disk-locking) are primarily responsible for the M dwarf rotation morphology, and not quirks of later angular momentum (AM) evolution. Such early mass trends must be taken into account when constructing initial conditions for future studies of stellar rotation. Finally, we show that the average M star loses ˜25%-40% of its AM between 10 and 125 Myr, a figure accurately and generically predicted by modern solar-calibrated wind models. Their success rules out a lossless PMS and validates the extrapolation of magnetic wind laws designed for solar-type stars to the low-mass regime at early times.

Subaru Imaging of Asymmetric Features in a Transitional Disk in Upper Scorpius

NASA Technical Reports Server (NTRS)

Mayama, S.; Hashimoto, J.; Muto, T.; Tsukagoshi, T.; Kusakabe, N.; Kuzuhara, M.; Takahashi, Y.; Kudo, T.; Dong, R.; Fukagawa, M.;

Subaru Imaging of Asymmetric Features in a Transitional Disk in a Transitional Disk in Upper Scorpius

NASA Technical Reports Server (NTRS)

Mayama, S.; Hashimoto, J.; Muto, T.; Tsukagoshi, T.; Kusakabe, N.; Kuzuhara, M.; Takahashi, Y.; Kudo, T.; Dong, R.; Fukagawa, M.;

The CIDA Variability Survey of Orion OB1. I. The Low-Mass Population of Ori OB1a and 1b

NASA Astrophysics Data System (ADS)

Briceño, Cesar; Calvet, Nuria; Hernández, J.; Vivas, A. K.; Hartmann, Lee; Downes, J. J.; Berlind, Perry

2005-02-01

We present results of a large-scale, multiepoch optical survey of the Orion OB1 association, carried out with the QUEST camera at the Venezuela National Astronomical Observatory. We identify for the first time the widely spread low-mass, young population in the Ori OB1a and OB1b subassociations. Candidate members were picked up by their variability in the V band and position in color-magnitude diagrams. We obtained spectra to confirm membership. In a region spanning ~68 deg2, we found 197 new young stars; of these, 56 are located in the Ori OB1a subassociation and 141 in Ori OB1b. The spatial distribution of the low-mass young stars is spatially coincident with that of the high-mass members but suggests a much sharper edge to the association. Comparison with the spatial extent of molecular gas and extinction maps indicates that the subassociation Ori OB1b is concentrated within a ringlike structure of radius ~2°(~15 pc at 440 pc), centered roughly on the star ɛ Ori in the Orion belt. The ring is apparent in 13CO and corresponds to a region with an extinction AV>=1. The stars exhibiting strong Hα emission, an indicator of active accretion, are found along this ring, whereas the center is populated with weak Hα-emitting stars. In contrast, Ori OB1a is located in a region devoid of gas and dust. We identify a grouping of stars within a ~3 deg2 area located in Ori OB1a, roughly clustered around the B2 star 25 Ori. The Herbig Ae/Be star V346 Ori is also associated with this grouping, which could be an older analog of σ Ori. Using several sets of evolutionary tracks, we find an age of 7-10 Myr for Ori OB1a and of ~4-6 Myr for Ori OB1b, consistent with previous estimates from OB stars. Indicators such as the equivalent width of Hα and near-IR excesses show that the number of accreting low-mass stars decreases sharply between Ori OB1b and Ori OB1a. These results indicate that although a substantial fraction of accreting disks remain at ages ~5 Myr, inner disks are essentially dissipated by 10 Myr. Based on observations obtained at the Llano del Hato National Astronomical Observatory of Venezuela, operated by Centro de Investigaciones de Astronomía (CIDA) for the Ministerio de Ciencia y Tecnología, and at the Fred Lawrence Whipple Observatory (FLWO) of the Smithsonian Institution. Based on observations obtained at the 3.5 m WIYN Telescope. The WIYN Observatory is a joint facility of the University of Wisconsin-Madison, Indiana University, Yale University, and the National Optical Astronomy Observatory (NOAO).

Leptin deficiency shifts mast cells toward anti-inflammatory actions and protects mice from obesity and diabetes by polarizing M2 macrophages

PubMed Central

Zhou, Yi; Yu, Xueqing; Chen, Huimei; Sjöberg, Sara; Roux, Joséphine; Zhang, Lijun; Ivoulsou, Al-Habib; Bensaid, Farid; Liu, Conglin; Liu, Jian; Tordjman, Joan; Clement, Karine; Lee, Chih-Hao; Hotamisligil, Gokhan S.; Libby, Peter; Shi, Guo-Ping

2015-01-01

SUMMARY Mast cells (MCs) contribute to the pathogenesis of obesity and diabetes. This study demonstrates that leptin deficiency slants MCs toward anti-inflammatory functions. MCs in the white adipose tissues (WAT) of lean humans and mice express negligible leptin. Adoptive transfer of leptin-deficient MCs expanded ex vivo mitigates diet-induced and pre-established obesity and diabetes in mice. Mechanistic studies show that leptin-deficient MCs polarize macrophages from M1 to M2 functions because of impaired cell signaling and an altered balance between pro- and anti-inflammatory cytokines, but do not affect T-cell differentiation. Rampant body weight gain in ob/ob mice, a strain that lacks leptin, associates with reduced MC content in WAT. In ob/ob mice, genetic depletion of MCs exacerbates obesity and diabetes, and repopulation of ex vivo expanded ob/ob MCs ameliorates these diseases. PMID:26481668

Large-scale magnetic topologies of early M dwarfs

NASA Astrophysics Data System (ADS)

Donati, J.-F.; Morin, J.; Petit, P.; Delfosse, X.; Forveille, T.; Aurière, M.; Cabanac, R.; Dintrans, B.; Fares, R.; Gastine, T.; Jardine, M. M.; Lignières, F.; Paletou, F.; Ramirez Velez, J. C.; Théado, S.

2008-10-01

We present here additional results of a spectropolarimetric survey of a small sample of stars ranging from spectral type M0 to M8 aimed at investigating observationally how dynamo processes operate in stars on both sides of the full convection threshold (spectral type M4). The present paper focuses on early M stars (M0-M3), that is above the full convection threshold. Applying tomographic imaging techniques to time series of rotationally modulated circularly polarized profiles collected with the NARVAL spectropolarimeter, we determine the rotation period and reconstruct the large-scale magnetic topologies of six early M dwarfs. We find that early-M stars preferentially host large-scale fields with dominantly toroidal and non-axisymmetric poloidal configurations, along with significant differential rotation (and long-term variability); only the lowest-mass star of our subsample is found to host an almost fully poloidal, mainly axisymmetric large-scale field resembling those found in mid-M dwarfs. This abrupt change in the large-scale magnetic topologies of M dwarfs (occurring at spectral type M3) has no related signature on X-ray luminosities (measuring the total amount of magnetic flux); it thus suggests that underlying dynamo processes become more efficient at producing large-scale fields (despite producing the same flux) at spectral types later than M3. We suspect that this change relates to the rapid decrease in the radiative cores of low-mass stars and to the simultaneous sharp increase of the convective turnover times (with decreasing stellar mass) that models predict to occur at M3; it may also be (at least partly) responsible for the reduced magnetic braking reported for fully convective stars. Based on observations obtained at the Télescope Bernard Lyot (TBL), operated by the Institut National des Science de l'Univers of the Centre National de la Recherche Scientifique of France. E-mail: donati@ast.obs-mip.fr (J-FD); jmorin@ast.obs-mip.fr (JM); petit@ast.obs-mip.fr (PP); xavier.delfosse@obs.ujf-grenoble.fr (XD); thierry.forveille@obs.ujf-grenoble.fr (TF); auriere@ast.obs-mip.fr (MA); remi.cabanac@ast.obs-mip.fr (RC); dintrans@ast.obs-mip.fr (BD); rfares@ast.obs-mip.fr (RF); tgastine@ast.obs-mip.fr (TG); mmj@st-and.ac.uk (MMJ); lignieres@ast.obs-mip.fr (FL); fpaletou@ast.obs-mip.fr (FP); julio.ramirez@obspm.fr (JCRV); sylvie.theado@ast.obs-mip.fr (ST)

Defensive medicine among obstetricians and gynaecologists in Turkey.

PubMed

Küçük, Mert

2018-02-01

In recent years, there has been a remarkable increase in medical malpractice litigations against OB/GYNs in Turkey and globally. This high litigation atmosphere may have changed attitudes, behaviour and practice of OB/GYNs. In the current study, opinions and attitudes of OB/GYNs regarding defensive medicine and to what extent they practice it were investigated. One hundred and eight OB/GYNs participated in the study. All participants found obstetrics and gynaecology riskier when compared with other medical branches and reported that they were increasingly practising defensive medicine. The majority of the OB/GYNs stated that they abstained from many risky interventions and expressed their belief that the high caesarean section (C-section) rate was associated with medico-legal concerns. The majority of the participants supported enacting of a specific medical malpractice law and supported the establishment of medically specialised courts. These regulations demanded by OB/GYNs should be taken into account by health authorities. Impact statement What is already known on this subject: In recent years, there has been a remarkable increase in medical malpractice litigations against OB/GYNs in Turkey and globally. Turkey has serious problems with the high C-section rate, which has been suggested to be related to medicolegal issues in a previous research. Fifty-one percent of babies, namely most of them, are delivered via C-section. There is no specific medical malpractice law and medically specialised court in Turkey. What the results of this study add: It seems like there is a professional liability crisis among OB/GYNs in Turkey. OB/GYNs reported that they were increasingly practising defensive medicine, and stated that they abstained from many risky interventions. A high C-section rate was found to be related to medicolegal concerns in OB/GYNs' perspective in the current study. OB/GYNs demanded some reasonable regulations. What the implications are of these findings for clinical practice and/or further research: Regulations demanded by OB/GYNs, which were probed in the current study, such as enacting a specific medical malpractice law and establishment of a medically specialised court, should be taken into account by health authorities in Turkey. The findings of the current study is believed to produce important results for the success of Health transformation programme put into practice in Turkey, which was not able to stop increasing C-section rates. Studies evaluating the direct or indirect costs related to defensive medicine practices of OB/GYNs in Turkey should be performed in subsequent research.

Effects of high fat diet, ovariectomy, and physical activity on leptin receptor expression in rat brain and white fat tissue

PubMed Central

Blažetić, Senka; Labak, Irena; Viljetić, Barbara; Balog, Marta; Vari, Sandor G.; Krivošíková, Zora; Gajdoš, Martin; Kramárová, Patrícia; Kebis, Anton; Vuković, Rosemary; Puljak, Livia; Has-Schön, Elizabeta; Heffer, Marija

2014-01-01

Aim To evaluate in a rat animal model whether ovariectomy, high fat diet (HFD), and physical activity in the form of running affect leptin receptor (Ob-R) distribution in the brain and white fat tissue compared to sham (Sh) surgery, standard diet (StD), and sedentary conditions. Methods The study included 48 female laboratory Wistar rats (4 weeks old). Following eight weeks of feeding with standard or HFD, rats were subjected to either OVX or Sh surgery. After surgery, all animals continued StD or HFD for the next 10 weeks. During these 10 weeks, ovariectomy and Sh groups were subjected to physical activity or sedentary conditions. Free-floating immunohistochemistry and Western blot methods were carried out to detect Ob-R in the brain and adipose tissue. Results StD-ovariectomy-sedentary group had a greater number of Ob-R positive neurons in lateral hypothalamic nuclei than StD-Sh-sedentary group. There was no difference in Ob-R positive neurons in arcuatus nuclei between all groups. Ob-R distribution in the barrel cortex was higher in HFD group than in StD group. Ob-R presence in perirenal and subcutaneous fat was decreased in StD-ovariectomy group. Conclusion HFD and ovariectomy increased Ob-R distribution in lateral hypothalamic nuclei, but there was no effect on arcuatus nuclei. Our results are first to suggest that HFD, ovariectomy, and physical activity affect Ob-R distribution in the barrel cortex, which might be correlated with the role of Ob-R in election of food in rats. PMID:24891281

Leptin regulates ACE activity in mice.

PubMed

Hilzendeger, Aline Mourao; Morais, Rafael Leite; Todiras, Mihail; Plehm, Ralph; da Costa Goncalves, Andrey; Qadri, Fatimunnisa; Araujo, Ronaldo Carvalho; Gross, Volkmar; Nakaie, Clovis Ryuichi; Casarini, Dulce Elena; Carmona, Adriana Karaoglanovic; Bader, Michael; Pesquero, João Bosco

2010-09-01

Leptin is a hormone related to metabolism. It also influences blood pressure, but the mechanisms triggered in this process are not yet elucidated. Angiotensin-I converting enzyme (ACE) regulates cardiovascular functions and recently has been associated with metabolism control and obesity. Here, we used ob/ob mice, a model lacking leptin, to answer the question whether ACE and leptin could interact to influence blood pressure, thereby linking the renin-angiotensin system and obesity. These mice are obese and diabetic but have normal 24 h mean arterial pressure. Our results show that plasma and lung ACE activities as well as ACE mRNA expression were significantly decreased in ob/ob mice. In agreement with these findings, the hypotensive effect produced by enalapril administration was attenuated in the obese mice. Plasma renin, angiotensinogen, angiotensin I, bradykinin, and angiotensin 1-7 were increased, whereas plasma angiotensin II concentration was unchanged in obese mice. Chronic infusion of leptin increased renin activity and angiotensin II concentration in both groups and increased ACE activity in ob/ob mice. Acute leptin infusion restored ACE activity in leptin-deficient mice. Moreover, the effect of an ACE inhibitor on blood pressure was not changed in ob/+ mice during leptin treatment but increased four times in obese mice. In summary, our findings show that the renin-angiotensin system is altered in ob/ob mice, with markedly reduced ACE activity, which suggests a possible connection between the renin-angiotensin system and leptin. These results point to an important interplay between the angiotensinergic and the leptinergic systems, which may play a role in the pathogenesis of obesity, hypertension, and metabolic syndrome.

Effects of high fat diet, ovariectomy, and physical activity on leptin receptor expression in rat brain and white fat tissue.

PubMed

Blažetić, Senka; Labak, Irena; Viljetić, Barbara; Balog, Marta; Vari, Sandor G; Krivošíková, Zora; Gajdoš, Martin; Kramárová, Patrícia; Kebis, Anton; Vuković, Rosemary; Puljak, Livia; Has-Schön, Elizabeta; Heffer, Marija

2014-06-01

To evaluate in a rat animal model whether ovariectomy, high fat diet (HFD), and physical activity in the form of running affect leptin receptor (Ob-R) distribution in the brain and white fat tissue compared to sham (Sh) surgery, standard diet (StD), and sedentary conditions. The study included 48 female laboratory Wistar rats (4 weeks old). Following eight weeks of feeding with standard or HFD, rats were subjected to either OVX or Sh surgery. After surgery, all animals continued StD or HFD for the next 10 weeks. During these 10 weeks, ovariectomy and Sh groups were subjected to physical activity or sedentary conditions. Free-floating immunohistochemistry and Western blot methods were carried out to detect Ob-R in the brain and adipose tissue. StD-ovariectomy-sedentary group had a greater number of Ob-R positive neurons in lateral hypothalamic nuclei than StD-Sh-sedentary group. There was no difference in Ob-R positive neurons in arcuatus nuclei between all groups. Ob-R distribution in the barrel cortex was higher in HFD group than in StD group. Ob-R presence in perirenal and subcutaneous fat was decreased in StD-ovariectomy group. HFD and ovariectomy increased Ob-R distribution in lateral hypothalamic nuclei, but there was no effect on arcuatus nuclei. Our results are first to suggest that HFD, ovariectomy, and physical activity affect Ob-R distribution in the barrel cortex, which might be correlated with the role of Ob-R in election of food in rats.

Alteration of Wnt5a expression and of the non-canonical Wnt/PCP and Wnt/PKC-Ca2+ pathways in human osteoarthritis osteoblasts

PubMed Central

Martineau, Xavier; Abed, Élie; Martel-Pelletier, Johanne; Pelletier, Jean-Pierre; Lajeunesse, Daniel

2017-01-01

Objective Clinical and in vitro studies suggest that subchondral bone sclerosis due to abnormal osteoblasts (Ob) is involved in the progression and/or onset of osteoarthritis (OA). Human Ob isolated from sclerotic subchondral OA bone tissue show an altered phenotype, a decreased canonical Wnt/β-catenin signaling pathway (cWnt), and a reduced mineralization in vitro. In addition to the cWnt pathway, at least two non-canonical signaling pathways, the Wnt/PKC and Wnt/PCP pathway have been described. However, there are no reports of either pathway in OA Ob. Here, we studied the two non-canonical pathways in OA Ob and if they influence their phenotype. Methods Human primary subchondral Ob were isolated from the subchondral bone plate of tibial plateaus of OA patients undergoing total knee arthroplasty, or of normal individuals at autopsy. The expression of genes involved in non-canonical Wnt signaling was evaluated by qRT-PCR and their protein production by Western blot analysis. Alkaline phosphatase activity and osteocalcin secretion (OC) were determined with substrate hydrolysis and EIA, respectively. Mineralization levels were evaluated with Alizarin Red Staining, Wnt/PKC and Wnt/PCP pathways by target gene expression and their respective activity using the NFAT and AP-1 luciferase reporter assays. Results OA Ob showed an altered phenotype as illustrated by an increased alkaline phosphatase activity and osteocalcin release compared to normal Ob. The expression of the non-canonical Wnt5a ligand was increased in OA Ob compared to normal. Whereas, the expression of LGR5 was significantly increased in OA Ob compared to normal Ob, the expression of LGR4 was similar. Wnt5a directly stimulated the expression and production of LGR5, contrasting, Wnt5a did not stimulate the expression of LGR4. Wnt5a also stimulated the phosphorylation of both JNK and PKC, as well as the activity of both NFAT and AP-1 transcription factors. The inhibition of Wnt5a expression partially corrects the abnormal mineralization, OC secretion and ALPase activity of OA Ob. Conclusion These data indicate that the alteration of Wnt5a, a non-canonical Wnt signaling activator, is implicated in the modified signalisation and phenotype observed in OA Ob. PMID:28777797

The Luminosity Function of OB Associations in the Galaxy

NASA Astrophysics Data System (ADS)

McKee, Christopher F.; Williams, Jonathan P.

1997-02-01

OB associations ionize the interstellar medium, producing both localized H II regions and diffuse ionized gas. The supernovae resulting from these associations pressurize and stir the interstellar medium. Using Smith, Biermann, & Mezger's compilation of radio H II regions in the Galaxy, and Kennicutt, Edgar, & Hodge's optical study of H II regions in nearby galaxies, we show that the luminosity distribution of giant OB associations in the Galaxy can be fit by a truncated power law of the form \\Nscra(>S)=\\Nscrau[(Su/S)-1], where S is the ionizing photon luminosity, \\Nscra(>S) is the number of associations with a luminosity of at least S, and Su is the upper limit to the distribution. The coefficient \\Nscrau is the number of the most luminous associations, with a luminosity between 0.5Su and Su. For the Galaxy, \\Nscrau=6.1 the fact that the number of the most luminous associations is significantly larger than unity indicates that there is a physical limit to the maximum size of H II regions in the Galaxy. To extend the luminosity distribution to small H II regions, we assume that the birthrate of associations, \\Nscr\\dota(>\\Nscr*), is also a truncated power law, \\Nscr\\dota(>\\Nscr*)~[(\\Nscr*u/\\Nscr*)-1], where \\Nscr* is the number of stars in the association. For large associations, the ionizing luminosity is proportional to the number of stars, S~\\Nscr* for smaller associations, we use both an analytic and a Monte Carlo approach to find the resulting luminosity distribution \\Nscra(>S). H II regions are generally centrally concentrated, with only the dense central regions being bright enough to appear in radio catalogs. Anantharamaiah postulated that radio H II regions have extended envelopes in order to account for diffuse radio recombination line emission in the Galaxy. Some of these envelopes are visible as the ionized ``worms'' discussed by Heiles and coworkers. We estimate that on the average the envelopes of radio H II regions absorb about twice as many ionizing photons as the radio H II regions themselves. Allowing for the ionizing radiation that is absorbed by dust (about 25% of the total), we find that the maximum ionizing photon luminosity of a Galactic OB association is Su ~= 4.9 × 1051 photons s-1, corresponding to an Hα luminosity of about 5 × 1039 ergs s-1. The total ionizing luminosity of this distribution of OB associations can account for the thermal radio emission and the N II far-infrared emission of the Galaxy. The number of massive stars in the associations is consistent with estimates of the rate of massive star supernovae in the Galaxy. Associations produce several generations of stars over their lifetimes, and the largest associations are predicted to produce about 7000 supernova progenitors. Fitting the surface density of associations to an exponential of the form d\\Nscra(\\Nscr*)/dA~ exp (-R/HR) with a scale length HR = 3.5 kpc gives a number of OB associations in the solar neighborhood that is consistent with observation. The H II envelopes contribute to pulsar dispersion measures and can account for the increased dispersion measure observed in the inner Galaxy.

VizieR Online Data Catalog: CO obs. of MCs in the Extreme Outer Galaxy region (Sun+, 2017)

NASA Astrophysics Data System (ADS)

Sun, Y.; Su, Y.; Zhang, S.-B.; Xu, Y.; Chen, X.-P.; Yang, J.; Jiang, Z.-B.; Fang, M.

2017-08-01

The observations in the Galactic range of 34.75°<=l<=45.25° and -5.25°<=b<=5.25° were conducted during 2011 November to 2015 March using the 13.7m millimeter-wavelength telescope of the Purple Mountain Observatory (PMO) in Delingha, China. The molecular lines of 12CO(J=1-0) in the upper sideband, and 13CO(J=1-0) and C18O(J=1-0) in the lower sideband were observed simultaneously. A total of 174 molecular clouds (MCs) were identified, of which 168 MCs probably lie in the Extreme Outer Galaxy (EOG) region. (3 data files).

Resolution of massive compact clusters in the 30 Doradus periphery with the Hubble Space Telescope

NASA Technical Reports Server (NTRS)

Walborn, Nolan R.; Mackenty, John W.; Saha, Abhijit; White, Richard L.; Parker, Joel WM.

1995-01-01

Hubble Space Telescope Wide Field/Planetary Camera UBV images of three massive, compact multiple systems with the SNR 30 Dor B/NGC 2060 and 30 Dor C/NGC 2044 are discussed and illustrated. In two cases, WN+OB objects have been resolved into additional components to those previously known from ground-based observations, substantially reducing the luminosities of the WN stars and rendering them currently unidentified; in the third case, the components of a B+K composite-spectrum object have been clearly identified. The results are of significance for evolutionary interpretations of these massive stars and for determinations of the upper IMF in extragalactic systems.

Proteomics Analysis of Skeletal Muscle from Leptin-Deficient ob/ob Mice Reveals Adaptive Remodeling of Metabolic Characteristics and Fiber Type Composition.

PubMed

Schönke, Milena; Björnholm, Marie; Chibalin, Alexander V; Zierath, Juleen R; Deshmukh, Atul S

2018-03-01

Skeletal muscle insulin resistance, an early metabolic defect in the pathogenesis of type 2 diabetes (T2D), may be a cause or consequence of altered protein expression profiles. Proteomics technology offers enormous promise to investigate molecular mechanisms underlying pathologies, however, the analysis of skeletal muscle is challenging. Using state-of-the-art multienzyme digestion and filter-aided sample preparation (MED-FASP) and a mass spectrometry (MS)-based workflow, we performed a global proteomics analysis of skeletal muscle from leptin-deficient, obese, insulin resistant (ob/ob) and lean mice in mere two fractions in a short time (8 h per sample). We identified more than 6000 proteins with 118 proteins differentially regulated in obesity. This included protein kinases, phosphatases, and secreted and fiber type associated proteins. Enzymes involved in lipid metabolism in skeletal muscle from ob/ob mice were increased, providing evidence against reduced fatty acid oxidation in lipid-induced insulin resistance. Mitochondrial and peroxisomal proteins, as well as components of pyruvate and lactate metabolism, were increased. Finally, the skeletal muscle proteome from ob/ob mice displayed a shift toward the "slow fiber type." This detailed characterization of an obese rodent model of T2D demonstrates an efficient workflow for skeletal muscle proteomics, which may easily be adapted to other complex tissues. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Mixed genotype transmission bodies and virions contribute to the maintenance of diversity in an insect virus

PubMed Central

Clavijo, Gabriel; Williams, Trevor; Muñoz, Delia; Caballero, Primitivo; López-Ferber, Miguel

2010-01-01

An insect nucleopolyhedrovirus naturally survives as a mixture of at least nine genotypes. Infection by multiple genotypes results in the production of virus occlusion bodies (OBs) with greater pathogenicity than those of any genotype alone. We tested the hypothesis that each OB contains a genotypically diverse population of virions. Few insects died following inoculation with an experimental two-genotype mixture at a dose of one OB per insect, but a high proportion of multiple infections were observed (50%), which differed significantly from the frequencies predicted by a non-associated transmission model in which genotypes are segregated into distinct OBs. By contrast, insects that consumed multiple OBs experienced higher mortality and infection frequencies did not differ significantly from those of the non-associated model. Inoculation with genotypically complex wild-type OBs indicated that genotypes tend to be transmitted in association, rather than as independent entities, irrespective of dose. To examine the hypothesis that virions may themselves be genotypically heterogeneous, cell culture plaques derived from individual virions were analysed to reveal that one-third of virions was of mixed genotype, irrespective of the genotypic composition of the OBs. We conclude that co-occlusion of genotypically distinct virions in each OB is an adaptive mechanism that favours the maintenance of virus diversity during insect-to-insect transmission. PMID:19939845

Adipose Deficiency of Nrf2 in ob/ob Mice Results in Severe Metabolic Syndrome

PubMed Central

Xue, Peng; Hou, Yongyong; Chen, Yanyan; Yang, Bei; Fu, Jingqi; Zheng, Hongzhi; Yarborough, Kathy; Woods, Courtney G.; Liu, Dianxin; Yamamoto, Masayuki; Zhang, Qiang; Andersen, Melvin E.; Pi, Jingbo

2013-01-01

Nuclear factor E2–related factor 2 (Nrf2) is a transcription factor that functions as a master regulator of the cellular adaptive response to oxidative stress. Our previous studies showed that Nrf2 plays a critical role in adipogenesis by regulating expression of CCAAT/enhancer-binding protein β and peroxisome proliferator–activated receptor γ. To determine the role of Nrf2 in the development of obesity and associated metabolic disorders, the incidence of metabolic syndrome was assessed in whole-body or adipocyte-specific Nrf2-knockout mice on a leptin-deficient ob/ob background, a model with an extremely positive energy balance. On the ob/ob background, ablation of Nrf2, globally or specifically in adipocytes, led to reduced white adipose tissue (WAT) mass, but resulted in an even more severe metabolic syndrome with aggravated insulin resistance, hyperglycemia, and hypertriglyceridemia. Compared with wild-type mice, WAT of ob/ob mice expressed substantially higher levels of many genes related to antioxidant response, inflammation, adipogenesis, lipogenesis, glucose uptake, and lipid transport. Absence of Nrf2 in WAT resulted in reduced expression of most of these factors at mRNA or protein levels. Our findings support a novel role for Nrf2 in regulating adipose development and function, by which Nrf2 controls the capacity of WAT expansion and insulin sensitivity and maintains glucose and lipid homeostasis. PMID:23238296

Associations of maternal employment and three-generation families with pre-school children's overweight and obesity in Japan.

PubMed

Watanabe, E; Lee, J S; Kawakubo, K

2011-07-01

Maternal employment has been shown to be associated with childhood overweight and obesity (Ow/Ob), but the presence of family members who care for children in place of the mothers might influence children's Ow/Ob and lifestyles. The influence of maternal employment on children's Ow/Ob should be examined together with the presence of caregivers such as grandparents. The effects of maternal employment and the presence of grandparents on lifestyles and Ow/Ob in Japanese pre-school children were investigated. Cross-sectional study on 2114 children aged 3-6 years who attended all childcare facilities in a city and primary caregivers was conducted. Children's weight and height, family environments (family members, maternal employment, single parent, number of siblings and parental Ow/Ob) and lifestyles (dietary, physical activity and sleeping habits) were surveyed using a self-administered questionnaire. Ow/Ob was defined by the International Obesity Task Force cut-offs. The eligible participants were 1765 children. The prevalence of Ow/Ob was 8.4% in boys and 9.9% in girls. Maternal employment was associated positively with irregular mealtimes, unfixed snacking times, bedtime after 10 p.m. and nighttime sleep duration of less than 10 h, whereas three-generation families were associated negatively with irregular mealtimes after adjustment for children's characteristics and family environments. Irregular mealtimes (OR (95% CI); 2.03 (1.36, 3.06)) and nighttime sleep duration of less than 10 h (1.96 (1.28, 3.01)) were associated with increased risks of being Ow/Ob. Both maternal employment and three-generation families were significantly associated with children's Ow/Ob. However, three-generation families maintained a significant association (1.59 (1.08, 2.35)) after adjustment for maternal employment. These study results suggest that the grandparents who care for pre-school children in place of mothers are more likely to contribute to childhood Ow/Ob than maternal employment. The family-focused lifestyle strategies to prevent childhood Ow/Ob must include grandparents who care for children.

Assessing the osteoblast transcriptome in a model of enhanced bone formation due to constitutive G{sub s}–G protein signaling in osteoblasts

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wattanachanya, Lalita, E-mail: lalita_md@yahoo.com; Division of Endocrinology and Metabolism, Department of Medicine, Faculty of Medicine, Chulalongkorn University and King Chulalongkorn Memorial Hospital, Thai Red Cross Society, Bangkok; Wang, Liping, E-mail: lipingwang05@yahoo.com

G protein-coupled receptor (GPCR) signaling in osteoblasts (OBs) is an important regulator of bone formation. We previously described a mouse model expressing Rs1, an engineered constitutively active G{sub s}-coupled GPCR, under the control of the 2.3 kb Col I promoter. These mice showed a dramatic age-dependent increase in trabecular bone of femurs. Here, we further evaluated the effects of enhanced G{sub s} signaling in OBs on intramembranous bone formation by examining calvariae of 1- and 9-week-old Col1(2.3)/Rs1 mice and characterized the in vivo gene expression specifically occurring in osteoblasts with activated G{sub s} G protein-coupled receptor signaling, at the cellularmore » level rather than in a whole bone. Rs1 calvariae displayed a dramatic increase in bone volume with partial loss of cortical structure. By immunohistochemistry, Osterix was detected in cells throughout the inter-trabecular space while Osteocalcin was expressed predominantly in cells along bone surfaces, suggesting the role of paracrine mediators secreted from OBs driven by 2.3 kb Col I promoter could influence early OB commitment, differentiation, and/or proliferation. Gene expression analysis of calvarial OBs revealed that genes affected by Rs1 signaling include those encoding proteins important for cell differentiation, cytokines and growth factors, angiogenesis, coagulation, and energy metabolism. The set of G{sub s}-GPCRs and other GPCRs that may contribute to the observed skeletal phenotype and candidate paracrine mediators of the effect of G{sub s} signaling in OBs were also determined. Our results identify novel detailed in vivo cellular changes of the anabolic response of the skeleton to G{sub s} signaling in mature OBs. - Highlights: • OB expression of an engineered G{sub s}-coupled receptor dramatically increases bone mass. • We investigated the changes in gene expression in vivo in enhanced OB G{sub s} signaling. • Genes in cell cycle and transcription were increased in enhanced OB G{sub s} signaling. • GPCRs and paracrine mediators of the effect of G{sub s} signaling in OBs were determined.« less

Ambulatory Blood Pressure Monitoring in Lean, Obese and Diabetic Children and Adolescents

PubMed Central

Shikha, Deep; Singla, Montish; Walia, Rachna; Potter, Natia; Umpaichitra, Vatcharapan; Mercado, Arlene; Winer, Nathaniel

2015-01-01

Aim To determine if children and adolescents who have obesity (Ob) or type 2 diabetes (T2DM) of relatively short duration have impaired cardiovascular function compared with lean subjects using 24-hour ambulatory blood pressure as a surrogate measure of evaluation. Methods We enrolled 100 African-Caribbean subjects (45 males/55 females), mean ages 14.4-15.2 years (range 11.8-18.5 years) and Tanner stage 4.2-4.8. Mean BMI for the Ob (n = 40), T2DM (n = 39) and lean (n = 21) groups were 40.3, 34.2 and 20.8, respectively (p < 0.01, Ob and T2DM vs. lean). Mean hemoglobin A1c in lean and Ob was 5.4 and 5.5% compared to 8.8% in T2DM (p < 0.001, T2DM vs. lean and Ob). Ambulatory blood pressure was recorded every 20 min over 24 h using Spacelabs 70207. Results Mean 24-hour, daytime and nighttime systolic blood pressure was significantly higher in Ob and T2DM compared with lean subjects (mean 24-hour 117 and 120 vs. 109 mm Hg; daytime 121 and 123 vs. 113 mm Hg; and nighttime 109 and 115 vs. 101 mm Hg; p < 0.01 for all time periods). The nocturnal systolic dip in Ob and T2DM did not differ from that of lean, whereas nocturnal diastolic dip decreased significantly in Ob and T2DM compared to lean (11.5 and 10.4 vs. 20.6 mm Hg; p < 0.01). Mean pulse pressure was significantly increased in the Ob and T2DM groups compared to lean subjects (51 and 54 vs. 45 mm Hg; p < 0.01). Conclusion Adolescent Ob and T2DM groups share adverse risk factors, which may be harbingers of adult cardiovascular events. PMID:26195970

Leptin signaling is required for adaptive changes in food intake, but not energy expenditure, in response to different thermal conditions.

PubMed

Kaiyala, Karl J; Ogimoto, Kayoko; Nelson, Jarrell T; Schwartz, Michael W; Morton, Gregory J

2015-01-01

Survival of free-living animals depends on the ability to maintain core body temperature in the face of rapid and dramatic changes in their thermal environment. If food intake is not adjusted to meet the changing energy demands associated with changes of ambient temperature, a serious challenge to body energy stores can occur. To more fully understand the coupling of thermoregulation to energy homeostasis in normal animals and to investigate the role of the adipose hormone leptin to this process, comprehensive measures of energy homeostasis and core temperature were obtained in leptin-deficient ob/ob mice and their wild-type (WT) littermate controls when housed under cool (14°C), usual (22°C) or ∼ thermoneutral (30°C) conditions. Our findings extend previous evidence that WT mice robustly defend normothermia in response to either a lowering (14°C) or an increase (30°C) of ambient temperature without changes in body weight or body composition. In contrast, leptin-deficient, ob/ob mice fail to defend normothermia at ambient temperatures lower than thermoneutrality and exhibit marked losses of both body fat and lean mass when exposed to cooler environments (14°C). Our findings further demonstrate a strong inverse relationship between ambient temperature and energy expenditure in WT mice, a relationship that is preserved in ob/ob mice. However, thermal conductance analysis indicates defective heat retention in ob/ob mice, irrespective of temperature. While a negative relationship between ambient temperature and energy intake also exists in WT mice, this relationship is disrupted in ob/ob mice. Thus, to meet the thermoregulatory demands of different ambient temperatures, leptin signaling is required for adaptive changes in both energy intake and thermal conductance. A better understanding of the mechanisms coupling thermoregulation to energy homeostasis may lead to the development of new approaches for the treatment of obesity.

Leptin Signaling Is Required for Adaptive Changes in Food Intake, but Not Energy Expenditure, in Response to Different Thermal Conditions

PubMed Central

Kaiyala, Karl J.; Ogimoto, Kayoko; Nelson, Jarrell T.; Schwartz, Michael W.; Morton, Gregory J.

2015-01-01

Survival of free-living animals depends on the ability to maintain core body temperature in the face of rapid and dramatic changes in their thermal environment. If food intake is not adjusted to meet the changing energy demands associated with changes of ambient temperature, a serious challenge to body energy stores can occur. To more fully understand the coupling of thermoregulation to energy homeostasis in normal animals and to investigate the role of the adipose hormone leptin to this process, comprehensive measures of energy homeostasis and core temperature were obtained in leptin-deficient ob/ob mice and their wild-type (WT) littermate controls when housed under cool (14°C), usual (22°C) or ∼ thermoneutral (30°C) conditions. Our findings extend previous evidence that WT mice robustly defend normothermia in response to either a lowering (14°C) or an increase (30°C) of ambient temperature without changes in body weight or body composition. In contrast, leptin-deficient, ob/ob mice fail to defend normothermia at ambient temperatures lower than thermoneutrality and exhibit marked losses of both body fat and lean mass when exposed to cooler environments (14°C). Our findings further demonstrate a strong inverse relationship between ambient temperature and energy expenditure in WT mice, a relationship that is preserved in ob/ob mice. However, thermal conductance analysis indicates defective heat retention in ob/ob mice, irrespective of temperature. While a negative relationship between ambient temperature and energy intake also exists in WT mice, this relationship is disrupted in ob/ob mice. Thus, to meet the thermoregulatory demands of different ambient temperatures, leptin signaling is required for adaptive changes in both energy intake and thermal conductance. A better understanding of the mechanisms coupling thermoregulation to energy homeostasis may lead to the development of new approaches for the treatment of obesity. PMID:25756181

Obstetrician–Gynecologists’ Objections to and Willingness to Help Patients Obtain an Abortion

PubMed Central

Harris, Lisa H; Cooper, Alexandra; Rasinski, Kenneth A; Curlin, Farr A; Lyerly, Anne Drapkin

2014-01-01

Objective To describe obstetrician–gynecologists’ (ob-gyns) views and willingness to help women seeking abortion in a variety of clinical scenarios. Methods We conducted a mailed survey of 1,800 U.S. ob-gyns. We presented seven scenarios in which patients sought abortion. For each, respondents indicated if they morally objected to abortion and if they would help patients obtain an abortion. We analyzed predictors of objection and assistance. Results The response rate was 66%. Objection to abortion ranged from 16% (cardiopulmonary disease) to 82% (sex selection); willingness to assist ranged from 64% (sex selection) to 93% (cardiopulmonary disease). Excluding sex selection, objection was less likely among ob-gyns who were female (odds ratio [OR] 0.5, 95% confidence interval [CI] 0.4–0.8), urban (OR 0.3, CI 0.1–0.7), or Jewish (OR 0.3, CI 0.1–0.7) compared to male, rural, or unaffiliated ob-gyns. Objection was more likely among ob-gyns from the South (OR 1.9, CI 1.2–3.0) or Midwest (OR 1.9, CI 1.2–3.1), and among Catholic, evangelical Protestant, or Muslim ob-gyns, or those for whom religion was most important, compared to reference. Among ob-gyns who objected to abortion in a given case, approximately two-thirds nevertheless help patients obtain an abortion. Excluding sex selection, assistance despite objection was more likely among female (OR 1.8, CI 1.1–2.9) and US-born ob-gyns (OR 2.2, CI 1.1–4.7), and less likely among Southern ob-gyns (OR 0.3, CI 0.2–0.6), or those for whom religion was most important (OR 0.3, CI 0.1–0.7). Conclusions Most ob-gyns help patients obtain an abortion even when they morally object to abortion in that case. Willingness to assist varies by clinical context and physician characteristics. PMID:21934455

Gender and sexual health in clinical practice in Lebanon

PubMed Central

El-Kak, F.; Jurdi, R.; Kaddour, A.; Zurayk, H.

2006-01-01

This study examines the readiness of obstetricians/gynecologists (Ob/Gyns) in Lebanon to provide sexual consultation, their degree of comfort when discussing issues of sexual health, and their attitudes regarding assessment, treatment, and referral. Data on these concepts were collected through face-to-face interviews with 286 randomly selected Ob/Gyns. Most Ob/Gyns reported feeling comfortable discussing sexuality during consultations, which they attributed much more to professional experience than to training. Most Ob/Gyns reported giving proper time for management of sexual health issues and follow-up, as these issues are brought up frequently by their women clients. However, results suggest that only one-third (31%) of Lebanese Ob/Gyns nearly always take the initiative in asking patients about their sexual health. Moreover, almost 45% of participating Ob/Gyns did not recognize a strong relationship between reproductive health and sexual functioning. Gender was not found to be an important predictor for any of the indicators measured in the present study. Ob/Gyns in Lebanon are significant consultants on various sexual issues, and they need better postgraduate training, continuing medical education, and access to medical congress resources on the topic of sexuality and its relationship to reproductive health. PMID:15548405

A CATALOG OF NEW SPECTROSCOPICALLY CONFIRMED MASSIVE OB STARS IN CARINA

DOE Office of Scientific and Technical Information (OSTI.GOV)

Alexander, Michael J.; Hanes, Richard J.; McSwain, M. Virginia

2016-12-01

The Carina star-forming region is one of the largest in the Galaxy, and its massive star population is still being unveiled. The large number of stars combined with high, and highly variable, interstellar extinction makes it inherently difficult to find OB stars in this type of young region. We present the results of a spectroscopic campaign to study the massive star population of the Carina Nebula, with the primary goal to confirm or reject previously identified Carina OB star candidates. A total of 141 known O- and B-type stars and 94 candidates were observed, of which 73 candidates had highmore » enough signal-to-noise ratio to classify. We find 23 new OB stars within the Carina Nebula, a 32% confirmation rate. One of the new OB stars has blended spectra and is suspected to be a double-lined spectroscopic binary (SB2). We also reclassify the spectral types of the known OB stars and discover nine new SB2s among this population. Finally, we discuss the spatial distribution of these new OB stars relative to known structures in the Carina Nebula.« less

Experimental demonstration of OSPF-TE extensions in muiti-domain OBS networks connected by GMPLS network

NASA Astrophysics Data System (ADS)

Tian, Chunlei; Yin, Yawei; Wu, Jian; Lin, Jintong

2008-11-01

The interworking network of Generalized Multi-Protocol Label Switching (GMPLS) and Optical Burst Switching (OBS) is attractive network architecture for the future IP/DWDM network nowadays. In this paper, OSPF-TE extensions for multi-domain Optical Burst Switching networks connected by GMPLS controlled WDM network are proposed, the corresponding experimental results such as the advertising latency are also presented by using an OBS network testbed. The experimental results show that it works effectively on the OBS/GMPLS networks.

Searching for self-enrichment in Cygnus OB2

NASA Astrophysics Data System (ADS)

Berlanas, Sara R.; Herrero, Artemio; Comerón, Fernando; Pasquali, Anna; Simón-Díaz, Sergio

2017-11-01

Cygnus OB2 is a rich and relatively close (d~1.4 kpc) OB association in our Galaxy. It represents an ideal testbed for our theories about self-enrichment processes produced by pollution of the interstellar medium by successive generations of massive stars. Comerón & Pasquali (2012, A&A, 543, A101) found a correlation between the age of young stellar groups in Cygnus OB2 and their Galactic longitude. If is associated with a chemical composition gradient, it could support these self-enrichment processes.

C-Mpl Is Expressed on Osteoblasts and Osteoclasts and Is Important in Regulating Skeletal Homeostasis.

PubMed

Meijome, Tomas E; Baughman, Jenna T; Hooker, R Adam; Cheng, Ying-Hua; Ciovacco, Wendy A; Balamohan, Sanjeev M; Srinivasan, Trishya L; Chitteti, Brahmananda R; Eleniste, Pierre P; Horowitz, Mark C; Srour, Edward F; Bruzzaniti, Angela; Fuchs, Robyn K; Kacena, Melissa A

2016-04-01

C-Mpl is the receptor for thrombopoietin (TPO), the main megakaryocyte (MK) growth factor, and c-Mpl is believed to be expressed on cells of the hematopoietic lineage. As MKs have been shown to enhance bone formation, it may be expected that mice in which c-Mpl was globally knocked out (c-Mpl(-/-) mice) would have decreased bone mass because they have fewer MKs. Instead, c-Mpl(-/-) mice have a higher bone mass than WT controls. Using c-Mpl(-/-) mice we investigated the basis for this discrepancy and discovered that c-Mpl is expressed on both osteoblasts (OBs) and osteoclasts (OCs), an unexpected finding that prompted us to examine further how c-Mpl regulates bone. Static and dynamic bone histomorphometry parameters suggest that c-Mpl deficiency results in a net gain in bone volume with increases in OBs and OCs. In vitro, a higher percentage of c-Mpl(-/-) OBs were in active phases of the cell cycle, leading to an increased number of OBs. No difference in OB differentiation was observed in vitro as examined by real-time PCR and functional assays. In co-culture systems, which allow for the interaction between OBs and OC progenitors, c-Mpl(-/-) OBs enhanced osteoclastogenesis. Two of the major signaling pathways by which OBs regulate osteoclastogenesis, MCSF/OPG/RANKL and EphrinB2-EphB2/B4, were unaffected in c-Mpl(-/-) OBs. These data provide new findings for the role of MKs and c-Mpl expression in bone and may provide insight into the homeostatic regulation of bone mass as well as bone loss diseases such as osteoporosis. © 2015 Wiley Periodicals, Inc.

Anisomycin administered in the olfactory bulb and dorsal hippocampus impaired social recognition memory consolidation in different time-points.

PubMed

Pena, R R; Pereira-Caixeta, A R; Moraes, M F D; Pereira, G S

2014-10-01

To identify an individual as familiar, rodents form a specific type of memory named social recognition memory. The olfactory bulb (OB) is an important structure for social recognition memory, while the hippocampus recruitment is still controversial. The present study was designed to elucidate the OB and the dorsal hippocampus contribution to the consolidation of social memory. For that purpose, we tested the effect of anisomycin (ANI), which one of the effects is the inhibition of protein synthesis, on the consolidation of social recognition memory. Swiss adult mice with cannulae implanted into the CA1 region of the dorsal hippocampus or into the OB were exposed to a juvenile during 5 min (training session; TR), and once again 1.5 h or 24 h later to test social short-term memory (S-STM) or social long-term memory (S-LTM), respectively. To study S-LTM consolidation, mice received intra-OB or intra-CA1 infusion of saline or ANI immediately, 3, 6 or 18 h after TR. ANI impaired S-LTM consolidation in the OB, when administered immediately or 6h after TR. In the dorsal hippocampus, ANI was amnesic only if administered 3 h after TR. Furthermore, the infusion of ANI in either OB or CA1, immediately after training, did not affect S-STM. Moreover, ANI administered into the OB did not alter the animal's performance in the buried food-finding task. Altogether, our results suggest the consolidation of S-LTM requires both OB and hippocampus participation, although in different time points. This study may help shedding light on the specific roles of the OB and dorsal hippocampus in social recognition memory. Copyright © 2014 Elsevier Inc. All rights reserved.

Biologically active leptin-related synthetic peptides activate STAT3 via phosphorylation of ERK1/2 and PI-3K.

PubMed

Lin, Hung-Yun; Yang, Sheng-Huei; Tang, Heng-Yuan; Cheng, Guei-Yun; Davis, Paul J; Grasso, Patricia

2014-07-01

The effects of leptin-related synthetic peptides [d-Leu-4]-OB3 and OB3 on energy balance and glucose homeostasis in ob/ob and db/db mice have been confirmed. The molecular basis of these effects, however, remains unclear. In the present study, we examined the ability of these peptides to activate signal transduction pathways known to be involved in transduction of the leptin signal. In a specific and concentration-dependent manner, [d-Leu-4]-OB3 induced phosphorylation of ERK1/2, PI-3K, Ser-727 STAT3, and Tyr-705 of STAT3. OB3 also induced activation of STAT3 via phosphorylation of ERK1/2, STAT3 Ser-727, STAT3 Tyr-705 and PI-3K p85, but to a lesser degree. Using PD98059 and LY294002, specific inhibitors of MEK and PI-3K, respectively, we were able to identify the signal transduction pathways involved in peptide-induced STAT3 activation. [d-Leu-4]-OB3 induced serine phosphorylation of STAT3 primarily through activation of ERK1/2. Tyrosine phosphorylation of STAT3, however, was induced primarily through activation of PI-3K. Our data suggest that in db/db mice, [d-Leu-4]-OB3 binding to short isoforms of the leptin receptor induces intracellular signaling cascades which do not require OB-Rb activation. These signals may ultimately result in peptide effects on transcriptional and translational events associated with energy balance and glycemic regulation. In summary, we have shown for the first time that, similar to leptin, bioactive leptin-related synthetic peptide analogs activate STAT3 via phosphorylation of serine and tyrosine residues by multiple signal transduction pathways. Copyright © 2014 Elsevier Inc. All rights reserved.

Expression of the P2X2 receptor in different classes of ileum myenteric neurons in the female obese ob/ob mouse

PubMed Central

Mizuno, Márcia Sanae; Crisma, Amanda Rabello; Borelli, Primavera; Castelucci, Patricia

2012-01-01

AIM: To examine whether the ob/ob mouse model of obesity is accompanied by enteric nervous system abnormalities such as altered motility. METHODS: The study examined the distribution of the P2X2 receptor (P2X2R) in myenteric neurons of female ob/ob mice. Specifically, we used immunohistochemistry to analyze the co-expression of the P2X2R with neuronal nitric oxide synthase (nNOS), choline acetyltransferase (ChAT), and calretinin (CalR) in neurons of the small intestine myenteric plexus in ob/ob and control female mice. In these sections, we used scanning confocal microscopy to analyze the co-localization of these markers as well as the neuronal density (cm2) and area profile (μm²) of P2X2R-positive neurons. In addition, enteric neurons were labeled using the nicotinamide adenine dinucleotide (NADH) diaphorase method and analyzed with light microscopy as an alternate means by which to analyze neuronal density and area. RESULTS: In the present study, we observed a 29.6% increase in the body weight of the ob/ob animals (OG) compared to the control group (CG). In addition, the average small intestine area was increased by approximately 29.6% in the OG compared to the CG. Immunoreactivity (IR) for the P2X2R, nNOS, ChAT and CalR was detectable in the myenteric plexus, as well as in the smooth muscle, in both groups. This IR appeared to be mainly cytoplasmic and was also associated with the cell membrane of the myenteric plexus neurons, where it outlined the neuronal cell bodies and their processes. P2X2R-IR was observed to co-localize 100% with that for nNOS, ChAT and CalR in neurons of both groups. In the ob/ob group, however, we observed that the neuronal density (neuron/cm2) of P2X2R-IR cells was increased by 62% compared to CG, while that of NOS-IR and ChAT-IR neurons was reduced by 49% and 57%, respectively, compared to control mice. The neuronal density of CalR-IR neurons was not different between the groups. Morphometric studies further demonstrated that the cell body profile area (μm²) of nNOS-IR, ChAT-IR and CalR-IR neurons was increased by 34%, 20% and 55%, respectively, in the OG compared to controls. Staining for NADH diaphorase activity is widely used to detect alterations in the enteric nervous system; however, our qualitative examination of NADH-diaphorase positive neurons in the myenteric ganglia revealed an overall similarity between the two groups. CONCLUSION: We demonstrate increases in P2X2R expression and alterations in nNOS, ChAT and CalR IR in ileal myenteric neurons of female ob/ob mice compared to wild-type controls. PMID:23002338

Roles of Obstetrician-Gynecologist Hospitalists with Changes in the Obstetrician-Gynecologist Workforce and Practice.

PubMed

Tessmer-Tuck, Jennifer A; Rayburn, William F

2015-09-01

Obstetrician-gynecologists (OB-GYNs) are the fourth largest group of physicians and the only specialty dedicated solely to women's health care. The specialty is unique in providing 24-hour inpatient coverage, surgical care and ambulatory preventive health care. This article identifies and reviews changes in the OB-GYN workforce, including more female OB-GYNs, an increasing emphasis on work-life balance, more sub-specialization, larger group practices with more employed physicians and, finally, an emphasis on quality and performance improvement. It then describes the evolution of the OB-GYN hospitalist movement to date and the role of OB-GYN hospitalists in the future with regard to these workforce changes. Copyright © 2015 Elsevier Inc. All rights reserved.

Reduced adiposity in ob/ob mice following total body irradiation and bone marrow transplantation.

PubMed

Ablamunits, Vitaly; Weisberg, Stuart P; Lemieux, Jacob E; Combs, Terry P; Klebanov, Simon

2007-06-01

The objective of this study was to assess long-term metabolic consequences of total body irradiation (TBI) and bone marrow transplantation. Severe obesity develops due to both hypertrophy and hyperplasia of adipocytes. We hypothesized that TBI would arrest adipose tissue growth and would affect insulin resistance (IR). We exposed 2-month-old female ob/ob mice to 8 Grays of TBI followed by bone marrow transplantation and tested the animals for body weight (BW) gain, body composition, blood glucose, and insulin sensitivity. Two months after TBI, irradiated mice stopped gaining BW, whereas non-treated mice continued to grow. At the age of 9.5 months, body mass of irradiated mice was 60.6 +/- 1.4 grams, which was only 61% of that in non-treated ob/ob controls (99.4 +/- 1.6 grams). Body composition measurements by DXA showed that decreased BW was primarily due to an impaired fat accumulation. This could not result from the production of leptin by bone marrow-derived adipocyte progenitors because inhibition of the obese phenotype was identical in recipients of both B6 and ob/ob bone marrow. Inability of the irradiated mice to accumulate fat was associated with hepatomegaly, lower levels of monocyte chemoattractant protein-1 expression in adipose tissue, and increased IR. Our data argue in favor of the hypothesis that inability of adipose tissue to expand may increase IR. This mouse model may be valuable for studies of late-onset radiation-induced IR in humans.

Neuroglial metabolic compartmentation underlying leptin deficiency in the obese ob/ob mice as detected by magnetic resonance imaging and spectroscopy methods

PubMed Central

Delgado, Teresa C; Violante, Inês R; Nieto-Charques, Laura; Cerdán, Sebastián

2011-01-01

Manganese-Enhanced Magnetic Resonance Imaging (MEMRI), 1H and 13C High-Resolution-Magic Angle Spinning (HR-MAS) Spectroscopy, and genomic approaches were used to compare cerebral activation and neuronal and glial oxidative metabolism in ad libitum fed C57BL6/J leptin-deficient, genetically obese ob/ob mice. T1-weighted Magnetic Resonance Images across the hypothalamic Arcuate and the Ventromedial nuclei were acquired kinetically after manganese infusion. Neuroglial compartmentation was investigated in hypothalamic biopsies after intraperitoneal injections of [1-13C]glucose or [2-13C]acetate. Total RNA was extracted to determine the effects of leptin deficiency in the expression of representative genes coding for regulatory enzymes of hypothalamic energy pathways and glutamatergic neurotransmission. Manganese-Enhanced Magnetic Resonance Imaging revealed enhanced cerebral activation in the hypothalamic Arcuate and Ventromedial nuclei of the ob/ob mice. 13C HR-MAS analysis showed increased 13C accumulation in the hypothalamic glutamate and glutamine carbons of ob/ob mice after the administration of [1-13C]glucose, a primarily neuronal substrate. Hypothalamic expression of the genes coding for glucokinase, phosphofructokinase, pyruvate dehydrogenase, and glutamine synthase was not significantly altered while pyruvate kinase expression was slightly upregulated. In conclusion, leptin deficiency associated with obesity led to increased cerebral activation in the hypothalamic Arcuate and Ventromedial nuclei, concomitant with significant increases in neuronal oxidative metabolism and glutamatergic neurotransmission. PMID:21971349

Consumption of Two Healthy Dietary Patterns Restored Microbiota Dysbiosis in Obese Patients with Metabolic Dysfunction.

PubMed

Haro, Carmen; García-Carpintero, Sonia; Rangel-Zúñiga, Oriol A; Alcalá-Díaz, Juan F; Landa, Blanca B; Clemente, José C; Pérez-Martínez, Pablo; López-Miranda, José; Pérez-Jiménez, Francisco; Camargo, Antonio

2017-12-01

The consumption of two healthy diets (Mediterranean (MED) and low-fat (LF) diets) may restore the gut microbiome dysbiosis in obese patients depending on the degree of metabolic dysfunction. The differences in bacterial community at baseline and after 2 years of dietary intervention of 106 subjects from the CORDIOPREV study were analyzed, 33 of whom were obese patients with severe metabolic disease (5 criteria for metabolic syndrome) (MetS-OB), 32 obese patients without metabolic dysfunction (2 or less criteria for metabolic syndrome) (NonMetS-OB) and 41 non-obese subjects (NonMetS-NonOB). Our study showed a marked dysbiosis in people with severe metabolic disease (Met-OB), compared with obese people without MetS (NonMetS-OB) and non-obese people (NonMetS-NonOB). This disbiotic pattern was reversed by consumption of both MED (35% of calories as fat (22% MUFA fat, 6% PUFA fat and <10% saturated fat) or LF (<30% total fat (<10% saturated fat, 12%-14% MUFA fat and 6-8% PUFA fat) diets, whereas no significant microbiota changes were observed in NonMetS-NonOB and NonMetS-OB groups. Our results suggest that the chronic intake of two healthy dietary patterns partially restores the gut microbiome dysbiosis in obese patients with coronary heart disease, depending on the degree of metabolic dysfunction. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Structural Organization of Baculovirus Occlusion Bodies and Protective Role of Multilayered Polyhedron Envelope Protein.

PubMed

Sajjan, Dayanand B; Hinchigeri, Shivayogeppa B

2016-03-01

Baculoviruses are the ingenious insect pathogens. Outside the host, baculovirus occlusion bodies (OB) provide stability to occlusion-derived viruses (ODV) embedded within. The OB is an organized structure, chiefly composed of proteins namely polyhedrin, polyhedron envelope protein (PEP) and P10. Currently, the structural organization of OB is poorly understood and the role of OB proteins in conferring the stability to ODV is unknown. Here we have shown that the assembly of polyhedrin unit cells into an OB is a rapid process; the PEP forms in multiple layers; the PEP layers predominantly contribute to ODV viability. Full-grown OBs (n = 36) were found to be 4.0 ± 1.0 µm in diameter and possessed a peculiar geometry of a truncated rhombic dodecahedron. The atomic force microscopy (AFM) study on the structure of OBs at different stages of growth in insect cells revealed polyhedrin assembly and thickness of PEP layers. The thickness of PEP layers at 53 h post-transfection (hpt) ranged from 56 to 80 nm. Mature PEP layers filled up approximately one third of the OB volume. The size of ODV nucleocapsid was found to be 433 ± 10 nm in length. The zeta potential and particle size distribution study of viruses revealed the protective role of PEP layers. The presence of a multilayered PEP confers a viable advantage to the baculoviruses compared to single-layered PEP. Thus, these findings may help in developing PEP layer-based biopolymers for protein-based nanodevices, nanoelectrodes and more stable biopesticides.

Peripheral nervous system insulin resistance in ob/ob mice

PubMed Central

2013-01-01

Background A reduction in peripheral nervous system (PNS) insulin signaling is a proposed mechanism that may contribute to sensory neuron dysfunction and diabetic neuropathy. Neuronal insulin resistance is associated with several neurological disorders and recent evidence has indicated that dorsal root ganglion (DRG) neurons in primary culture display altered insulin signaling, yet in vivo results are lacking. Here, experiments were performed to test the hypothesis that the PNS of insulin-resistant mice displays altered insulin signal transduction in vivo. For these studies, nondiabetic control and type 2 diabetic ob/ob mice were challenged with an intrathecal injection of insulin or insulin-like growth factor 1 (IGF-1) and downstream signaling was evaluated in the DRG and sciatic nerve using Western blot analysis. Results The results indicate that insulin signaling abnormalities documented in other “insulin sensitive” tissues (i.e. muscle, fat, liver) of ob/ob mice are also present in the PNS. A robust increase in Akt activation was observed with insulin and IGF-1 stimulation in nondiabetic mice in both the sciatic nerve and DRG; however this response was blunted in both tissues from ob/ob mice. The results also suggest that upregulated JNK activation and reduced insulin receptor expression could be contributory mechanisms of PNS insulin resistance within sensory neurons. Conclusions These findings contribute to the growing body of evidence that alterations in insulin signaling occur in the PNS and may be a key factor in the pathogenesis of diabetic neuropathy. PMID:24252636

Frankfurt Medical Department Activity (FMEDDAC) OB/GYN Clinic Study

DTIC Science & Technology

1993-08-01

ideas took hold and flourished in post-World War II Japan ( Arikan , 1990). The Japanese institutionalized the following chain FMEDDAC OB-GYN 8 reaction...be required for most organizations. FMEDDAC OB-GYN 69 References Arikan , V.L. (1991). Total quality management - Applications to nursing service

Constraining the velocity structure of the Juan de Fuca plate from ridge to trench with a 2D tomographic study of wide angle OBS data

NASA Astrophysics Data System (ADS)

Boulahanis, B.; Canales, J. P.; Carbotte, S. M.; Carton, H. D.; Han, S.; Nedimovic, M. R.

2016-12-01

We conduct a two-dimensional travel time tomography study of a cross-plate, 300-km long, ocean bottom seismometer (OBS) transect collected as part of the Ridge to Trench (R2T) program to investigate the structure, evolution and state of hydration of the Juan de Fuca (JdF) plate from the ridge axis to subduction at the Cascadia margin offshore Washington. Our study employs the methodology of Korenaga et al. (2000) to derive a P-wave velocity model using wide-angle data from 15 OBSs spaced on average 15 km apart, spanning from the Endeavour segment of the JdF ridge to the Cascadia accretionary prism. A top down modeling approach is employed, first assessing velocities of the sediment layer, then the crust, and finally the upper mantle; at each stage of the inversion we fix the structure of the overlaying layers. Quality of data fit is evaluated using the root mean square value of the difference between predicted and observed travel times normalized by pick uncertainty. Previous studies provide a well-resolved multi-channel seismic (MCS) reflection image of this transect (Han et al., 2016), affording good constraints of the location of basement and Moho reflectors while allowing for comparison of the relationship between velocities and crustal structure. MCS results along this transect suggest evidence of little bending faulting confined to the sediment and upper-middle crust. An initial velocity model of the sediment layer above igneous crust is constructed utilizing the MCS derived sediment velocities. A one-dimensional velocity starting model of the oceanic crust is generated using the results of Horning et al. (in press) from a quasi-parallel cross-plate transect also acquired as part of the R2T study. Seismic velocities are compared to predicted velocities for crustal and mantle lithologies at temperatures estimated from a plate-cooling model and are used to provide constraints on water contents in these layers.

Massive Stars in the MCs: What They Tell Us about the IMF, Stellar Evolution, and Upper Mass "Cutoffs"

NASA Astrophysics Data System (ADS)

Massey, P.

Massive stars in the Magellanic Clouds provide an instantaneous "snapshot" of star-formation. In this talk I will review what we have learned both about star formation, and stellar evolution. Studies over the past decade have shown that the initial mass function (IMF) is the same for massive stars born in OB associations in the LMC and SMC as in associations and clusters in the Milky Way; the slope of the IMF is essentially Salpeter (Gamma ~ -1.3), despite the factor of 10 difference in metallicity between these systems. Recent work on the R136 cluster (described in Hunter's review talk) suggest that there is no such thing as an upper mass cutoff to the IMF, at least not one that has been found observationally: for the youngest clusters (2 Myr and younger), the mass of the highest mass star present is simply dependent upon how populous the cluster is; i.e., the IMF is truncated by statistics, not physics. There does appear to be a significant population of massive stars that are born in the "field" (not part of a large OB association or cluster); the IMF of these stars is quite a bit steeper (Gamma ~ -4), although stars as massive as those found in associations are also found in the field. The mixed-age population of the MCs as a whole can be used to test stellar evolutionary models; the agreement with the work of the Geneva group is found to be excellent, for stars with masses >25 Mo, although the youngest stars may be missing in the HRD. The discovery that clusters born in associations are quite coeval (Delta tau <1-2 Myr) allows us to use the "turn-off masses" to determine what mass objects become Wolf-Rayet stars of various types, and new results will be reviewed.

Crustal Deformation In the Northwestern Margin of the South China Sea: Results From Wide-angle Seismic Modeling

NASA Astrophysics Data System (ADS)

Huang, H.; Klingelhoefer, F.

2017-12-01

The South China Sea (SCS) has undergone episodic spreading during the Cenozoic Era. The long-term extension has shaped the continental margins of the SCS, leading to a progressive breakup of the lithosphere. Separated blocks and rift troughs, as controlled by tectonic stretching, contains key information about the deforming mechanism of the crust. In this work, we present a P-wave velocity model of a wide-angle seismic profile OBS2013-1 which passes through the NW margin of the SCS. Modeling of 25 ocean bottom seismometers (OBS) data revealed a detailed crustal structure and shallow complexities along the profile (Figure 1). The crust thins symmetrically across the Xisha Trough, from more than 20 km on flanks to 10 km in the central valley where the sediments thickens over 5 km; A volcano is situated on top of the centre basement high where the Moho drops slightly. At the distal margin around the Zhongsha Trough, the upper crust was detached and accordingly made the middle crust exhumed in a narrow area ( 20 km wide). Meanwhile, materials from the lower crust rises asymmetrically, increasing the crustal velocity by 0.3 km/s and may also giving rise to volcanisms along the hanging side. A 40 km wide hyper-stretched crust (with thickness of 5 km) was identified next to the Zhongsha Trough and covered by overflowing magma and post-rift sediments on the top. These observations argue for a depth-related and asymmetrically extension of the crust, including (1) detachment fault controls the deformation of the upper crust, leading to exhumation of the middle crust and asymmetrically rising of the lower crust, (2) The region adjacent to the exhumation region and with highly thinned crust can be considered as extinct OCT due to magma-starved supplying.

Timescales of Disk Evolution and Planet Formation: HST, Adaptive Optics, and ISO Observations of Weak-Line and Post-T Tauri Stars

NASA Astrophysics Data System (ADS)

Brandner, Wolfgang; Zinnecker, Hans; Alcalá, Juan M.; Allard, France; Covino, Elvira; Frink, Sabine; Köhler, Rainer; Kunkel, Michael; Moneti, Andrea; Schweitzer, Andreas

2000-08-01

We present high spatial resolution HST and ground-based adaptive optics observations and high-sensitivity ISO (ISOCAM & ISOPHOT) observations of a sample of X-ray selected weak-line (WTTS) and post- (PTTS) T Tauri stars located in the nearby Chamaeleon T and Scorpius-Centaurus OB associations. HST/NICMOS and adaptive optics observations aimed at identifying substellar companions (young brown dwarfs) at separations >=30 AU from the primary stars. No such objects were found within 300 AU of any of the target stars, and a number of faint objects at larger separations can very likely be attributed to a population of field (background) stars. ISOCAM observations of 5 to 15 Myr old WTTSs and PTTSs in ScoCen reveal infrared excesses which are clearly above photospheric levels and which have a spectral index intermediate between that of younger (1 to 5 Myr) T Tauri stars in Chamaeleon and that of pure stellar photospheres. The difference in the spectral index of the older PTTSs in ScoCen compared with the younger classical and weak-line TTSs in Cha can be attributed to a deficiency of smaller size (0.1 to 1 μm) dust grains relative to larger size (~5 μm) dust grains in the disks of the PTTSs. The lack of small dust grains is either due to the environment (effect of nearby O stars and supernova explosions) or due to disk evolution. If the latter is the case, it would hint that circumstellar disks start to become dust depleted at an age between 5 to 15 Myr. Dust depletion is very likely related to the build-up of larger particles (ultimately rocks and planetesimals) and thus an indicator for the onset of the period of planet formation. Based on observations with the NASA/ESA Hubble Space Telescope obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under the NASA contract NAS 5-26555, observations at the European Southern Observatory, La Silla (ESO Prop ID 58.E-0169), and observations with ESA's Infrared Space Observatory.

The multiplicity of T Tauri stars in the star forming regions Taurus-Auriga and Ophiuchus-Scorpius: A 2.2 micron speckle imaging survey

NASA Technical Reports Server (NTRS)

Ghez, A. M.; Neugebauer, G.; Matthews, K.

1993-01-01

We present the results of a magnitude limited (K less than = 8.5 mag) speckle imaging survey of 69 T Tauri stars in the star forming regions Taurus-Auriga and Ophiuchus-Scorpius. Thirty-three companion stars were found with separations ranging from 0.07 sec to 2.5 sec, nine are new detections. This survey reveals a distinction between the classical T Tauri stars (CTTS) and the weak-lined T Tauri stars (WTTS) based on the binary star frequency as a function of separation: the WTTS binary star distribution is enhanced at the closer separations (less than 50 AU) relative to the CTTS binary star distribution. We suggest that the nearby companion stars shorten the accretion time scale in multiple star systems, thereby accounting for the presence of WTTS that are coeval with many CTTS. The binary star frequency in the projected linear separation range 16 to 252 AU for T Tauri stars (60 (+/- 17)%) is a factor of 4 greater than that of the solar-type main-sequence stars (16(+/- 3)%). Given the limited separation range of this survey, the rate at which binaries are detected suggests that most, if not all, T Tauri stars have companions. We propose that the observed overabundance of companions of T Tauri stars is an evolutionary effect, in which triple and higher order T Tauri stars are disrupted by close encounters with another star or system of stars.

Food habits of Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) in the northeastern Chukchi and western Beaufort Seas

NASA Astrophysics Data System (ADS)

Gray, Benjamin P.; Norcross, Brenda L.; Beaudreau, Anne H.; Blanchard, Arny L.; Seitz, Andrew C.

2017-01-01

Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) belong to Cottidae, the second most abundant fish family in the western Arctic. Although considered important in food webs, little is known about their food habits throughout this region. To address this knowledge gap, we examined and compared the diets of 515 Arctic staghorn sculpin and 422 shorthorn sculpin using stomachs collected over three summers in the northeastern Chukchi Sea (2010-2012) and one summer in the western Beaufort Sea (2011). We used permutational multivariate analysis of variance (PERMANOVA) and non-metric multidimensional scaling (nMDS) to compare sculpin diets between regions and selected size classes. Differences in mouth morphologies and predator size versus prey size relationships were examined using regression techniques. Arctic staghorn sculpin and shorthorn sculpin diet compositions differed greatly throughout the Chukchi and Beaufort Seas. Regardless of body size, the smaller-mouthed Arctic staghorn sculpin consumed mostly benthic amphipods and polychaetes, whereas the larger-mouthed shorthorn sculpin shifted from a diet composed of benthic and pelagic macroinvertebrates as smaller individuals to shrimps and fish prey as larger individuals. Within shared habitats, the sculpins appear to partition prey, either by taxa or size, in a manner that suggests no substantial overlap occurs between species. This study increases knowledge of sculpin feeding ecology in the western Arctic and offers regional, quantitative diet information that could support current and future food web modeling efforts.

Organic brain syndrome. The psychiatric imposter.

PubMed

Dubin, W R; Weiss, K J; Zeccardi, J A

1983-01-07

Rapid differentiation of organic brain syndrome (OBS) from functional psychiatric illness can be difficult when patients come to an emergency department with predominantly psychiatric symptoms. Using four screening criteria-disorientation, abnormal vital signs, clouded consciousness, and patients older than 40 years with no previous psychiatric history-we detected 38 cases of OBS from 1,140 medically cleared patients. Twelve of these patients were subsequently admitted to a medical unit. Despite the presence of striking behavioral aberration, an increased awareness of the clinical manifestations of OBS will enhance the physician's ability to discriminate OBS from other psychiatric illness.

Obstetrics Hospitalists: Risk Management Implications.

PubMed

Veltman, Larry

2015-09-01

The concept of having an in-house obstetrician (serving as an obstetrics [OB] hospitalist) available 24 hours a day, 7 days a week provides a safety net for OB events that many need immediate intervention for a successful outcome. A key precept of risk management, that of loss prevention, fits perfectly with the addition of an OB hospitalist role in the perinatal department. Inherent in the role of OB hospitalists are the patient safety and risk management principles of improved communication, enhanced readiness, and immediate availability. Copyright © 2015 Elsevier Inc. All rights reserved.

Additional red and reddened stars in Cyg OB2 association

NASA Technical Reports Server (NTRS)

Parthasarathy, M.; Jain, S. K.

1989-01-01

Several new red and reddened stars are detected in the most heavily reddened associations Cyg OB2. About 47 IRAS sources are detected in Cyg OB2. Their flux distributions, and colors, suggest that they are young stellar objects embedded in dust envelopes or disks (some of them may be proto stars) and are most likely members of the Cyg OB2 association. The large values of the flux ratio L sub IR/L sub VIS suggests that the central objects are obscured because of very large extinction.

The Organic Brain Syndrome (OBS) scale: a systematic review.

PubMed

Björkelund, Karin Björkman; Larsson, Sylvia; Gustafson, Lars; Andersson, Edith

2006-03-01

The Organic Brain Syndrome (OBS) Scale was developed to determine elderly patients' disturbances of awareness and orientation as to time, place and own identity, and assessment of various emotional and behavioural symptoms appearing in delirium, dementia and other organic mental diseases. The aim of the study was to examine the OBS Scale, using the eight criteria and guidelines formulated by the Scientific Advisory Committee of the Medical Outcomes Trust (SAC), and to investigate its relevance and suitability for use in various clinical settings. Systematic search and analysis of papers (30) on the OBS Scale were carried out using the criteria suggested by the SAC. The OBS Scale in many aspects satisfies the requirements suggested by the SAC: conceptual and measurement model, reliability, validity, responsiveness, interpretability, respondent and administrative burden, alternative forms of administration, and cultural and language adaptations, but there is a need for additional evaluation, especially with regard to different forms of reliability, and the translation and adaptation to other languages. The OBS Scale is a sensitive scale which is clinically useful for the description and long-term follow-up of patients showing symptoms of acute confusional state and dementia. Although the OBS Scale has been used in several clinical studies there is need for further evaluation.

Towards Experiments to Test Violation of the Original Bell Inequality

NASA Astrophysics Data System (ADS)

Khrennikov, Andrei; Basieva, Irina

2018-04-01

The aim of this note is to attract attention of experimenters to the original Bell (OB) inequality which was shadowed by the common consideration of the CHSH inequality. There are two reasons to test the OB inequality and not the CHSH inequality. First of all, the OB inequality is a straightforward consequence to the EPR-argumentation. And only this inequality is related to the EPR-Bohr debate. However, the last statement can be objected by some experts working in quantum foundations. Therefore to convince experimenters to perform the OB-violation experiment, we prefer to concentrate on the second distinguishing feature of the OB inequality which was emphasized by I. Pitowsky. He pointed out that the OB inequality provides a higher degree of violations of classicality than the CHSH inequality. The main problem is that the OB inequality is derived under the assumption of perfect (anti-) correlations. However, the last years were characterized by the amazing development of quantum technologies. Nowadays, there exist sources producing with very high probability the pairs of photons in the singlet state. Moreover, the efficiency of photon detectors was improved tremendously. In any event one can start by proceeding with the fair sampling assumption. Another possibility is to use the scheme of Hensen et al. experiment for entangled electrons.

Body fat mass, leptin and puberty.

PubMed

Kiess, W; Müller, G; Galler, A; Reich, A; Deutscher, J; Klammt, J; Kratzsch, J

2000-07-01

Leptin, the ob gene product, provides a molecular basis for the lipostatic theory of the regulation of energy balance. Leptin circulates as a monomeric 16 kDa protein in rodent and human plasma and is also bound to leptin binding proteins that may form large high molecular weight complexes. Initial models of leptin action included leptin-deficient ob/ob mice and leptin-insensitive db/db mice. Peripheral or central administration of leptin reduced body weight, adiposity, and food intake in ob/ob mice but not in db/db mice. In ob/ob mice leptin treatment restored fertility. Leptin interacts with many messenger molecules in the brain. For example, leptin suppresses neuropeptide Y (NPY) expression in the arcuate nucleus. Increased NPY activity has an inhibitory effect on the gonadotropin axis and represents a direct mechanism for inhibiting sexual maturation and reproductive function in conditions of food restriction and/or energy expenditure. By modulating the hypothalamo-pituitary-gonadal axis both directly and indirectly, leptin may thus serve as the signal from fat to the brain about the adequacy of fat stores for pubertal development and reproduction. Normal leptin secretion is necessary for normal reproductive function to proceed and leptin may be a signal allowing for the point of initiation of and progression toward puberty.

Lgl1 Is Required for Olfaction and Development of Olfactory Bulb in Mice.

PubMed

Li, Zhenzu; Zhang, Tingting; Lin, Zhuchun; Hou, Congzhe; Zhang, Jian; Men, Yuqin; Li, Huashun; Gao, Jiangang

2016-01-01

Lethal giant larvae 1 (Lgl1) was initially identified as a tumor suppressor in Drosophila and functioned as a key regulator of epithelial polarity and asymmetric cell division. In this study, we generated Lgl1 conditional knockout mice mediated by Pax2-Cre, which is expressed in olfactory bulb (OB). Next, we examined the effects of Lgl1 loss in the OB. First, we determined the expression patterns of Lgl1 in the neurogenic regions of the embryonic dorsal region of the LGE (dLGE) and postnatal OB. Furthermore, the Lgl1 conditional mutants exhibited abnormal morphological characteristics of the OB. Our behavioral analysis exhibited greatly impaired olfaction in Lgl1 mutant mice. To elucidate the possible mechanisms of impaired olfaction in Lgl1 mutant mice, we investigated the development of the OB. Interestingly, reduced thickness of the MCL and decreased density of mitral cells (MCs) were observed in Lgl1 mutant mice. Additionally, we observed a dramatic loss in SP8+ interneurons (e.g. calretinin and GABAergic/non-dopaminergic interneurons) in the GL of the OB. Our results demonstrate that Lgl1 is required for the development of the OB and the deletion of Lgl1 results in impaired olfaction in mice.

Lgl1 Is Required for Olfaction and Development of Olfactory Bulb in Mice

PubMed Central

Li, Zhenzu; Zhang, Tingting; Lin, Zhuchun; Hou, Congzhe; Zhang, Jian; Men, Yuqin; Li, Huashun

2016-01-01

Lethal giant larvae 1 (Lgl1) was initially identified as a tumor suppressor in Drosophila and functioned as a key regulator of epithelial polarity and asymmetric cell division. In this study, we generated Lgl1 conditional knockout mice mediated by Pax2-Cre, which is expressed in olfactory bulb (OB). Next, we examined the effects of Lgl1 loss in the OB. First, we determined the expression patterns of Lgl1 in the neurogenic regions of the embryonic dorsal region of the LGE (dLGE) and postnatal OB. Furthermore, the Lgl1 conditional mutants exhibited abnormal morphological characteristics of the OB. Our behavioral analysis exhibited greatly impaired olfaction in Lgl1 mutant mice. To elucidate the possible mechanisms of impaired olfaction in Lgl1 mutant mice, we investigated the development of the OB. Interestingly, reduced thickness of the MCL and decreased density of mitral cells (MCs) were observed in Lgl1 mutant mice. Additionally, we observed a dramatic loss in SP8+ interneurons (e.g. calretinin and GABAergic/non-dopaminergic interneurons) in the GL of the OB. Our results demonstrate that Lgl1 is required for the development of the OB and the deletion of Lgl1 results in impaired olfaction in mice. PMID:27603780

Emodin, an 11β-hydroxysteroid dehydrogenase type 1 inhibitor, regulates adipocyte function in vitro and exerts anti-diabetic effect in ob/ob mice

PubMed Central

Wang, Yue-jing; Huang, Su-ling; Feng, Ying; Ning, Meng-meng; Leng, Ying

2012-01-01

Aim: Emodin (1,3,8-trihydroxy-6-methylanthraquinone) is a potent and selective inhibitor of 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1) with the ability to ameliorate metabolic disorders in diet-induced obese mice. In the present study, we investigated the effects of emodin on adipocyte function and the underlying mechanisms in vitro, and its anti-diabetic effects in ob/ob mice. Methods: 3T3-L1 adipocytes were used for in vitro studies. 11β-HSD1A activity was evaluated with a scintillation proximity assay. The adipogenesis, glucose uptake, lipolysis and adiponectin secretion were investigated in 3T3-L1 adipocytes treated with emodin in the presence of active (corticosterone) or inactive glucocorticoid (11-dehydrocorticosterone). For in vivo studies, ob/ob mice were administered emodin (25 and 50 mg·kg−1·d−1, ip) for 26 d. On the last day of administration, the serum was collected and the mesenteric and perirenal fat were dissected for analyses. Results: Emodin inhibited the 11β-HSD1 activity in 3T3-L1 adipocytes in concentration- and time-dependent manners (the IC50 values were 7.237 and 4.204 μmol/L, respectively, after 1 and 24 h treatment. In 3T3-L1 adipocytes, emodin (30 μmol/L) suppressed 11-dehydrocorticosterone-induced adipogenesis without affecting corticosterone-induced adipogenesis; emodin (3 μmol/L) reduced 11-dehydrocorticosterone-stimulated lipolysis, but had no effect on corticosterone-induced lipolysis. Moreover, emodin (3 μmol/L) partly reversed the impaired insulin-stimulated glucose uptake and adiponectin secretion induced by 11-dehydrocorticosterone but not those induced by corticosterone. In ob/ob mice, long-term emodin administration decreased 11β-HSD1 activity in mesenteric adipose tissues, lowered non-fasting and fasting blood glucose levels, and improved glucose tolerance. Conclusion: Emodin improves the inactive glucocorticoid-induced adipose tissue dysfunction by selective inhibition on 11β-HSD1 in adipocyte in vitro and improves glycemic control in ob/ob mice. PMID:22922341

New information about the skull and dentary of the Miocene platypus Obdurodon dicksoni, and a discussion of ornithorhynchid relationships.

PubMed Central

Musser, A M; Archer, M

1998-01-01

A reconstruction of the skull, dentary and dentition of the middle Miocene ornithorhynchid Obdurodon dicksoni has been made possible by acquisition of nearly complete cranial and dental material. Access to new anatomical work on the living platypus, Ornithorhynchus anatinus, and the present comparative study of the cranial foramina of Ob. dicksoni and Or. anatinus have provided new insights into the evolution of the ornithorhynchid skull. The hypertrophied bill in Ob. dicksoni is seen here as possibly apomorphic, although evidence from ontogenetic studies of Or. anatinus suggests that the basic form of the bill in Ob. dicksoni (where the rostral crura meet at the midline) may be ancestral to the form of the bill in Or. anatinus (where the rostral crura meet at the midline in the embryonic platypus but diverge in the adult). Differences in the relative positions of cranial structures, and in the relationships of certain cranial foramina, indicate that the cranium may have become secondarily shortened in Or. anatinus, possibly evolving from a more elongate skull type such as that of Ob. dicksoni. The plesiomorphic dentary of Ob. dicksoni, with well-developed coronoid and angular processes, contrasts with the dentary of Or. anatinus, in which the processes are almost vestigial, as well as with the dentary of the late Oligocene, congeneric Ob. insignis, in which the angular process appears to be reduced (the coronoid process is missing). In this regard the dentary of Ob. insignis seems to be morphologically closer to Or. anatinus than is the dentary of the younger Ob. dicksoni. Phylogenetic conclusions differ from previous analyses in viewing the northern Australian Ob. dicksoni as possibly derived in possessing a hypertrophied bill and dorsoventrally flattened skull and dentary, perhaps being a specialized branch of the Obdurodon line rather than ancestral to species of Ornithorhynchus. The presence of functional teeth and the robust, flattened skull and dentary in Ob. dicksoni argue for differences in diet and lifestyle between this extinct ornithorhynchid and the living Ornithorhynchus. PMID:9720105

WHAT WE DON’T TALK ABOUT WHEN WE DON’T TALK ABOUT SEX1: RESULTS OF A NATIONAL SURVEY OF UNITED STATES OBSTETRICIAN/GYNECOLOGISTS

PubMed Central

SOBECKI, Janelle N.; CURLIN, Farr A.; RASINSKI, Kenneth A.; LINDAU, Stacy Tessler

2012-01-01

Introduction Sexuality is a key aspect of women’s physical and psychological health. Research shows both patients and physicians face barriers to communication about sexuality. Given their expertise and training in addressing conditions of the female genital tract across the female life course, obstetrician/gynecologists (ob/gyns) are well-positioned among all physicians to address sexuality issues with female patients. New practice guidelines for management of female sexual dysfunction and the importance of female sexual behavior and function to virtually all aspects of ob/gyn care, and to women’s health more broadly, warrant up-to-date information regarding ob/gyns’ sexual history-taking routine. Aims To determine obstetrician/gynecologists’ practices of communication with patients about sexuality, and to examine the individual and practice-level correlates of such communication. Methods A population-based sample of 1154 practicing U.S. obstetrician/gynecologists (53% male; mean age 48 years) was surveyed regarding their practices of communication with patients about sex. Main Outcome Measures Self-reported frequency measures of ob/gyns’ communication practices with patients including whether or not ob/gyns discuss patients’ sexual activities, sexual orientation, satisfaction with sexual life, pleasure with sexual activity, and sexual problems or dysfunction, as well as whether or not one ever expresses disapproval of or disagreement with patients’ sexual practices. Multivariable analysis was used to correlate physicians’ personal and practice characteristics with these communication practices. Results Survey response rate was 65.6%. Sixty-three percent of ob/gyns reported routinely assessing patients’ sexual activities; 40% routinely asked about sexual problems. Fewer asked about sexual satisfaction (28.5%), sexual orientation/identity (27.7%), or pleasure with sexual activity (13.8%). A quarter of ob/gyns reported they had expressed disapproval of patients’ sexual practices. Ob/gyns practicing predominately gynecology were significantly more likely than other ob/gyns to routinely ask about each of the five outcomes investigated. Conclusion The majority of U.S. ob/gyns report routinely asking patients about their sexual activities, but most other areas of patients’ sexuality are not routinely discussed. PMID:22443146

Prostaglandin E2 acts via bone marrow macrophages to block PTH-stimulated osteoblast differentiation in vitro

PubMed Central

Choudhary, Shilpa; Blackwell, Katherine; Voznesensky, Olga; Roy, Abhijit Deb; Pilbeam, Carol

2014-01-01

Intermittent PTH is the major anabolic therapy for osteoporosis while continuous PTH causes bone loss. PTH acts on the osteoblast (OB) lineage to regulate bone resorption and formation. PTH also induces cyclooxygenase-2 (COX-2), producing prostaglandin E2 (PGE2) that can act on both OBs and osteoclasts (OCs). Because intermittent PTH is more anabolic in Cox-2 knockout (KO) than wild type (WT) mice, we hypothesized COX-2 might contribute to the effects of continuous PTH by suppressing PTH-stimulated differentiation of mesenchymal stem cells into OBs. We compared effects of continuous PTH on bone marrow stromal cells (BMSCs) and primary OBs (POBs) from Cox-2 KO mice, mice with deletion of PGE2 receptors (Ptger4 and Ptger2 KO mice), and WT controls. PTH increased OB differentiation in BMSCs only in the absence of COX-2 expression or activity. In the absence of COX-2, PTH stimulated differentiation if added during the first week of culture. In Cox-2 KO BMSCs, PTH-stimulated differentiation was prevented by adding PGE2 to cultures. Co-culture of POBs with M-CSF-expanded bone marrow macrophages (BMMs) showed that the inhibition of PTH-stimulated OB differentiation required not only COX-2 or PGE2 but also BMMs. Sufficient PGE2 to mediate the inhibitory effect was made by either WT POBs or WT BMMs. The inhibitory effect mediated by COX-2/PGE2 was transferred by conditioned media from RANKL-treated BMMs and could be blocked by osteoprotegerin, which interferes with RANKL binding to its receptor on OC lineage cells. Deletion of Ptger4, but not Ptger2, in BMMs prevented the inhibition of PTH-stimulated OB differentiation. As expected, PGE2 also stimulated OB differentiation, but when given in combination with PTH, the stimulatory effects of both were abrogated. These data suggest that PGE2, acting via EP4R on BMMs committed to the OC lineage, stimulated secretion of a factor or factors that acted to suppress PTH-stimulated OB differentiation. This suppression of OB differentiation could contribute to the bone loss seen with continuous PTH in vivo. PMID:23639875

Broad-band BOS (BBYB) development and calibration in Taiwan

NASA Astrophysics Data System (ADS)

Lin, C. R.; Wang, C. C.; Kuo, B. Y.; Chen, P.; Jang, J. P.; Chang, H.; Laio, Y. C.; Chang, K. H.; Lin, F. S.

2016-12-01

Since 2009, combine with Academia Sinica, National Applied Research Laboratories and National Sun Yat-sen University formed ocean bottom seismograph (OBS) development team to develop sub-broadband OBS (called Yardbird OBS). Through a series deploy experiment at seafloor offshore Taiwan that got a lot of data can be used to study plate tectonics, seismic activity, source characteristics. Nowadays they have pretty good results already. Due to bandwidth limitations of the Yardbird OBS that inadequate to use for analyze global-scale earthquake. Therefor developing broadband ocean bottom seismograph is an important goal for the development team. Currently the broadband OBS (called BBYB) design and construction have completed the initial experiment phase. Due to underwater instruments always got high risk. Something accidentally making equipment sank in the sea cannot be recovery. Even recovery of equipment may also be causing poor performance because there is no data record. It cannot be to accomplish the experiment mission. In order to improve the OBS performance, avoid OBS dis-recovery or data collection is incomplete, must be sure all OBS's each component (such as seismic data recording device, balanced body, sonar dashboard, instruments and internal wiring ...) with well-done quality before assembly. Each component could go through very rigorous testing, strict and pick out the good components in the assembly process. Be sure all of produce the OBS under the water after a long deployment could successful recovery and got valuable data. In this presentation we will show a serial testing procedure and results for quality each BBYB component. Such as: Data logger: digitizer sensitivity, sampling rate, clock timing. Acoustic controller: function of Enable, Disable, Range, Release 1, Release 2, Option 1(Release disable). Air pressure gauge for glass ball: accuracy. A check lists of connector wiring check for assembling instrument. Design deploy and recovery procedure for operation on deck. We hope through repeated testing to ensure perfect performance of BBYB and apply the testing concept to another equipment for improve instruments performance. Keywords: ocean bottom seismograph (OBS); Data logger; Acoustic controller; Air pressure gauge.

Weighing the stigma of weight: An fMRI study of neural reactivity to the pain of obese individuals.

PubMed

Azevedo, R T; Macaluso, E; Viola, V; Sani, G; Aglioti, S M

2014-05-01

Explicit negative attitudes and blameful beliefs (e.g. poor diet, laziness) towards obese individuals are well documented and are pervasive even among health professionals. Here we sought to determine whether obesity stigma is reflected in a fundamental feature of intersubjectivity namely the automatic neural resonance with others' affective experiences. During fMRI, normal-weight female participants observed short clips depicting normal-weight (NW) and obese (Ob) models experiencing pain. Importantly, participants believed that half of the Ob were overweight due to a hormonal disorder (HormOb) and ignored the cause of obesity of the remaining models (Unknown obese models; UnkOb). Analyses of hemodynamic responses showed reduced activity to the pain of Ob compared to that of NW in areas associated with pain processing and early visual processing. The comparison between the two Ob conditions revealed a further decrease of activity to HormOb's pain compared to UnkOb's (and NW) pain in the right inferior frontal gyrus, an area associated with emotional resonance. Our study demonstrates that stigma for obese individuals can be observed at implicit levels, and that it is modulated by knowledge concerning the etiology of obesity, with the seemingly surprising result that obesity due to disease may result in greater stigmatization. Moreover, the perceived similarity with the models and the ambivalent emotion of pity may index biased brain responses to obese individuals' pain. The study highlights a possibly important neural link between resonance with the pain of others and obesity stigma. Copyright © 2013 Elsevier Inc. All rights reserved.

Antisense protein tyrosine phosphatase 1B reverses activation of p38 mitogen-activated protein kinase in liver of ob/ob mice.

PubMed

Gum, Rebecca J; Gaede, Lori L; Heindel, Matthew A; Waring, Jeffrey F; Trevillyan, James M; Zinker, Bradley A; Stark, Margery E; Wilcox, Denise; Jirousek, Michael R; Rondinone, Cristina M; Ulrich, Roger G

2003-06-01

Phosphorylation of stress-activated kinase p38, a MAPK family member, was increased in liver of ob/ob diabetic mice relative to lean littermates. Treatment of ob/ob mice with protein tyrosine phosphatase 1B (PTP1B) antisense oligonucleotides (ASO) reduced phosphorylation of p38 in liver-to below lean littermate levels-and normalized plasma glucose while reducing plasma insulin. Phosphorylation of ERK, but not JNK, was also decreased in ASO-treated mice. PTP1B ASO decreased TNFalpha protein levels and phosphorylation of the transcription factor cAMP response element binding protein (CREB) in liver, both of which can occur through decreased phosphorylation of p38 and both of which have been implicated in insulin resistance or hyperglycemia. Decreased p38 phosphorylation was not directly due to decreased phosphorylation of the kinases that normally phosphorylate p38-MKK3 and MKK6. Additionally, p38 phosphorylation was not enhanced in liver upon insulin stimulation of ASO-treated ob/ob mice (despite increased activation of other signaling molecules) corroborating that p38 is not directly affected via the insulin receptor. Instead, decreased phosphorylation of p38 may be due to increased expression of MAPK phosphatases, particularly the p38/ERK phosphatase PAC1 (phosphatase of activated cells). This study demonstrates that reduction of PTP1B protein using ASO reduces activation of p38 and its substrates TNFalpha and CREB in liver of diabetic mice, which correlates with decreased hyperglycemia and hyperinsulinemia.

Maternal obesity accelerates fetal pancreatic beta-cell but not alpha-cell development in sheep: prenatal consequences.

PubMed

Ford, Stephen P; Zhang, Liren; Zhu, Meijun; Miller, Myrna M; Smith, Derek T; Hess, Bret W; Moss, Gary E; Nathanielsz, Peter W; Nijland, Mark J

2009-09-01

Maternal obesity affects offspring weight, body composition, and organ function, increasing diabetes and metabolic syndrome risk. We determined effects of maternal obesity and a high-energy diet on fetal pancreatic development. Sixty days prior to breeding, ewes were assigned to control [100% of National Research Council (NRC) recommendations] or obesogenic (OB; 150% NRC) diets. At 75 days gestation, OB ewes exhibited elevated insulin-to-glucose ratios at rest and during a glucose tolerance test, demonstrating insulin resistance compared with control ewes. In fetal studies, ewes ate their respective diets from 60 days before to 75 days after conception when animals were euthanized under general anesthesia. OB and control ewes increased in body weight by approximately 43% and approximately 6%, respectively, from diet initiation until necropsy. Although all organs were heavier in fetuses from OB ewes, only pancreatic weight increased as a percentage of fetal weight. Blood glucose, insulin, and cortisol were elevated in OB ewes and fetuses on day 75. Insulin-positive cells per unit pancreatic area were 50% greater in fetuses from OB ewes as a result of increased beta-cell mitoses rather than decreased programmed cell death. Lambs of OB ewes were born earlier but weighed the same as control lambs; however, their crown-to-rump length was reduced, and their fat mass was increased. We conclude that increased systemic insulin in fetuses from OB ewes results from increased glucose exposure and/or cortisol-induced accelerated fetal beta-cell maturation and may contribute to premature beta-cell function loss and predisposition to obesity and metabolic disease in offspring.

OB/GYN boot cAMP using high-fidelity human simulators: enhancing residents' perceived competency, confidence in taking a leadership role, and stress hardiness.

PubMed

Pliego, Jose F; Wehbe-Janek, Hania; Rajab, M Hasan; Browning, Jeff L; Fothergill, Russell E

2008-01-01

To evaluate the effectiveness of an obstetrical and gynecologic (Ob/Gyn) Boot Camp simulation training on perceived technical competency, confidence in a leadership role, and stress hardiness of resident training. We conducted a prospective pilot study on the effectiveness of an Ob/Gyn Boot Camp on resident training. Residents participated in an intensive immersion in clinical simulation of common obstetrical emergencies including shoulder dystocia, neonatal resuscitation, postpartum hemorrhage, and ruptured ectopic pregnancy. After the training, residents completed a Web-based survey on their perceptions of how the Ob/Gyn Boot Camp affected their 1) technical competency in the assessment and management of their patients, 2) confidence in taking a leadership role, and 3) stress hardiness. Residents rated their perceptions on a Likert scale of 1 to 5, 1 = poor to 5 = excellent. Twenty-three (14 Ob/Gyn and 9 family medicine) residents participated in this pilot study. Eighteen (78%) residents completed the online survey; 4 Ob/Gyn and 1 family medicine resident did not complete the survey. The residents reported that the simulation training stimulated an interest in learning key skills for obstetrical and gynecologic emergencies. Ob/Gyn residents reported significant improvement in their perceived technical competence and stress hardiness after the Boot Camp. However both Ob/Gyn and family medicine residents reported no significant improvement of confidence in their leadership abilities during obstetrical emergencies after the Boot Camp. Boot Camp simulation training early in the curriculum has the potential for enhancing residents' self-assessments of confidence, competency, and stress hardiness in managing obstetrical emergencies.

Leptin deficiency suppresses MMTV-Wnt-1 mammary tumor growth in obese mice and abrogates tumor initiating cell survival.

PubMed

Zheng, Qiao; Dunlap, Sarah M; Zhu, Jinling; Downs-Kelly, Erinn; Rich, Jeremy; Hursting, Stephen D; Berger, Nathan A; Reizes, Ofer

2011-08-01

Obesity increases both the risk and mortality associated with many types of cancer including that of the breast. In mice, obesity increases both incidence of spontaneous tumors and burden of transplanted tumors. Our findings identify leptin, an adipose secreted cytokine, in promoting increased mammary tumor burden in obese mice and provide a link between this adipokine and cancer. Using a transplantable tumor that develops spontaneously in the murine mammary tumor virus-Wnt-1 transgenic mice, we show that tumors transplanted into obese leptin receptor (LepRb)-deficient (db/db) mice grow to eight times the volume of tumors transplanted into lean wild-type (WT) mice. However, tumor outgrowth and overall tumor burden is reduced in obese, leptin-deficient (ob/ob) mice. The residual tumors in ob/ob mice contain fewer undifferentiated tumor cells (keratin 6 immunopositive) compared with WT or db/db mice. Furthermore, tumors in ob/ob mice contain fewer cells expressing phosphorylated Akt, a growth promoting kinase activated by the LepRb, compared with WT and db/db mice. In vivo limiting dilution analysis of residual tumors from ob/ob mice indicated reduced tumor initiating activity suggesting fewer cancer stem cells (CSCs). The tumor cell populations reduced by leptin deficiency were identified by fluorescence-activated cell sorting and found to express LepRb. Finally, LepRb expressing tumor cells exhibit stem cell characteristics based on the ability to form tumorspheres in vitro and leptin promotes their survival. These studies provide critical new insight on the role of leptin in tumor growth and implicate LepRb as a CSC target.

Wind collisions in three massive stars of Cygnus OB2

NASA Astrophysics Data System (ADS)

Cazorla, Constantin; Nazé, Yaël; Rauw, Gregor

2014-01-01

Aims: We wish to study the origin of the X-ray emission of three massive stars in the Cyg OB2 association: Cyg OB2 #5, Cyg OB2 #8A, and Cyg OB2 #12. Methods: To this aim, dedicated X-ray observations from XMM-Newton and Swift are used, as well as archival ROSAT and Suzaku data. Results: Our results on Cyg OB2 #8A improve the phase coverage of the orbit and confirm previous studies: the signature of a wind-wind collision is conspicuous. In addition, signatures of a wind-wind collision are also detected in Cyg OB2 #5, but the X-ray emission appears to be associated with the collision between the inner binary and the tertiary component orbiting it with a 6.7 yr period, without a putative collision inside the binary. The X-ray properties strongly constrain the orbital parameters, notably allowing us to discard some proposed orbital solutions. To improve the knowledge of the orbit, we revisit the light curves and radial velocity of the inner binary, looking for reflex motion induced by the third star. Finally, the X-ray emission of Cyg OB2 #12 is also analyzed. It shows a marked decrease in recent years, compatible with either a wind-wind collision in a wide binary or the aftermath of a recent eruption. Based on observations collected at the Observatoire de Haute Provence (OHP) as well as with Swift and XMM-Newton.Tables 1-3 and 5 are available in electronic form at http://www.aanda.org

Harsh Parenting and Food Insecurity in Adolescence: The Association With Emerging Adult Obesity.

PubMed

Lohman, Brenda J; Gillette, Meghan T; Neppl, Tricia K

2016-07-01

As the first study of its kind, the overall purpose of this article was to examine the relationships and interactions between harsh parenting (HP) and food insecurity (FI) in adolescence on the development of overweight/obesity (OW/OB) in emerging adulthood. Data came from the Iowa Youth and Families Project, a longitudinal study of 451 adolescent youth and their families that began in 1989 in the rural Midwest. Adolescents were aged 13 years at the initial assessment, and weight status in emerging adulthood was measured 10 years later at age 23. Experiencing HP in adolescence predicted greater odds of OW/OB at 23 years old. Higher body mass indexes of the adolescent and his or her father in adolescence also increased the odds of being OW/OB at 23 years. Having parents with higher levels of education lowered the odds of being OW/OB in emerging adulthood. Finally, females who experienced high levels of FI and HP in adolescence had higher odds of OW/OB at 23 years in comparison to males. HP, in combination with FI in adolescence, predicted OW/OB for females in emerging adulthood but not for males. This study contributes to an understanding of the interplay between multiple influences in adolescence: namely, parenting and economic influences. Assessing antecedents to OW/OB in emerging adulthood via multiple pathways provides a more complex understanding of how and why adolescents turn into OW/OB adults. Copyright © 2016 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

Maternal obesity accelerates fetal pancreatic β-cell but not α-cell development in sheep: prenatal consequences

PubMed Central

Ford, Stephen P.; Zhang, Liren; Zhu, Meijun; Miller, Myrna M.; Smith, Derek T.; Hess, Bret W.; Moss, Gary E.; Nathanielsz, Peter W.; Nijland, Mark J.

2009-01-01

Maternal obesity affects offspring weight, body composition, and organ function, increasing diabetes and metabolic syndrome risk. We determined effects of maternal obesity and a high-energy diet on fetal pancreatic development. Sixty days prior to breeding, ewes were assigned to control [100% of National Research Council (NRC) recommendations] or obesogenic (OB; 150% NRC) diets. At 75 days gestation, OB ewes exhibited elevated insulin-to-glucose ratios at rest and during a glucose tolerance test, demonstrating insulin resistance compared with control ewes. In fetal studies, ewes ate their respective diets from 60 days before to 75 days after conception when animals were euthanized under general anesthesia. OB and control ewes increased in body weight by ∼43% and ∼6%, respectively, from diet initiation until necropsy. Although all organs were heavier in fetuses from OB ewes, only pancreatic weight increased as a percentage of fetal weight. Blood glucose, insulin, and cortisol were elevated in OB ewes and fetuses on day 75. Insulin-positive cells per unit pancreatic area were 50% greater in fetuses from OB ewes as a result of increased β-cell mitoses rather than decreased programmed cell death. Lambs of OB ewes were born earlier but weighed the same as control lambs; however, their crown-to-rump length was reduced, and their fat mass was increased. We conclude that increased systemic insulin in fetuses from OB ewes results from increased glucose exposure and/or cortisol-induced accelerated fetal β-cell maturation and may contribute to premature β-cell function loss and predisposition to obesity and metabolic disease in offspring. PMID:19605766

Perceived relevance of oral biology by dental students.

PubMed

Scheven, B A A

2012-02-01

This study investigated the perception that dental students have regarding the relevance of oral biology (OB) to dental education and dentistry in general. Moreover, this study analysed students' attitude towards OB learning approaches and resources. A questionnaire based on a Likert scale was used to survey pre-clinical/second (BDS2)- and final/fifth (BDS5)-year dental students at the School of Dentistry of the University of Birmingham (United Kingdom). In comparison, a small group of postgraduate specialist registrars were surveyed to evaluate the attitudes of practising dentists. The results show that all study groups expressed a high level of perceived relevance of OB to dentistry. Students' perception of OB for dental education, clinical training and practice also scored high. More than 40% of undergraduate students and about 55% of the postgraduates indicated a perceived change in their attitude towards OB with time characterised by increased appreciation of the subject. Lectures were considered as the most important teaching approach, whereas 'group poster projects' ranked lowest. Of the different study resources, lecture handouts received the overall highest importance score. The results indicate that dental students considered OB relevant for dental education and dentistry and suggest a positive attitude towards the subject. This study also suggested that dental students prefer teacher-centred/led teaching rather than student-directed learning of OB. The article addresses the role of OB and science-related research projects within the dental curriculum and discusses that close integration of basic sciences with dental education may enrich dental education and overall learning experience. © 2011 John Wiley & Sons A/S.

Lining bunker walls with oxygen barrier film reduces nutrient losses in corn silages.

PubMed

Lima, L M; Dos Santos, J P; Casagrande, D R; Ávila, C L S; Lara, M S; Bernardes, T F

2017-06-01

The objective of this study was to evaluate 2 systems for covering corn silage in bunker silos. The first system consisted of a sheet of 45-μm-thick oxygen barrier film (OB, polyethylene + ethylene-vinyl alcohol) placed along the length of the sidewall before filling. After filling, the excess film was pulled over the wall on top of the silage, and a sheet of polyethylene was placed on top. The second system involved using a standard sheet (ST) of 180-μm-thick polyethylene film. Eight commercial bunker silos were divided into 2 parts lengthwise so that one-half of the silo was covered with OB and the other half with a ST system. During the filling, 3 net bags with chopped corn were buried in the central part (halfway between the top and bottom of the silo) of the bunkers (CCOR) in 3 sections 10 m apart. After filling, 18 net bags (9 per covering system) were buried 40 cm below the top surface of the 3 sections. These bags were placed at 3 distances from the bunker walls (0 to 50 cm, 51 to 100 cm, and 101 to 150 cm). During unloading, the bags were removed from the silos to determine the dry matter (DM) losses, fermentation end products, and nutritive value. The Milk2006 spreadsheet was used to estimate milk per tonne of DM. The model included the fixed effect of treatment (7 different locations in the bunker) and the random effect of the silo. Two contrasts were tested to compare silages in the top laterals (shoulders) with that in the CCOR (CCOR vs. OB and CCOR vs. ST). Three contrasts compared the corresponding distances of the silage covered by the 2 systems (OB50 vs. ST50, OB100 vs. ST100 and OB150 vs. ST150). Variables were analyzed with the PROC MIXED procedure of the SAS at the 5% level. The OB method produced well-fermented silages, which were similar to CCOR, whereas the OB system showed less lactic acid and greater pH and mold counts compared with CCOR. The ST method had 116.2 kg of milk/t less than the CCOR, as the OB system and the CCOR were similar (1,258.3 and 1,294.0 kg/t, respectively). Regarding the distances from the walls, the effects were more pronounced from 0 to 101 cm. The OB50 and OB100 silages had better quality and lower mold counts and DM losses than ST50 and ST100. The OB system reduced DM and nutrient losses at the shoulders in farm bunker corn silages compared with no sidewall plastic. The OB film should lap onto the crop for at least 200 cm so that 150 cm are covered outward from the wall. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

A Behavioral Approach to Improving Self-Care Skills in OBS Patients.

ERIC Educational Resources Information Center

McEvoy, Cathy L.; Patterson, Roger L.

Traditionally, the treatment of geriatric patients suffering from Organic Brain Syndrome (OBS) has been characterized by non-therapeutic custodial care. To determine whether elderly clients with dementia can benefit from self-care skill training, and to compare their progress with clients without OBS, 30 clients of the Residential Aging Program in…

Cross-cultural industrial organizational psychology and organizational behavior: A hundred-year journey.

PubMed

Gelfand, Michele J; Aycan, Zeynep; Erez, Miriam; Leung, Kwok

2017-03-01

In celebration of the anniversary of the Journal of Applied Psychology ( JAP ), we take a hundred-year journey to examine how the science of cross-cultural industrial/organizational psychology and organizational behavior (CCIO/OB) has evolved, both in JAP and in the larger field. We review broad trends and provide illustrative examples in the theoretical, methodological, and analytic advances in CCIO/OB during 4 main periods: the early years (1917-1949), the middle 20th century (1950-1979), the later 20th century (1980-2000), and the 21st century (2000 to the present). Within each period, we discuss key historical and societal events that influenced the development of the science of CCIO/OB, major trends in research on CCIO/OB in the field in general and JAP in particular, and important milestones and breakthroughs achieved. We highlight pitfalls in research on CCIO/OB and opportunities for growth. We conclude with recommendations for the next 100 years of CC IO/OB research in JAP and beyond. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

The CIDA-QUEST large-scale survey of Orion OB1: evidence for rapid disk dissipation in a dispersed stellar population.

PubMed

Briceño, C; Vivas, A K; Calvet, N; Hartmann, L; Pacheco, R; Herrera, D; Romero, L; Berlind, P; Sánchez, G; Snyder, J A; Andrews, P

2001-01-05

We are conducting a large-scale, multiepoch, optical photometric survey [Centro de Investigaciones de Astronomia-Quasar Equatorial Survey Team (CIDA-QUEST)] covering about 120 square degrees to identify the young low-mass stars in the Orion OB1 association. We present results for an area of 34 square degrees. Using photometric variability as our main selection criterion, as well as follow-up spectroscopy, we confirmed 168 previously unidentified pre-main sequence stars that are about 0.6 to 0.9 times the mass of the sun (Mo), with ages of about 1 million to 3 million years (Ori OB1b) and about 3 million to 10 million years (Ori OB1a). The low-mass stars are spatially coincident with the high-mass (at least 3 Mo) members of the associations. Indicators of disk accretion such as Halpha emission and near-infrared emission from dusty disks fall sharply from Ori OB1b to Ori OB1a, indicating that the time scale for disk dissipation and possibly the onset of planet formation is a few million years.

Oligoclonal and monoclonal bands after single autologous stem cell transplant in patients with multiple myeloma: impact on overall survival and progression-free survival.

PubMed

Jimenez-Zepeda, Victor H; Reece, Donna E; Trudel, Suzanne; Franke, Norman; Winter, Andrew; Chen, Christine; Tiedemann, Rodger; Kukreti, Vishal

2014-10-01

Abstract Recently, the occurrence of oligoclonal and monoclonal bands (OB/MB) unrelated to the original clone has been reported in patients with multiple myeloma who undergo autologous stem cell transplant (ASCT) and/or receive treatment with novel agents. The aim of our study was to assess the impact of OB/MB occurrence on overall (OS) and progression-free survival (PFS) for patients with MM undergoing single ASCT at our institution. All consecutive patients with documented MM undergoing single ASCT from January 2000 to December 2012 were evaluated. Ninety-nine patients (11.8%) developed OB/MB at day 100 post-ASCT (32.3%, OB and 67.7%, MB). Multivariate analysis identified the development of OBs/MBs as an independent favorable prognostic factor for OS and PFS (p = 0.008 and 0.012, respectively). In conclusion, the occurrence of OB/MB is an important prognostic factor in patients with MM who undergo ASCT. Its impact on clinical outcomes should be prospectively validated and its biological significance further elucidated.

Genistein treatment increases bone mass in obese, hyperglycemic mice.

PubMed

Michelin, Richard M; Al-Nakkash, Layla; Broderick, Tom L; Plochocki, Jeffrey H

2016-01-01

Obesity and type 2 diabetes mellitus are associated with elevated risk of limb bone fracture. Incidences of these conditions are on the rise worldwide. Genistein, a phytoestrogen, has been shown by several studies to demonstrate bone-protective properties and may improve bone health in obese type 2 diabetics. In this study, we test the effects of genistein treatment on limb bone and growth plate cartilage histomorphometry in obese, hyperglycemic ob/ob mice. Six-week-old ob/ob mice were divided into control and genistein-treated groups. Genistein-treated mice were fed a diet containing 600 mg genistein/kg for a period of 4 weeks. Cross-sectional geometric and histomorphometric analyses were conducted on tibias. Genistein-treated mice remained obese and hyperglycemic. However, histomorphometric comparisons show that genistein-treated mice have greater tibial midshaft diameters and ratios of cortical bone to total tissue area than the controls. Genistein-treated mice also exhibit decreased growth plate thickness of the proximal tibia. Our results indicate that genistein treatment affects bone of the tibial midshaft in the ob/ob mouse, independent of improvements in the hyperglycemic state and body weight.

The daidzein- and estradiol- induced anorectic action in CCK or leptin receptor deficiency rats.

PubMed

Fujitani, Mina; Mizushige, Takafumi; Bhattarai, Keshab; Iwahara, Asami; Aida, Ryojiro; Kishida, Taro

2015-01-01

We investigated the effect of daidzein feeding and estradiol treatment on food intake in cholecystokinin-1 receptor (CCK1R) deficiency, leptin receptor (ObRb) deficiency rats and their wild-type rats. These rats underwent an ovariectomy or a sham operation. For the 5 week experiment, each rat was divided in three groups: control, daidzein (150 mg/kg diet), and estradiol (4.2 μg/rat/day) groups. In both CCK1R+ and CCK1R- rats, daidzein feeding and estradiol treatment significantly decreased food intake. Daidzein feeding significantly reduced food intake in ovariectomized ObRb- rats, although not in ObRb+ rats. Estradiol treatment significantly lowered food intake in ovariectomized ObRb+ and ObRb- rats. In the ovariectomized rats, estradiol treatment significantly increases uterine weight, while daidzein feeding did not change it, suggesting that daidzein might have no or weak estrogenic effect in our experiment. These results suggest that CCK1R and ObRb signalings were not essential for the daidzein- and estradiol-induced anorectic action.

Ablation of ghrelin O-acyltransferase does not improve glucose intolerance or body adiposity in mice on a leptin-deficient ob/ob background.

PubMed

Kirchner, Henriette; Heppner, Kristy M; Holland, Jenna; Kabra, Dhiraj; Tschöp, Matthias H; Pfluger, Paul T

2013-01-01

Type 2 Diabetes is a global health burden and based on current estimates will become an even larger problem in the future. Developing new strategies to prevent and treat diabetes is a scientific challenge of high priority. The stomach hormone ghrelin has been associated with playing a role in the regulation of glucose homeostasis. However, its precise mechanism and impact on whole glucose metabolism remains to be elucidated. This study aims to clarify the role of the two ghrelin isoforms acyl- and desacyl ghrelin in regulating glucose homeostasis. Therefore ghrelin activating enzyme Ghrelin-O-acyltransferase (GOAT) was ablated in leptin-deficient ob/ob mice to study whether specific acyl ghrelin deficiency or desacyl ghrelin abundance modifies glucose tolerance on a massively obese background. As targeted deletion of acyl ghrelin does not improve glucose homeostasis in our GOAT-ob/ob mouse model we conclude that neither acyl ghrelin nor the increased ratio of desacyl/acyl ghrelin is crucial for controlling glucose homeostasis in the here presented model of massive obesity induced by leptin deficiency.

Association of Obesity, BMI, and Hispanic Ethnicity on Ambulatory Status in Children with Spinal Dysraphism followed near the California-Mexico Border.

PubMed

McDonald, Michelle L; Huang, Andy; Proudfoot, James A; Le, Joan T; Chiang, George J; Bush, Ruth A

2016-01-01

Evaluate the relationship between body mass index (BMI), overweight status (OW), or obesity (OB) and ambulatory status in a predominantly Hispanic population of children with spinal dysraphism (SD). Retrospective data were extracted from records of 272 children and youth aged 0-24 years with a diagnosis of SD. Body mass index (BMI) and OW / OB rates were calculated for children 0-3 years, 4-11 years, and adolescents older than 11. Ethnicity was predominantly Hispanic (65.4%). No difference in mean BMI or OW / OB rate was found between ambulation groups (p = .20; p = .72). Mean BMI and OW / OB rate increased with increasing age in all groups (p < .001; p = .02). Forty-four percent of patients were OW / OB, which was greater among Hispanics (48.2%) compared with non-Hispanics [(35.2%), p = .03]. Female gender was a risk factor for increased BMI among Hispanics (p = .00). Despite no difference in ambulatory status, increasing BMI and OW / OB are associated with Hispanic ethnicity and increasing age.

Obliterative bronchiolitis in fibreglass workers: a new occupational disease?

PubMed

Cullinan, Paul; McGavin, Clive R; Kreiss, Kathleen; Nicholson, Andrew G; Maher, Toby M; Howell, Tim; Banks, John; Newman Taylor, Anthony J; Chen, Chi-Hsien; Tsai, Perng-Jy; Shih, Tung-Sheng; Burge, P Sherwood

2013-05-01

Obliterative bronchiolitis (OB) is a rare disease with a small number of established occupational aetiologies. We describe a case series of severe OB in workers making glass-reinforced plastics. Workplace exposures were the likely cause after the independent diagnosis of OB in two workers laying up the fibreglass hulls of yachts; the second worker took over the job of the first after he left following a lung transplant. Presentation of these two cases at international meetings led to others identifying similar workers. We identified six workers with good evidence of OB. All were involved in preparing fibreglass with styrene resins, five as boat builders laying up fibreglass hulls and one during cooling-tower fabrication. The disease came on rapidly without unusual acute exposures. Two patients had lung transplants, while another died while waiting for one. Histology confirmed OB in the four with biopsies/post-mortem examinations or explanted lungs. A rare, potentially fatal disease occurring in six workers laying up fibreglass with styrene resins from five different worksites suggests that work exposures were the cause of their OB. The precise agent responsible awaits identification.

On Chorin's Method for Stationary Solutions of the Oberbeck-Boussinesq Equation

NASA Astrophysics Data System (ADS)

Kagei, Yoshiyuki; Nishida, Takaaki

2017-06-01

Stability of stationary solutions of the Oberbeck-Boussinesq system (OB) and the corresponding artificial compressible system is considered. The latter system is obtained by adding the time derivative of the pressure with small parameter ɛ > 0 to the continuity equation of (OB), which was proposed by A. Chorin to find stationary solutions of (OB) numerically. Both systems have the same sets of stationary solutions and the system (OB) is obtained from the artificial compressible one as the limit ɛ \\to 0 which is a singular limit. It is proved that if a stationary solution of the artificial compressible system is stable for sufficiently small ɛ > 0, then it is also stable as a solution of (OB). The converse is proved provided that the velocity field of the stationary solution satisfies some smallness condition.

New Low-Mass Wide Companions to Members of the Sco-Cen OB Association

NASA Astrophysics Data System (ADS)

Finn, Molly; Mamajek, Eric E.; Luhman, Kevin; Murphy, Simon

2017-01-01

We have conducted a survey for wide common proper motion companions to 512 members of the Upper Cen-Lup (UCL) and Lower Cen-Cru (LCC) subgroups of the Sco-Cen OB association using astrometry and photometry from the SPM4 catalog. Companion candidates were selected within 3 arcminutes (23 kau = 0.11 pc at d = 130 pc). We find that 12% of the Sco-Cen members have stellar companions in the separation range 3-20 kau. Optical spectra of 16 candidate companions were taken with the new COSMOS spectrograph on the Blanco 4-m telescope and the Wide Field Spectrograph on the Australian National University 2.3-m telescope. The spectroscopic survey yielded 14 M-type stars with Na I surface gravity index indicative of pre-MS status, of which half were Li-rich (along with two background giant interlopers). Seven stars in the range M1-M4.5 appear to be Li depleted, but otherwise seem to be pre-MS due to their chromospheric activity, low surface gravity via the Na I index, and their co- movement with other young stars in Sco-Cen. We suggest that these stars represent the Li depletion boundary for UCL and LCC. We acknowledge support from NSF award AST-1313029 and the REU Site in Physics and Astrophysics at the University of Rochester supported by NSF award PHY-1156339.

Microseism Source Distribution Observed from Ireland

NASA Astrophysics Data System (ADS)

Craig, David; Bean, Chris; Donne, Sarah; Le Pape, Florian; Möllhoff, Martin

2017-04-01

Ocean generated microseisms (OGM) are recorded globally with similar spectral features observed everywhere. The generation mechanism for OGM and their subsequent propagation to continental regions has led to their use as a proxy for sea-state characteristics. Also many modern seismological methods make use of OGM signals. For example, the Earth's crust and upper mantle can be imaged using ``ambient noise tomography``. For many of these methods an understanding of the source distribution is necessary to properly interpret the results. OGM recorded on near coastal seismometers are known to be related to the local ocean wavefield. However, contributions from more distant sources may also be present. This is significant for studies attempting to use OGM as a proxy for sea-state characteristics such as significant wave height. Ireland has a highly energetic ocean wave climate and is close to one of the major source regions for OGM. This provides an ideal location to study an OGM source region in detail. Here we present the source distribution observed from seismic arrays in Ireland. The region is shown to consist of several individual source areas. These source areas show some frequency dependence and generally occur at or near the continental shelf edge. We also show some preliminary results from an off-shore OBS network to the North-West of Ireland. The OBS network includes instruments on either side of the shelf and should help interpret the array observations.

Metabolic profiling of ob/ob mouse fatty liver using HR-MAS 1H-NMR combined with gene expression analysis reveals alterations in betaine metabolism and the transsulfuration pathway.

PubMed

Gogiashvili, Mikheil; Edlund, Karolina; Gianmoena, Kathrin; Marchan, Rosemarie; Brik, Alexander; Andersson, Jan T; Lambert, Jörg; Madjar, Katrin; Hellwig, Birte; Rahnenführer, Jörg; Hengstler, Jan G; Hergenröder, Roland; Cadenas, Cristina

2017-02-01

Metabolic perturbations resulting from excessive hepatic fat accumulation are poorly understood. Thus, in this study, leptin-deficient ob/ob mice, a mouse model of fatty liver disease, were used to investigate metabolic alterations in more detail. Metabolites were quantified in intact liver tissues of ob/ob (n = 8) and control (n = 8) mice using high-resolution magic angle spinning (HR-MAS) 1 H-NMR. In addition, after demonstrating that HR-MAS 1 H-NMR does not affect RNA integrity, transcriptional changes were measured by quantitative real-time PCR on RNA extracted from the same specimens after HR-MAS 1 H-NMR measurements. Importantly, the gene expression changes obtained agreed with those observed by Affymetrix microarray analysis performed on RNA isolated directly from fresh-frozen tissue. In total, 40 metabolites could be assigned in the spectra and subsequently quantified. Quantification of lactate was also possible after applying a lactate-editing pulse sequence that suppresses the lipid signal, which superimposes the lactate methyl resonance at 1.3 ppm. Significant differences were detected for creatinine, glutamate, glycine, glycolate, trimethylamine-N-oxide, dimethylglycine, ADP, AMP, betaine, phenylalanine, and uridine. Furthermore, alterations in one-carbon metabolism, supported by both metabolic and transcriptional changes, were observed. These included reduced demethylation of betaine to dimethylglycine and the reduced expression of genes coding for transsulfuration pathway enzymes, which appears to preserve methionine levels, but may limit glutathione synthesis. Overall, the combined approach is advantageous as it identifies changes not only at the single gene or metabolite level but also deregulated pathways, thus providing critical insight into changes accompanying fatty liver disease. Graphical abstract A Evaluation of RNA integrity before and after HR-MAS 1 H-NMR of intact mouse liver tissue. B Metabolite concentrations and gene expression levels assessed in ob/ob (steatotic) and ob/+ (control) mice using HR-MAS 1 H-NMR and qRT-PCR, respectively.

The effects of thiazolidinediones on human bone marrow stromal cell differentiation in vitro and in thiazolidinedione-treated patients with type 2 diabetes.

PubMed

Beck, George R; Khazai, Natasha B; Bouloux, Gary F; Camalier, Corinne E; Lin, Yiming; Garneys, Laura M; Siqueira, Joselita; Peng, Limin; Pasquel, Francisco; Umpierrez, Denise; Smiley, Dawn; Umpierrez, Guillermo E

2013-03-01

Thiazolidinedione (TZD) therapy has been associated with an increased risk of bone fractures. Studies in rodents have led to a model in which decreased bone quality in response to TZDs is due to a competition of lineage commitment between osteoblasts (OBs) and adipocytes (ADs) for a common precursor cell, resulting in decreased OB numbers. Our goal was to investigate the effects of TZD exposure on OB-AD lineage determination from primary human bone marrow stromal cells (hBMSCs) both in vitro and in vivo from nondiabetic subjects and patients with type 2 diabetics. Our experimental design included 2 phases. Phase 1 was an in vitro study of TZD effects on the differentiation of hBMSCs into OBs and ADs in nondiabetic subjects. Phase 2 was a randomized, placebo-controlled trial to determine the effects of 6-month pioglitazone treatment in vivo on hBMSC differentiation using AD/OB colony forming unit assays in patients with type 2 diabetes. In vitro, TZDs (pioglitazone and rosiglitazone) enhanced the adipogenesis of hBMSCs, whereas neither altered OB differentiation or function as measured by alkaline phosphatase activity, gene expression, and mineralization. The ability of TZDs to enhance adipogenesis occurred at a specific time/stage of the differentiation process, and pretreating with TZDs did not further enhance adipogenesis. In vivo, 6-month TZD treatment decreased OB precursors, increased AD precursors, and increased total colony number in patients with type 2 diabetes. Our results indicate that TZD exposure in vitro potently stimulates adipogenesis but does not directly alter OB differentiation/mineralization or lineage commitment from hBMSCs. However, TZD treatment in type 2 diabetic patients results in decreased osteoblastogenesis from hBMSCs compared with placebo, indicating an indirect negative effect on OBs and suggesting an alternative model by which TZDs might negatively regulate bone quality. Copyright © 2013 Mosby, Inc. All rights reserved.

Peritumoral adipose tissue as a source of inflammatory and angiogenic factors in colorectal cancer.

PubMed

Amor, S; Iglesias-de la Cruz, M C; Ferrero, E; García-Villar, O; Barrios, V; Fernandez, N; Monge, L; García-Villalón, A L; Granado, M

2016-02-01

Obesity is a risk factor for the development of human colorectal cancer (CC). The aim of this work is to report the inflammatory and angiogenic scenario in lean (BMI < 25 kg/m2) and obese (BMI > 30 kg/m2) patients with and without CC and to assess the role of peritumoral adipose tissue in CC-induced inflammation. Patients were divided in four experimental groups: obese patients with CC (OB-CC), lean patients with CC (LEAN-CC), obese patients without CC (OB), and lean patients without CC (LEAN). Plasma levels of pro-inflammatory cytokines (interleukin (IL)-6, IL-4, IL-8) and granulocyte-macrophage colony-stimulating factor (GM-CSF) were increased in OB-CC patients. Peritumoral adipose tissue (TF) explants and cultured mature adipocytes secreted higher amounts of nitrites and nitrates than did control and non-tumoral (NTF) adipose tissue both alone and in response to lipopolysaccharide (LPS). Nitrite and nitrate secretion was also increased in TF explants from OB-CC patients compared with that from LEAN-CC patients. Gene expression of adiponectin, tumor necrosis factor alpha (TNF-α), insulin-like growth factor type I (IGF-I), cyclooxygenase-2 (COX-2), and peroxisome proliferator-activated receptor γ (PPAR-γ) was increased in TF explants from CC patients. LPS increased the gene expression of IL-6, IL-10, TNF-α, vascular endothelial growth factor (VEGF), and COX-2 in OB and in TF explants from OB-CC patients. COX-2 and PPAR-γ inhibition further increased LPS-induced release of nitrites and nitrates in TF explants and adipocytes from OB-CC patients. In conclusion, OB-CC patients have increased plasma levels of pro-inflammatory and angiogenic factors. TF from OB-CC patients shows an increased secretion of inflammatory markers compared with both TF from LEAN-CC and non-tumoral adipose tissue (AT) through a COX-2- and PPAR-γ-independent mechanism.

The Stem Cell Marker Lgr5 Defines a Subset of Postmitotic Neurons in the Olfactory Bulb.

PubMed

Yu, Yiqun; Moberly, Andrew H; Bhattarai, Janardhan P; Duan, Chen; Zheng, Qian; Li, Fangqi; Huang, Hugh; Olson, William; Luo, Wenqin; Wen, Tieqiao; Yu, Hongmeng; Ma, Minghong

2017-09-27

Lgr5, leucine-rich repeat-containing G-protein coupled receptor 5, is a bona fide biomarker for stem cells in multiple tissues. Lgr5 is also expressed in the brain, but the identities and properties of these Lgr5 + cells are still elusive. Using an Lgr5-EGFP reporter mouse line, we found that, from early development to adulthood, Lgr5 is highly expressed in the olfactory bulb (OB), an area with ongoing neurogenesis. Immunostaining with stem cell, glial, and neuronal markers reveals that Lgr5 does not label stem cells in the OB but instead labels a heterogeneous population of neurons with preference in certain subtypes. Patch-clamp recordings in OB slices reveal that Lgr5-EGFP + cells fire action potentials and display spontaneous excitatory postsynaptic events, indicating that these neurons are integrated into OB circuits. Interestingly, R-spondin 3, a potential ligand of Lgr5, is also expressed in the adult OB. Collectively, our data indicate that Lgr5-expressing cells in the OB are fully differentiated neurons and imply distinct roles of Lgr5 and its ligand in postmitotic cells. SIGNIFICANCE STATEMENT Lgr5 (leucine-rich repeat-containing G-protein coupled receptor 5) is a bona fide stem cell marker in many body organs. Here we report that Lgr5 is also highly expressed in the olfactory bulb (OB), the first relay station in the brain for processing odor information and one of the few neural structures that undergo continuous neurogenesis. Surprisingly, Lgr5 is not expressed in the OB stem cells, but instead in a few subtypes of terminally differentiated neurons, which are incorporated into the OB circuit. This study reveals that Lgr5 + cells in the brain represent a nonstem cell lineage, implying distinct roles of Lgr5 in postmitotic neurons. Copyright © 2017 the authors 0270-6474/17/379403-12$15.00/0.

Manta A New BroadBand OBS

NASA Astrophysics Data System (ADS)

Hello, Y.; Yegikyan, M.; Charvis, P.; Philippe, O.

2017-12-01

Manta is a new BroadBand OBS developed at Geoazur and commercialized by Osean. The design is inspired by 3-years autonomy MUG-OBS a Multiparameter Ocean Bottom System which carry a lot of sort of sensor types. As Mug-OBS, Manta-OBS rated 6000m is designed to resist a trawling. All the components are non corrosive such polyethylene, titanium and buoyancy is ensured by syntactic foam. Equipped in standard version with a Trillium compact OBS Manta has an autonomy of 18 months, but can accept on its 4 input channels any kind of signal as low as from an hydrophone or larger from other type of a seismometer or accelerometer. Tri-axial geophones unit (2 Hz or 4.5 Hz ) can replace the seismometer and will expend the lifespan for the instrument. The seismometer is encapsulated in a central well established by four panels of the main structure to protect it from sea current convection and is decoupled from main chassis. An health bulletin is recoverable by acoustic any time to facilitate the installation and during a visit when instrument is deployed. Main parameters for acquisition can be changed by acoustics command from surface at any time. Once at the bottom, release for the main sensor installation is programmed on a timer but controlled by the tilt of the OBS. If the tilt is too important based on programmed limits, sensor will not released automatically, but this can be forced by acoustic command after returning the tilt informations to the boat operator. Manta is equipped with flash light and AIS system for easy location at recovery, and can also send it's position by Iridium satellite in case of an unexpected ascent such caused by a possible trawling if deployed in shallow water. Clock drift calculation is automatically made against GPS time signal once the OBS return at the surface. The recovery of the OBS is initiated by an acoustic command. These new features made Manta a very versatile instrument for monitoring earthquakes.

A Chrysodeixis chalcites Single-Nucleocapsid Nucleopolyhedrovirus Population from the Canary Islands Is Genotypically Structured To Maximize Survival

PubMed Central

Bernal, Alexandra; Simón, Oihane; Williams, Trevor; Muñoz, Delia

2013-01-01

A Chrysodeixis chalcites single-nucleocapsid nucleopolyhedrovirus wild-type isolate from the Canary Islands, Spain, named ChchSNPV-TF1 (ChchTF1-wt), appears to have great potential as the basis for a biological insecticide for control of the pest. An improved understanding of the genotypic structure of this wild-type strain population should facilitate the selection of genotypes for inclusion in a bioinsecticidal product. Eight genetically distinct genotypes were cloned in vitro: ChchTF1-A to ChchTF1-H. Quantitative real-time PCR (qPCR) analysis confirmed that ChchTF1-A accounted for 36% of the genotypes in the wild-type population. In bioassays, ChchTF1-wt occlusion bodies (OBs) were significantly more pathogenic than any of the component single-genotype OBs, indicating that genotype interactions were likely responsible for the pathogenicity phenotype of wild-type OBs. However, the wild-type population was slower killing and produced higher OB yields than any of the single genotypes alone. These results strongly suggested that the ChchTF1-wt population is structured to maximize its transmission efficiency. Experimental OB mixtures and cooccluded genotype mixtures containing the most abundant and the rarest genotypes, at frequencies similar to those at which they were isolated, revealed a mutualistic interaction that restored the pathogenicity of OBs. In OB and cooccluded mixtures containing only the most abundant genotypes, ChchTF1-ABC, OB pathogenicity was even greater than that of wild-type OBs. The ChchTF1-ABC cooccluded mixture killed larvae 33 h faster than the wild-type population and remained genotypically and biologically stable throughout five successive passages in vivo. In conclusion, the ChchTF1-ABC mixture shows great potential as the active ingredient of a bioinsecticide to control C. chalcites in the Canary Islands. PMID:24096419

Deletion Genotypes Reduce Occlusion Body Potency but Increase Occlusion Body Production in a Colombian Spodoptera frugiperda Nucleopolyhedrovirus Population

PubMed Central

Barrera, Gloria; Williams, Trevor; Villamizar, Laura; Caballero, Primitivo; Simón, Oihane

2013-01-01

A Colombian field isolate (SfCOL-wt) of Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV) is a mixture of different genotypes. To evaluate the insecticidal properties of the different genotypic variants, 83 plaque purified virus were characterized. Ten distinct genotypes were identified (named A through J). SfCOL-A was the most prevalent (71±2%; mean ± SE) showing a PstI restriction profile indistinguishable to that of SfCOL-wt. The remaining nine genotypes presented genomic deletions of 3.8 - 21.8 Kb located mainly between nucleotides 11,436 and 33,883 in the reference genome SfMNPV-B, affecting the region between open reading frames (ORFs) sf20 and sf33. The insecticidal activity of each genotype from SfCOL-wt and several mixtures of genotypes was compared to that of SfCOL-wt. The potency of SfCOL-A occlusion bodies (OBs) was 4.4-fold higher than SfCOL-wt OBs, whereas the speed of kill of SfCOL-A was similar to that of SfCOL-wt. Deletion genotype OBs were similarly or less potent than SfCOL-wt but six deletion genotypes were faster killing than SfCOL-wt. The potency of genotype mixtures co-occluded within OBs were consistently reduced in two-genotype mixtures involving equal proportions of SfCOL-A and one of three deletion genotypes (SfCOL-C, -D or -F). Speed of kill and OB production were improved only when the certain genotype mixtures were co-occluded, although OB production was higher in the SfCOL-wt isolate than in any of the component genotypes, or mixtures thereof. Deleted genotypes reduced OB potency but increased OB production of the SfCOL-wt population, which is structured to maximize the production of OBs in each infected host. PMID:24116220

Sniffin' Sticks and olfactory system imaging in patients with Kallmann syndrome.

PubMed

Ottaviano, Giancarlo; Cantone, Elena; D'Errico, Arianna; Salvalaggio, Alessandro; Citton, Valentina; Scarpa, Bruno; Favaro, Angela; Sinisi, Antonio Agostino; Liuzzi, Raffaele; Bonanni, Guglielmo; Di Salle, Francesco; Elefante, Andrea; Manara, Renzo; Staffieri, Alberto; Martini, Alessandro; Brunetti, Arturo

2015-09-01

The relationship between olfactory function, rhinencephalon and forebrain changes in Kallmann syndrome (KS) have not been adequately investigated. We evaluated a large cohort of male KS patients using Sniffin' Sticks and MRI in order to study olfactory bulb (OB) volume, olfactory sulcus (OS) depth, cortical thickness close to the OS, and olfactory phenotype. Olfaction was assessed administering Sniffin' Sticks®, in 38 KS patients and 17 controls (by means of Screening 12 test®). All subjects underwent magnetic resonance imaging (MRI) to study OB volume, sulcus depth, and cortical thickness. Compared to controls, KS patients showed smaller OB volume (p<0.0001), reduced sulcus depth (p<0.0001), and thicker cortex in the region close to the OS (p<0.0001). Anosmic KS patients had smaller OB than controls and hyposmic KS patients; there was no difference between hyposmic KS patients and controls. OB volume correlated with Sniffin' Sticks score (r = 0.64; p < 0.001), OS depth (p<0.0001) and, inversely, with cortical thickness changes (p<0.0001). Sniffin' Sticks showed an inverse correlation with cortical thickness (r = -0.5; p<0.0001) and a trend toward a statistically significant correlation with OS depth. The present study provides further evidence of the strict relationship between olfaction and OB volume. The strong correlation between OB volume and the overlying cortical changes highlights the key role of rhinencephalon in forebrain embryogenesis. © 2015 ARS-AAOA, LLC.

Coordinated transcriptional regulation of bone homeostasis by Ebf1 and Zfp521 in both mesenchymal and hematopoietic lineages

PubMed Central

Kiviranta, Riku; Yamana, Kei; Saito, Hiroaki; Ho, Daniel K.; Laine, Julius; Tarkkonen, Kati; Nieminen-Pihala, Vappu; Hesse, Eric; Correa, Diego; Määttä, Jorma; Tessarollo, Lino; Rosen, Evan D.; Horne, William C.; Jenkins, Nancy A.; Copeland, Neal G.; Warming, Soren

2013-01-01

Bone homeostasis is maintained by the coupled actions of hematopoietic bone-resorbing osteoclasts (OCs) and mesenchymal bone-forming osteoblasts (OBs). Here we identify early B cell factor 1 (Ebf1) and the transcriptional coregulator Zfp521 as components of the machinery that regulates bone homeostasis through coordinated effects in both lineages. Deletion of Zfp521 in OBs led to impaired bone formation and increased OB-dependent osteoclastogenesis (OC-genesis), and deletion in hematopoietic cells revealed a strong cell-autonomous role for Zfp521 in OC progenitors. In adult mice, the effects of Zfp521 were largely caused by repression of Ebf1, and the bone phenotype of Zfp521+/− mice was rescued in Zfp521+/−:Ebf1+/− mice. Zfp521 interacted with Ebf1 and repressed its transcriptional activity. Accordingly, deletion of Zfp521 led to increased Ebf1 activity in OBs and OCs. In vivo, Ebf1 overexpression in OBs resulted in suppressed bone formation, similar to the phenotype seen after OB-targeted deletion of Zfp521. Conversely, Ebf1 deletion led to cell-autonomous defects in both OB-dependent and cell-intrinsic OC-genesis, a phenotype opposite to that of the Zfp521 knockout. Thus, we have identified the interplay between Zfp521 and Ebf1 as a novel rheostat for bone homeostasis. PMID:23569325

The approach of general surgeons to oncoplastic and reconstructive breast surgery in Turkey: a survey of practice patterns.

PubMed

Emiroğlu, Mustafa; Sert, İsmail; İnal, Abdullah; Karaali, Cem; Peker, Kemal; İlhan, Enver; Gülcelik, Mehmet; Erol, Varlık; Güngör, Hilmi; Can, Didem; Aydın, Cengiz

2014-12-01

Oncoplastic Breast Surgery (OBS), which is a combination of oncological procedures and plastic surgery techniques, has recently gained widespread use. To assess the experiences, practice patterns and preferred approaches to Oncoplastic and Reconstructive Breast Surgery (ORBS) undertaken by general surgeons specializing in breast surgery in Turkey. Cross-sectional study. Between December 2013 and February 2014, an eleven-question survey was distributed among 208 general surgeons specializing in breast surgery. The questions focused on the attitudes of general surgeons toward performing oncoplastic breast surgery (OBS), the role of the general surgeon in OBS and their training for it as well as their approaches to evaluating cosmetic outcomes in Breast Conserving Surgery (BCS) and informing patients about ORBS preoperatively. Responses from all 208 surgeons indicated that 79.8% evaluated the cosmetic outcomes of BCS, while 94.2% informed their patients preoperatively about ORBS. 52.5% performed BCS (31.3% themselves, 21.1% together with a plastic surgeon). 53.8% emphasized that general surgeons should carry out OBS themselves. 36.1% of respondents suggested that OBS training should be included within mainstream surgical training, whereas 27.4% believed this training should be conducted by specialised centres. Although OBS procedure rates are low in Turkey, it is encouraging to see general surgeons practicing ORBS themselves. The survey demonstrates that our general surgeons aspire to learn and utilize OBS techniques.

Histological properties of the nasal cavity and olfactory bulb of the Japanese jungle crow Corvus macrorhynchos.

PubMed

Yokosuka, Makoto; Hagiwara, Akiko; Saito, Toru R; Tsukahara, Naoki; Aoyama, Masato; Wakabayashi, Yoshihiro; Sugita, Shoei; Ichikawa, Masumi

2009-09-01

The nasal cavity and olfactory bulb (OB) of the Japanese jungle crow (Corvus macrorhynchos) were studied using computed tomography (CT) and histochemical staining. The nasal septum divided the nasal cavity in half. The anterior and maxillary conchae were present on both sides of the nasal cavity, but the posterior concha was indistinct. A small OB was present on the ventral surface of the periphery of the cerebrum. The OB-brain ratio--the ratio of the size of the OB to that of the cerebral hemisphere--was 6.13. The olfactory nerve bundles projected independently to the OB, which appeared fused on gross examination. Histochemical analysis confirmed the fusion of all OB layers. Using a neural tracer, we found that the olfactory nerve bundles independently projected to the olfactory nerve layer (ONL) and glomerular layer (GL) of the left and right halves of the fused OB. Only 4 of 21 lectins bound to the ONL and GL. Thus, compared with mammals and other birds, the jungle crow may have a poorly developed olfactory system and an inferior sense of olfaction. However, it has been contended recently that the olfactory abilities of birds cannot be judged from anatomical findings alone. Our results indicate that the olfactory system of the jungle crow is an interesting research model to evaluate the development and functions of vertebrate olfactory systems.

Involvement of glutamatergic N-methyl-d-aspartate receptors in the expression of increased head-dipping behaviors in the hole-board tests of olfactory bulbectomized mice.

PubMed

Hirose, Noritaka; Saitoh, Akiyoshi; Kamei, Junzo

2016-10-01

Olfactory bulbectomized (OB) mice produce agitated anxiety-like behaviors in the hole-board test, which was expressed by an increase in head-dipping counts and a decrease in head-dipping latencies. However, the associated mechanisms remain unclear. In the present study, MK-801 (10, 100μg/kg), a selective N-methyl-d-aspartate (NMDA) receptor antagonist, significantly and dose-dependently suppressed the increased head-dipping behaviors in OB mice, without affecting sham mice. Similar results were obtained with another selective NMDA receptor antagonist D-AP5 treatment in OB mice. On the other hand, muscimol, a selective aminobutyric acid type A (GABAA) receptor agonist produced no effects on these hyperemotional behaviors in OB mice at a dose (100μg/kg) that produced anxiolytic-like effects in sham mice. Interestingly, glutamine contents and glutamine/glutamate ratios were significantly increased in the amygdala and frontal cortex of OB mice compared to sham mice. Based on these results, we concluded that the glutamatergic NMDA receptors are involved in the expression of increased head-dipping behaviors in the hole-board tests of OB mice. Accordingly, the changes in glutamatergic transmission in frontal cortex and amygdala may play important roles in the expression of these abnormal behaviors in OB mice. Copyright © 2016. Published by Elsevier B.V.

The antidepressant-like effect of Ocimum basilicum in an animal model of depression.

PubMed

Ali, S S; Abd El Wahab, M G; Ayuob, N N; Suliaman, M

2017-01-01

We investigated the efficacy of Ocimum basilicum (OB) essential oils for treating depression related behavioral, biochemical and histopathological changes caused by exposure to chronic unpredictable mild stress (CUMS) in mice and to explore the mechanism underlying the pathology. Male albino mice were divided into four groups: controls; CUMS; CUMS plus fluoxetine, the antidepressant administered for pharmacological validation of OB; and CUMS plus OB. Behavioral tests included the forced swim test (FST), elevated plus-maze (EPM) and the open field test (OFT); these tests were performed at the end of the experiment. We assessed serum corticosterone level, protein, gene and immunoexpression of brain-derived neurotropic factor (BDNF) and glucocorticoid receptors (GRs) as well as immunoexpression of glial fibrillary acidic protein (GFAP), Ki67, caspase-3 in the hippocampus. CUMS caused depression in the mice as evidenced by prolonged immobility in the FST, prolonged time spent in the open arms during the EPM test and reduction of open field activity in the OFT. OB ameliorated the CUMS induced depressive status. OB significantly reduced the corticosterone level and up-regulated protein and gene expressions of BDNF and GR. OB reduced CUMS induced hippocampal neuron atrophy and apoptosis, and increased the number of the astrocytes and new nerve cells. OB significantly increased GFAP-positive cells as well as BDNF and GR immunoexpression in the hippocampus.

A thaumatin-like protein of Ocimum basilicum confers tolerance to fungal pathogen and abiotic stress in transgenic Arabidopsis

PubMed Central

Misra, Rajesh Chandra; Sandeep; Kamthan, Mohan; Kumar, Santosh; Ghosh, Sumit

2016-01-01

Plant often responds to fungal pathogens by expressing a group of proteins known as pathogenesis-related proteins (PRs). The expression of PR is mediated through pathogen-induced signal-transduction pathways that are fine-tuned by phytohormones such as methyl jasmonate (MeJA). Here, we report functional characterization of an Ocimum basilicum PR5 family member (ObTLP1) that was identified from a MeJA-responsive expression sequence tag collection. ObTLP1 encodes a 226 amino acid polypeptide that showed sequence and structural similarities with a sweet-tasting protein thaumatin of Thaumatococcus danielli and also with a stress-responsive protein osmotin of Nicotiana tabacum. The expression of ObTLP1 in O. basilicum was found to be organ-preferential under unstressed condition, and responsive to biotic and abiotic stresses, and multiple phytohormone elicitations. Bacterially-expressed recombinant ObTLP1 inhibited mycelial growth of the phytopathogenic fungi, Scleretonia sclerotiorum and Botrytis cinerea; thereby, suggesting its antifungal activity. Ectopic expression of ObTLP1 in Arabidopsis led to enhanced tolerance to S. sclerotiorum and B. cinerea infections, and also to dehydration and salt stress. Moreover, induced expression of the defense marker genes suggested up-regulation of the defense-response pathways in ObTLP1-expressing Arabidopsis upon fungal challenge. Thus, ObTLP1 might be useful for providing tolerance to the fungal pathogens and abiotic stresses in crops. PMID:27150014

A thaumatin-like protein of Ocimum basilicum confers tolerance to fungal pathogen and abiotic stress in transgenic Arabidopsis.

PubMed

Misra, Rajesh Chandra; Sandeep; Kamthan, Mohan; Kumar, Santosh; Ghosh, Sumit

2016-05-06

Plant often responds to fungal pathogens by expressing a group of proteins known as pathogenesis-related proteins (PRs). The expression of PR is mediated through pathogen-induced signal-transduction pathways that are fine-tuned by phytohormones such as methyl jasmonate (MeJA). Here, we report functional characterization of an Ocimum basilicum PR5 family member (ObTLP1) that was identified from a MeJA-responsive expression sequence tag collection. ObTLP1 encodes a 226 amino acid polypeptide that showed sequence and structural similarities with a sweet-tasting protein thaumatin of Thaumatococcus danielli and also with a stress-responsive protein osmotin of Nicotiana tabacum. The expression of ObTLP1 in O. basilicum was found to be organ-preferential under unstressed condition, and responsive to biotic and abiotic stresses, and multiple phytohormone elicitations. Bacterially-expressed recombinant ObTLP1 inhibited mycelial growth of the phytopathogenic fungi, Scleretonia sclerotiorum and Botrytis cinerea; thereby, suggesting its antifungal activity. Ectopic expression of ObTLP1 in Arabidopsis led to enhanced tolerance to S. sclerotiorum and B. cinerea infections, and also to dehydration and salt stress. Moreover, induced expression of the defense marker genes suggested up-regulation of the defense-response pathways in ObTLP1-expressing Arabidopsis upon fungal challenge. Thus, ObTLP1 might be useful for providing tolerance to the fungal pathogens and abiotic stresses in crops.

Synergistic effect of energy drinks and overweight/obesity on cardiac autonomic testing using the Valsalva maneuver in university students.

PubMed

Majeed, Farrukh; Yar, Talay; Alsunni, Ahmed; Alhawaj, Ali Fouad; AlRahim, Ahmed; Alzaki, Muneer

2017-01-01

Obesity and caffeine consumption may lead to autonomic disturbances that can result in a wide range of cardiovascular disorders. To determine autonomic disturbances produced by the synergistic effects of overweight or obesity (OW/OB) and energy drinks. Cross-sectional, analytical. Physiology department at a university in Saudi Arabia. University students, 18-22 years of age, of normal weight (NW) and OW/OB were recruited by convenience sampling. Autonomic testing by the Valsalva ratio (VR) along with systolic and diastolic blood pressure, pulse pressure, and mean arterial blood pressure were measured at baseline (0 minute) and 60 minutes after energy drink consumption. Autonomic disturbance, hemodynamic changes. In 50 (27 males and 23 females) subjects, 21 NW and 29 OW/OB, a significant decrease in VR was observed in OW/OB subjects and in NW and OW/OB females at 60 minutes after energy drink consumption. Values of systolic and diastolic blood pressure, pulse pressure and mean arterial blood pressure were also significantly higher in OW/OB and in females as compared to NW and males. BMI was negatively correlated with VR and diastolic blood pressure at 60 minutes. Obesity and energy drinks alter autonomic functions. In some individuals, OW/OB may augment these effects. Due to time and resource restraints, only the acute effects of energy drinks were examined.

Coordinated X-ray and optical observations of Scorpius X-1

NASA Technical Reports Server (NTRS)

Augusteijn, T.; Karatasos, K.; Papadakis, M.; Paterakis, G.; Kikuchi, S.; Brosch, N.; Leibowitz, E.; Hertz, P.; Mitsuda, K.; Dotani, T.

1992-01-01

We present the results of coordinated, partly simultaneous, optical and X-ray (Ginga) observations of the low-mass X-ray binary Sco X-1. We find that the division between the optically bright and faint state, at a blue magnitude B = 12.8, corresponds to the change from the normal to the flaring branch in the X-ray color-color diagram as proposed by Priedhorsky et al. (1986). From archival Walraven data we find that in both optical states the orbital light curve is approximately sinusoidal, and have a similar amplitudes.

Beam-dynamics codes used at DARHT

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ekdahl, Jr., Carl August

Several beam simulation codes are used to help gain a better understanding of beam dynamics in the DARHT LIAs. The most notable of these fall into the following categories: for beam production – Tricomp Trak orbit tracking code, LSP Particle in cell (PIC) code, for beam transport and acceleration – XTR static envelope and centroid code, LAMDA time-resolved envelope and centroid code, LSP-Slice PIC code, for coasting-beam transport to target – LAMDA time-resolved envelope code, LSP-Slice PIC code. These codes are also being used to inform the design of Scorpius.

A Business Case Analysis (BCA) of the One Box - One Wire (OB1) Joint Combined Technology Demonstration (JCTD)

DTIC Science & Technology

2009-03-01

Framework ( IATF ) as their guidance for information assurance. The IATF defines what high 5 OB1 is compatible with and intends to use legacy...standardized levels of security. The OB1 team using the IATF as guidance defines high robustness as proving to the maximum extent possible, that

Flooding of the Ob and Irtysh Rivers, Russia

NASA Technical Reports Server (NTRS)

2002-01-01

This pair of true- and false-color images shows flooding along the Ob' (large east-west running river) and Irtysh (southern tributary of the Ob') on July 7, 2002. In the false-color image, land surfaces are orange-gold and flood waters are black or dark blue. Fires are marked with red dots in both images. Rivers

Offshore seismicity in the western Marmara Sea, Turkey, revealed by ocean bottom observation

NASA Astrophysics Data System (ADS)

Yamamoto, Yojiro; Takahashi, Narumi; Citak, Seckin; Kalafat, Doǧan; Pinar, Ali; Gürbüz, Cemil; Kaneda, Yoshiyuki

2015-04-01

The North Anatolian Fault (NAF) extends 1600 km westward from a junction with the East Anatolian Fault at the Karliova Triple Junction in eastern Turkey, across northern Turkey and into the Aegean Sea, accommodating about 25 mm/yr of right-lateral motion between Anatolia and the Eurasian plate. Since 1939, devastating earthquakes with magnitude greater than seven ruptured NAF westward, starting from 1939 Erzincan (Ms=7.9) at the eastern Turkey and including the latest 1999 Izmit-Golcuk (Ms=7.7) and the Duzce (Ms=7.4) earthquakes in the Marmara region. Considering the fault segments ruptured by the May 24th, 2014 Northern Aegean earthquake (Mw=6.9), the only un-ruptured segments left behind the 1600 km long NAF locate beneath the Marmara Sea and those segments keep their mystery due to their underwater location. To consider the earthquake hazard and disaster mitigation, the detailed information about fault geometry and its stick-slip behavior beneath the western Marmara Sea is very important. Thus, we started to operate a series of ocean bottom seismographic (OBS) observations to estimate the fault geometry from microearthquake distribution. As a first step, we deployed 3 pop-up type OBSs on 20th of March 2014 as a trial observation, and recovered them on 18th of June 2014. Although one of the OBSs worked only 6 days from the start of the observation, other two OBSs functioned properly during the whole 3-month observation period. We first searched for the microearthquakes missing by the land seismic network and estimated their precious location by using the initial 6 days data, i.e., using all the temporary OBS stations. Although there are only 3 earthquakes listed on the Kandilli Observatory and Earthquake Research Institute (KOERI) catalogue, we could identify 41 earthquakes with more than 5 picking data of P and S first arrivals, and two-third of them located within the OBS network. We found the earthquake cluster along the main NAF and whose depth interval is 12-20 km. This cluster indicates that the dip angle of the main NAF is almost vertical. We also relocated the KOERI-catalogued earthquakes in 3 months periods by combining the land and OBS seismic data. The results indicated that some earthquakes occurred 5-10 km away from the main NAF. Besides, the upper limit of seismicity along NAF seems to dip eastward. To obtain more information of the fault geometry beneath the Marmara Sea, we started a second step observation by using 10 OBSs from September 2014 to June 2015. In addition, we are planning to add 5 OBSs to this observation in Mar. 2015. All OBS observations are conducted as a part of the "Earthquake and Tsunami Disaster Mitigation in the Marmara Region and Disaster Education in Turkey" project, financially supported by Japan International Cooperation Agency (JICA), Japan Science and Technology Agency (JST), and the Ministry of Development in Turkey.

Low permeability to oxygen of a new barrier film prevents butyric acid bacteria spore formation in farm corn silage.

PubMed

Borreani, G; Tabacco, E

2008-11-01

The outgrowth of Clostridium spore-forming bacteria causes late blowing in cheeses. Recently, the role of air diffusion during storage and feed-out and the role of aerobic deterioration has been shown to indirectly favor butyric acid bacteria (BAB) growth and to determine the presence of high concentrations of BAB spores in farm tank milk. A new oxygen barrier (OB) film was tested and compared with conventional polyethylene (ST). The objective was to verify whether the OB film could prevent BAB spore formation in whole-crop corn silage during storage on 2 commercial farms with different potential silage spoilage risks. Two bunkers (farms 1 and 2) were divided into 2 parts along the length so that half the feed-out face would be covered with ST film and the other half with OB film. Plastic net bags with freshly chopped corn were buried in the upper layer and in the central part (CORE) of the bunkers. The silos were opened in summer and fed out at different removal rates (19 vs. 33 cm/d). Herbage at ensiling, silage at unloading, and silage after air exposure (6 and 15 d) were analyzed for pH, nitrate, BAB spores, yeasts, and molds. The BAB spores in herbages at ensiling were 2.84 log(10) most probable number (MPN)/g, with no differences between treatments or farms. Nitrate was below the detection limit on farm 1 and exceeded 2,300 mg/kg of fresh matter on farm 2. At unloading, the BAB spores in the ST silage on farm 1 were greater than 5 log(10) MPN/g, whereas in the CORE and the OB silages, they were approximately 2 log(10) MPN/g. The ST silage had the greatest pH (5.89), the greatest mold count (5.07 log(10) cfu/g), and the greatest difference between silage temperature and ambient temperature (dT(section-ambient)). On farm 2, the ST silage had the greatest concentration of BAB spores (2.19 log(10) MPN/g), the greatest pH (4.05), and the least nitrate concentration compared with the CORE and the OB silages. Pooled data on BAB spores collected from aerobically deteriorated samples showed a positive relationship with pH, mold count, and dT(section-ambient) and a negative relationship with nitrate concentration. A high concentration of BAB spores (>5 log MPN/g) was associated with visible spoilage, high pH values (>5.00), high mold counts (>5 log cfu/g), high dT(section-ambient), and nitrate below 1,000 mg/kg of fresh matter. We concluded that the use of a film with reduced oxygen permeability prevented the outgrowth of BAB spores during conservation and feed-out, and it could improve the microbiological quality of corn silage by eliminating the fractions of silage with high BAB spore concentrations.

[D-Leu-4]-OB3, a synthetic peptide amide with leptin-like activity, augments the effects of orally delivered exenatide and pramlintide acetate on energy balance and glycemic control in insulin-resistant male C57BLK/6-m db/db mice.

PubMed

Leinung, Matthew C; Grasso, Patricia

2012-11-10

The escalation predicted for the incidence of both type 2 diabetes mellitus and obesity has prompted investigators to search for additional pharmacotherapeutic approaches to their treatment. Two of these approaches, combination pharmacotherapy and utilization of leptin-related bioactive synthetic peptides as anti-diabetes/anti-obesity agents, were used in the present study. Exenatide or pramlintide acetate was reconstituted in dodecyl maltoside (DDM) in the absence or presence of [D-Leu-4]-OB3, and delivered orally by gavage to insulin-resistant male C57BLK/6-m db/db mice twice daily for 14 days. Body weight gain, food and water intake, blood glucose, and serum insulin levels were measured. Mice given DDM alone for 14 days were 19.7% heavier than they were at the beginning of the study, while oral delivery of exenatide or [D-Leu-4]-OB3 in DDM reduced body weight gain to only 13.9% and 11.5%, respectively, of initial body weight. Mice receiving exenatide and [D-Leu-4]-OB3 were 4.2% lighter than they were at the beginning of the study. In another study, Intravail® treated control mice gained 38.2% of their initial body weight, while mice receiving pramlintide acetate or [D-Leu-4]-OB3 were only 26.8% and 25.4% heavier, respectively, at the end of the study, Co-administration of pramlintide acetate and [D-Leu-4]-OB3 did not further enhance the effect of pramlintide acetate on body weight gain. Food intake was reduced by exenatide, pramlintide acetate, and [D-Leu-4]-OB3 alone, and co-delivery with [D-Leu-4]-OB3 did not induce a further decrease. Water intake was not affected by exenatide, pramlintide acetate, or [D-Leu-4]-OB3 alone, but co-delivery of exenatide or pramlintide acetate with [D-Leu-4]-OB3 resulted in a significant reduction in water intake. Oral delivery of exenatide or pramlintide acetate in DDM significantly lowered blood glucose levels by 20.4% and 30.2%, respectively. Co-delivery with [D-Leu-4]-OB3 further reduced blood glucose by 38.3% and 50.5%, respectively. A concentration-dependent increase in serum insulin was observed in response to increasing concentrations of exenatide, and [D-Leu-4]-OB3 slightly reduced the insulin response to exenatide at all concentrations tested. Increasing concentrations of pramlintide acetate alone did not elevate serum insulin, and when given in combination with [D-Leu-4]-OB3, serum insulin levels fell below those of DDM-treated control mice. Our data indicate that (1) exenatide and pramlintide acetate, currently administered by subcutaneous injection, can be given orally in DDM; (2) the bioactivity of exenatide and pramlintide acetate is retained following oral delivery in DDM; and (3) the effects of exenatide and pramlintide acetate on energy balance and glycemic control can be enhanced by co-administration with [D-Leu-4]-OB3, a synthetic peptide amide with leptin-like activity. Copyright © 2012 Elsevier B.V. All rights reserved.

Hepatic Transporter Expression in Metabolic Syndrome: Phenotype, Serum Metabolic Hormones, and Transcription Factor Expression

PubMed Central

Donepudi, Ajay C.; Cheng, Qiuqiong; Lu, Zhenqiang James; Cherrington, Nathan J.

2016-01-01

Metabolic syndrome is a multifactorial disease associated with obesity, insulin resistance, diabetes, and the alteration of multiple metabolic hormones. Obesity rates have been rising worldwide, which increases our need to understand how this population will respond to drugs and exposure to other chemicals. The purpose of this study was to determine in lean and obese mice the ontogeny of clinical biomarkers such as serum hormone and blood glucose levels as well as the physiologic markers that correlate with nuclear receptor– and transporter-related pathways. Livers from male and female wild-type (WT) (C57BL/6) and ob/ob mice littermates were collected before, during, and after the onset of obesity. Serum hormone and mRNA levels were analyzed. Physiologic changes and gene expression during maturation and progression to obesity were performed and correlation analysis was performed using canonical correlations. Significant ontogenic changes in both WT and ob/ob mice were observed and these ontogenic changes differ in ob/ob mice with the development of obesity. In males and females, the ontogenic pattern of the expression of genes such as Abcc3, 4, Abcg2, Cyp2b10, and 4a14 started to differ from week 3, and became significant at weeks 4 and 8 in ob/ob mice compared with WT mice. In obese males, serum resistin, glucagon, and glucose levels correlated with the expression of most hepatic ATP-binding cassette (Abc) transporters, whereas in obese females, serum glucagon-like peptide 1 levels were correlated with most hepatic uptake transporters and P450 enzymes. Overall, the correlation between physiologic changes and gene expression indicate that metabolism-related hormones may play a role in regulating the genes involved in drug metabolism and transport. PMID:26847773

Obesity-induced changes in kidney mitochondria and endoplasmic reticulum in the presence or absence of leptin

PubMed Central

do Carmo, Jussara M.; Hosler, Jonathan P.; Hall, John E.

2015-01-01

We investigated obesity-induced changes in kidney lipid accumulation, mitochondrial function, and endoplasmic reticulum (ER) stress in the absence of hypertension, and the potential role of leptin in modulating these changes. We compared two normotensive genetic mouse models of obesity, leptin-deficient ob/ob mice and hyperleptinemic melanocortin-4 receptor-deficient mice (LoxTB MC4R−/−), with their respective lean controls. Compared with controls, ob/ob and LoxTB MC4R−/− mice exhibit significant albuminuria, increased creatinine clearance, and high renal triglyceride content. Renal ATP levels were decreased in both obesity models, and mitochondria isolated from both models showed alterations that would lower mitochondrial ATP production. Mitochondria from hyperleptinemic LoxTB MC4R−/− mice kidneys respired NADH-generating substrates (including palmitate) at lower rates due to an apparent decrease in complex I activity, and these mitochondria showed oxidative damage. Kidney mitochondria of leptin-deficient ob/ob mice showed normal rates of respiration with no evidence of oxidative damage, but electron transfer was partially uncoupled from ATP synthesis. A fourfold induction of C/EBP homologous protein (CHOP) expression indicated induction of ER stress in kidneys of hyperleptinemic LoxTB MC4R−/− mice. In contrast, ER stress was not induced in kidneys of leptin-deficient ob/ob mice. Our findings show that obesity, in the absence of hypertension, is associated with renal dysfunction in mice but not with major renal injury. Alterations to mitochondria that lower cellular ATP levels may be involved in obesity-induced renal injury. The type and severity of mitochondrial and ER dysfunction differs depending upon the presence or absence of leptin. PMID:26290368

Effects of cholinergic m-receptor agonists on insulin release in islets from obese and lean mice of different ages: the importance of bicarbonate.

PubMed

Persson-Sjögren, Solveig; Lindström, Per

2004-11-01

Decreased beta-cell function is often observed in older individuals and may predispose to the development of type 2 diabetes. We have studied the age-related effects of M-receptor agonism on insulin release in islets isolated from female ob/ ob and lean mice. Islets were challenged with 11.1 or 16.7 mmol/L glucose in media with HCO3/CO2 (KRBH) or without (KRH). Acetylcholine (ACh) (10 micromol/L) increased glucose-induced insulin release in islets from 4- to 5-week-old ob/ob mice both in KRBH and KRH. In islets from 9- to 13-month-old ob/ob mice, 10 micromol/L ACh and 10 micromol/L carbachol enhanced insulin release in KRBH but not in KRH. ACh increased insulin release in islets from 4- to 5-week-old and 16-month-old lean mice incubated in KRH but not in islets from 24-month-old lean mice. The Na/H exchange inhibitor dimethylamiloride (100 micromol/L) did not affect insulin release stimulated by M-receptor agonists. Carbachol did not enhance glucose-induced insulin secretion in islets from 9- to 10-month-old ob/ob mice in the presence of low extracellular Na concentration. ACh stimulated cytoplasmic Ca mobilization in islets from 9- to 10-month-old mice also when bicarbonate was omitted. The results suggest that cholinergic signal transduction involving extracellular bicarbonate and Na is reduced with age in mouse pancreatic islets. Chronic hyperglycemia may add to the age-related decrease in M-receptor-mediated insulin release by affecting the buffering capacity of the islets through mechanisms other than amiloride-sensitive proton exchange.

A direct comparison of quality of life in obese and Cushing’s syndrome patients

PubMed Central

Abraham, Smita Baid; Abel, Brent S; Rubino, Domenica; Nansel, Tonja; Ramsey, Sheila; Nieman, Lynnette K

2014-01-01

Objective Obese (OB) individuals and patients with Cushing’s syndrome (CS) often have similar clinical presentations. While each group has reduced health-related quality of life (HRQL), it is not known whether the degree of impairment is different and might distinguish between them. The objective of this study was to compare HRQL in these two populations. Design Cross-sectional study. Methods Three hundred and twenty-seven OB patients (48.1±11.7 years; 72.5% women) with weight gain and at least two features of CS were recruited from an outpatient weight management clinic. Sixty-six untreated patients with CS (41.6±13.2 years; 78.8% women) presented to the NIH Clinical Center for evaluation. Subjects completed the SF-36 survey and a locally created symptom questionnaire. Results After adjusting for symptom count, OB patients had a significantly higher (better HRQL) mean physical component summary (PCS) score than CS patients (44.9±0.6 vs 35.4±1.5, P<0.0001). However, the mean mental component summary (MCS) score was lower (worse HRQL) in the OB group (41.6±0.6 vs 50.7±1.6, P<0.0001). Symptom count showed significant correlations with PCS and MCS scores. BMI correlated with PCS (r=−0.29) in OB but not in CS patients. BMI was not associated with MCS in either group. Conclusion HRQL is significantly different between OB and CS patients. Surprisingly, after adjusting for symptom count, OB patients showed worse mental health scores than the CS population. Significant differences in HRQL and symptom count may suggest which OB patients should be screened for CS. PMID:23444412

Current practices in the diagnosis and management of gestational diabetes mellitus in India (WINGS-5)

PubMed Central

Mahalakshmi, Manni Mohanraj; Bhavadharini, Balaji; Maheswari, Kumar; Anjana, Ranjit Mohan; Jebarani, Saravanan; Ninov, Lyudmil; Kayal, Arivudainambi; Malanda, Belma; Belton, Anne; Uma, Ram; Mohan, Viswanathan; Unnikrishnan, Ranjit

2016-01-01

Aim: To obtain information on existing practices in the diagnosis and management of gestational diabetes mellitus (GDM) among physicians/diabetologists/endocrinologists and obstetricians/gynecologists (OB/GYNs) in India. Methods: Details regarding diagnostic criteria used, screening methods, management strategies, and the postpartum follow-up of GDM were obtained from physicians/diabetologists/endocrinologists and OB/GYNs across 24 states of India using online/in-person surveys using a structured questionnaire. Results: A total of 3841 doctors participated in the survey of whom 68.6% worked in private clinics. Majority of OB/GYNs (84.9%) preferred universal screening for GDM, and screening in the first trimester was performed by 67% of them. Among the OB/GYNs, 600 (36.7%) reported using the nonfasting 2 h criteria for diagnosing GDM whereas 560 (29.4%) of the diabetologists/endocrinologists reported using the same. However, further questioning on the type of blood sample collected and the glucose load used revealed that, in reality, only 208 (12.7%) and 72 (3.8%), respectively, used these criteria properly. The survey also revealed that the International Association of Diabetes and Pregnancy Study Groups criteria was followed properly by 299 (18.3%) of OB/GYNs and 376 (19.7%) of physicians/diabetologists/endocrinologists. Postpartum oral glucose tolerance testing was advised by 56% of diabetologists and 71.6% of OB/GYNs. Conclusion: More than half of the physicians/diabetologists/endocrinologists and OB/GYNs in India do not follow any of the recommended guidelines for the diagnosis of GDM. This emphasizes the need for increased awareness about screening and diagnosis of GDM both among physicians/diabetologists/endocrinologists and OB/GYNs in India. PMID:27186555

Changes in gut microbiota control inflammation in obese mice through a mechanism involving GLP-2-driven improvement of gut permeability.

PubMed

Cani, P D; Possemiers, S; Van de Wiele, T; Guiot, Y; Everard, A; Rottier, O; Geurts, L; Naslain, D; Neyrinck, A; Lambert, D M; Muccioli, G G; Delzenne, N M

2009-08-01

Obese and diabetic mice display enhanced intestinal permeability and metabolic endotoxaemia that participate in the occurrence of metabolic disorders. Our recent data support the idea that a selective increase of Bifidobacterium spp. reduces the impact of high-fat diet-induced metabolic endotoxaemia and inflammatory disorders. Here, we hypothesised that prebiotic modulation of gut microbiota lowers intestinal permeability, by a mechanism involving glucagon-like peptide-2 (GLP-2) thereby improving inflammation and metabolic disorders during obesity and diabetes. Study 1: ob/ob mice (Ob-CT) were treated with either prebiotic (Ob-Pre) or non-prebiotic carbohydrates as control (Ob-Cell). Study 2: Ob-CT and Ob-Pre mice were treated with GLP-2 antagonist or saline. Study 3: Ob-CT mice were treated with a GLP-2 agonist or saline. We assessed changes in the gut microbiota, intestinal permeability, gut peptides, intestinal epithelial tight-junction proteins ZO-1 and occludin (qPCR and immunohistochemistry), hepatic and systemic inflammation. Prebiotic-treated mice exhibited a lower plasma lipopolysaccharide (LPS) and cytokines, and a decreased hepatic expression of inflammatory and oxidative stress markers. This decreased inflammatory tone was associated with a lower intestinal permeability and improved tight-junction integrity compared to controls. Prebiotic increased the endogenous intestinotrophic proglucagon-derived peptide (GLP-2) production whereas the GLP-2 antagonist abolished most of the prebiotic effects. Finally, pharmacological GLP-2 treatment decreased gut permeability, systemic and hepatic inflammatory phenotype associated with obesity to a similar extent as that observed following prebiotic-induced changes in gut microbiota. We found that a selective gut microbiota change controls and increases endogenous GLP-2 production, and consequently improves gut barrier functions by a GLP-2-dependent mechanism, contributing to the improvement of gut barrier functions during obesity and diabetes.

C-Mpl is expressed on osteoblasts and osteoclasts and is important in regulating skeletal homeostasis

PubMed Central

Meijome, Tomas E.; Baughman, Jenna T.; Hooker, R. Adam; Cheng, Ying-Hua; Ciovacco, Wendy A.; Balamohan, Sanjeev M.; Srinivasan, Trishya L.; Chitteti, Brahmananda R.; Eleniste, Pierre P.; Horowitz, Mark C.; Srour, Edward F.; Bruzzaniti, Angela; Fuchs, Robyn K.; Kacena, Melissa A.

2016-01-01

C-Mpl is the receptor for thrombopoietin (TPO), the main megakaryocyte (MK) growth factor, and c-Mpl is believed to be expressed on cells of the hematopoietic lineage. As MKs have been shown to enhance bone formation, it may be expected that mice in which c-Mpl was globally knocked out (c-Mpl−/− mice) would have decreased bone mass because they have fewer MKs. Instead, c-Mpl−/− mice have a higher bone mass than WT controls. Using c-Mpl−/− mice we investigated the basis for this discrepancy and discovered that c-Mpl is expressed on both osteoblasts (OBs) and osteoclasts (OCs), an unexpected finding that prompted us to examine further how c-Mpl regulates bone. Static and dynamic bone histomorphometry parameters suggest that c-Mpl deficiency results in a high bone turnover state with a net gain in bone volume. In vitro, a higher percentage of c-Mpl−/− OBs were in active phases of the cell cycle, leading to an increased number of OBs. No difference in OB differentiation was observed in vitro as examined by real-time PCR and functional assays. In co-culture systems, which allow for the interaction between OBs and OC progenitors, c-Mpl−/− OBs enhanced osteoclastogenesis. Two of the major signaling pathways by which OBs regulate osteoclastogenesis, MCSF/OPG/RANKL and EphrinB2-EphB2/B4, were unaffected in c-Mpl−/− OBs. These data provide new findings for the role of MKs and c-Mpl expression in bone and may provide insight into the homeostatic regulation of bone mass as well as bone loss diseases such as osteoporosis. PMID:26375403

Altered behavior of adult obese rats by monosodium l-glutamate neonatal treatment is related to hypercorticosteronemia and activation of hypothalamic ERK1 and ERK2.

PubMed

Guimarães, Ernesto da Silveira Goulart; de Caires Júnior, Luiz Carlos; Musso, Camila Manso; Macedo de Almeida, Mariana; Gonçalves, Cássio Francisco; Pettersen, Klaus Grossi; Paes, Santiago Tavares; González Garcia, Raúl Marcel; de Freitas Mathias, Paulo Cesar; Torrezan, Rosana; Mourao-Júnior, Carlos Alberto; Andreazzi, Ana Eliza

2017-04-01

Obesity is a metabolic and hormonal disorder with serious social and psychological impacts. There is a close relationship among obesity, neuroendocrine homeostasis and behavioral patterns. However, few data are available in the literature regarding this subject. This study assessed behavior and memory of adult obese rats by monosodium l-glutamate (MSG) neonatal treatment or highly palatable dietary treatment. MSG obesity was induced by subcutaneous injections of MSG (4 mg/g) during the first 5 days of life (Ob-MSG); control group (C-MSG), received saline solution equimolar. Both groups were fed with commercial chow. To induce dietary obesity, 21-day-old rats were assigned to two experimental diets: highly palatable diet (Ob-Diet) and control diet (C-Diet) composed of commercial chow. Ninety-day-old animals were submitted to behavioral assessment by the open-field test and short- and long-term memory by the object recognition test. Biometric variables were obtained, the Lee index was calculated and mass of retroperitoneal and perigonadal fat pads was measured. Furthermore, an altered behavioral profile was investigated by quantification of plasmatic corticosterone, expression, and activity of hypothalamic extracellular signal-regulated kinase protein (ERK) 1 and 2. Increased Lee index and fat pads were observed in Ob-MSG and Ob-Diet groups. Ob-MSG presented a higher level of anxiety and impaired long-term memory compared to C-MSG, while there was no difference between Ob-Diet and C-Diet. The Ob-MSG group presented a higher level of plasmatic corticosterone and increased phosphorylation of hypothalamic ERK1 and 2. Both treatments induced obesity but only Ob-MSG showed altered behavioral parameters, which is related to increased concentration of corticosterone and hypothalamic ERK1 and 2 activation.

UDP-glucuronosyltransferase expression in mouse liver is increased in obesity- and fasting-induced steatosis.

PubMed

Xu, Jialin; Kulkarni, Supriya R; Li, Liya; Slitt, Angela L

2012-02-01

UDP-glucuronosyltransferases (Ugt) catalyze phase II conjugation reactions with glucuronic acid, which enhances chemical polarity and the elimination from the body. Few studies have addressed whether Ugt expression and activity are affected by liver disease, such as steatosis. The purpose of this study was to determine whether steatosis induced by obesity or fasting could affect liver Ugt mRNA expression and activity. Male C57BL/6J and Lep(ob/ob) (ob/ob) mice were fed ad libitum or food was withheld for 24 h. In steatotic livers of ob/ob mice, Ugt1a1, -1a6, -1a9, -2a3, -3a1, and -3a2 mRNA expression increased. Fasting, which also induced steatosis, increased hepatic Ugt1a1, -1a6, -1a7, -1a9, -2b1, -2b5, -2a3, -3a1, and -3a2 mRNA expression in mouse liver. Likewise, acetaminophen glucuronidation increased by 47% in hepatic microsomes from ob/ob mice compared with that in C57BL/6J mice, but not after fasting. In both steatosis models, Ugt induction was accompanied by increased aryl hydrocarbon receptor, constitutive androstane receptor (CAR), peroxisome proliferator-activated receptor (PPAR)-α, pregnane X receptor, nuclear factor (erythroid-derived 2)-like 2 (Nrf2), and peroxisome proliferator-activated receptor-γ coactivator-1α mRNA expression. In addition, fasting increased CAR, PPAR, and Nrf2 binding activity. The work points to hepatic triglyceride concentrations corresponding with nuclear receptor and Ugt expression. The findings indicate that steatosis significantly alters hepatic Ugt expression and activity, which could have a significant impact on determining circulating hormone levels, drug efficacy, and environmental chemical clearance.

Sleep quality, sleep duration and physical activity in obese adolescents: effects of exercise training.

PubMed

Mendelson, M; Borowik, A; Michallet, A-S; Perrin, C; Monneret, D; Faure, P; Levy, P; Pépin, J-L; Wuyam, B; Flore, P

2016-02-01

Decreased sleep duration and altered sleep quality are risk factors for obesity in youth. Structured exercise training has been shown to increase sleep duration and improve sleep quality. This study aimed at evaluating the impact of exercise training for improving sleep duration, sleep quality and physical activity in obese adolescents (OB). Twenty OB (age: 14.5 ± 1.5 years; body mass index: 34.0 ± 4.7 kg m(-2) ) and 20 healthy-weight adolescents (HW) completed an overnight polysomnography and wore an accelerometer (SenseWear Bodymedia) for 7 days. OB participated in a 12-week supervised exercise-training programme consisting of 180 min of exercise weekly. Exercise training was a combination of aerobic exercise and resistance training. Sleep duration was greater in HW compared with OB (P < 0.05). OB presented higher apnoea-hypopnoea index than HW (P < 0.05). Physical activity (average daily metabolic equivalent of tasks [METs]) by accelerometer was lower in OB (P < 0.05). After exercise training, obese adolescents increased their sleep duration (+64.4 min; effect size: 0.88; P = 0.025) and sleep efficiency (+7.6%; effect size: 0.76; P = 0.028). Physical activity levels were increased in OB as evidenced by increased steps per day and average daily METs (P < 0.05). Improved sleep duration was associated with improved average daily METs (r = 0.48, P = 0.04). The present study confirms altered sleep duration and quality in OB. Exercise training improves sleep duration, sleep quality and physical activity. © 2015 World Obesity.

Activation of ER stress and mTORC1 suppresses hepatic sortilin-1 levels in obese mice

PubMed Central

Ai, Ding; Baez, Juan M.; Jiang, Hongfeng; Conlon, Donna M.; Hernandez-Ono, Antonio; Frank-Kamenetsky, Maria; Milstein, Stuart; Fitzgerald, Kevin; Murphy, Andrew J.; Woo, Connie W.; Strong, Alanna; Ginsberg, Henry N.; Tabas, Ira; Rader, Daniel J.; Tall, Alan R.

2012-01-01

Recent GWAS have identified SNPs at a human chromosom1 locus associated with coronary artery disease risk and LDL cholesterol levels. The SNPs are also associated with altered expression of hepatic sortilin-1 (SORT1), which encodes a protein thought to be involved in apoB trafficking and degradation. Here, we investigated the regulation of Sort1 expression in mouse models of obesity. Sort1 expression was markedly repressed in both genetic (ob/ob) and high-fat diet models of obesity; restoration of hepatic sortilin-1 levels resulted in reduced triglyceride and apoB secretion. Mouse models of obesity also exhibit increased hepatic activity of mammalian target of rapamycin complex 1 (mTORC1) and ER stress, and we found that administration of the mTOR inhibitor rapamycin to ob/ob mice reduced ER stress and increased hepatic sortilin-1 levels. Conversely, genetically increased hepatic mTORC1 activity was associated with repressed Sort1 and increased apoB secretion. Treating WT mice with the ER stressor tunicamycin led to marked repression of hepatic sortilin-1 expression, while administration of the chemical chaperone PBA to ob/ob mice led to amelioration of ER stress, increased sortilin-1 expression, and reduced apoB and triglyceride secretion. Moreover, the ER stress target Atf3 acted at the SORT1 promoter region as a transcriptional repressor, whereas knockdown of Atf3 mRNA in ob/ob mice led to increased hepatic sortilin-1 levels and decreased apoB and triglyceride secretion. Thus, in mouse models of obesity, induction of mTORC1 and ER stress led to repression of hepatic Sort1 and increased VLDL secretion via Atf3. This pathway may contribute to dyslipidemia in metabolic disease. PMID:22466652

Hepatic Transporter Expression in Metabolic Syndrome: Phenotype, Serum Metabolic Hormones, and Transcription Factor Expression.

PubMed

Donepudi, Ajay C; Cheng, Qiuqiong; Lu, Zhenqiang James; Cherrington, Nathan J; Slitt, Angela L

2016-04-01

Metabolic syndrome is a multifactorial disease associated with obesity, insulin resistance, diabetes, and the alteration of multiple metabolic hormones. Obesity rates have been rising worldwide, which increases our need to understand how this population will respond to drugs and exposure to other chemicals. The purpose of this study was to determine in lean and obese mice the ontogeny of clinical biomarkers such as serum hormone and blood glucose levels as well as the physiologic markers that correlate with nuclear receptor- and transporter-related pathways. Livers from male and female wild-type (WT) (C57BL/6) and ob/ob mice littermates were collected before, during, and after the onset of obesity. Serum hormone and mRNA levels were analyzed. Physiologic changes and gene expression during maturation and progression to obesity were performed and correlation analysis was performed using canonical correlations. Significant ontogenic changes in both WT and ob/ob mice were observed and these ontogenic changes differ in ob/ob mice with the development of obesity. In males and females, the ontogenic pattern of the expression of genes such as Abcc3, 4, Abcg2, Cyp2b10, and 4a14 started to differ from week 3, and became significant at weeks 4 and 8 in ob/ob mice compared with WT mice. In obese males, serum resistin, glucagon, and glucose levels correlated with the expression of most hepatic ATP-binding cassette (Abc) transporters, whereas in obese females, serum glucagon-like peptide 1 levels were correlated with most hepatic uptake transporters and P450 enzymes. Overall, the correlation between physiologic changes and gene expression indicate that metabolism-related hormones may play a role in regulating the genes involved in drug metabolism and transport. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.

Impaired contractile responses and altered expression and phosphorylation of Ca2+ sensitization proteins in gastric antrum smooth muscles from ob/ob mice

PubMed Central

Bhetwal, Bhupal P.; An, Changlong; Baker, Salah A.; Lyon, Kristin L.

2013-01-01

Diabetic gastroparesis is a common complication of diabetes, adversely affecting quality of life with symptoms of abdominal discomfort, nausea, and vomiting. The pathogenesis of this complex disorder is not well understood, involving abnormalities in the extrinsic and enteric nervous systems, interstitial cells of Cajal (ICCs), smooth muscles and immune cells. The ob/ob mouse model of obesity and diabetes develops delayed gastric emptying, providing an animal model for investigating how gastric smooth muscle dysfunction contributes to the pathophysiology of diabetic gastroparesis. Although ROCK2, MYPT1, and CPI-17 activities are reduced in intestinal motility disorders, their functioning has not been investigated in diabetic gastroparesis. We hypothesized that reduced expression and phosphorylation of the myosin light chain phosphatase (MLCP) inhibitory proteins MYPT1 and CPI-17 in ob/ob gastric antrum smooth muscles could contribute to the impaired antrum smooth muscle function of diabetic gastroparesis. Spontaneous and carbachol- and high K+-evoked contractions of gastric antrum smooth muscles from 7 to 12 week old male ob/ob mice were reduced compared to age- and strain-matched controls. There were no differences in spontaneous and agonist-evoked intracellular Ca2+ transients and myosin light chain kinase expression. The F-actin:G-actin ratios were similar. Rho kinase 2 (ROCK2) expression was decreased at both ages. Basal and agonist-evoked MYPT1 and myosin light chain 20 phosphorylation, but not CPI-17 phosphorylation, was reduced compared to age-matched controls. These findings suggest that reduced MLCP inhibition due to decreased ROCK2 phosphorylation of MYPT1 in gastric antrum smooth muscles contributes to the antral dysmotility of diabetic gastroparesis. PMID:23576331

Not all sharks are "swimming noses": variation in olfactory bulb size in cartilaginous fishes.

PubMed

Yopak, Kara E; Lisney, Thomas J; Collin, Shaun P

2015-03-01

Olfaction is a universal modality by which all animals sample chemical stimuli from their environment. In cartilaginous fishes, olfaction is critical for various survival tasks including localizing prey, avoiding predators, and chemosensory communication with conspecifics. Little is known, however, about interspecific variation in olfactory capability in these fishes, or whether the relative importance of olfaction in relation to other sensory systems varies with regard to ecological factors, such as habitat and lifestyle. In this study, we have addressed these questions by directly examining interspecific variation in the size of the olfactory bulbs (OB), the region of the brain that receives the primary sensory projections from the olfactory nerve, in 58 species of cartilaginous fishes. Relative OB size was compared among species occupying different ecological niches. Our results show that the OBs maintain a substantial level of allometric independence from the rest of the brain across cartilaginous fishes and that OB size is highly variable among species. These findings are supported by phylogenetic generalized least-squares models, which show that this variability is correlated with ecological niche, particularly habitat. The relatively largest OBs were found in pelagic-coastal/oceanic sharks, especially migratory species such as Carcharodon carcharias and Galeocerdo cuvier. Deep-sea species also possess large OBs, suggesting a greater reliance on olfaction in habitats where vision may be compromised. In contrast, the smallest OBs were found in the majority of reef-associated species, including sharks from the families Carcharhinidae and Hemiscyllidae and dasyatid batoids. These results suggest that there is great variability in the degree to which these fishes rely on olfactory cues. The OBs have been widely used as a neuroanatomical proxy for olfactory capability in vertebrates, and we speculate that differences in olfactory capabilities may be the result of functional rather than phylogenetic adaptations.

Markers of Oxidative Stress in Human Milk do not Differ by Maternal BMI But are Related to Infant Growth Trajectories.

PubMed

Young, Bridget E; Patinkin, Zachary W; Pyle, Laura; de la Houssaye, Becky; Davidson, Barbara S; Geraghty, Sheela; Morrow, Ardythe L; Krebs, Nancy

2017-06-01

Objective Obesity in adults is associated with inflammation and oxidative stress. Whether or not this phenotype is reflected in human milk (HM) composition, or may impact infant growth remains unknown. We investigated whether HM from overweight/obese (OW/Ob) mothers exhibited higher concentrations of inflammatory cytokines and markers of oxidative stress. We also correlated these bioactive components with infant growth patterns. Methods This was an observational cohort of 56 breastfeeding mothers and their infants [33 normal weight (NW) and 23 OW/Ob]. Infants were followed until 6 months of age and HM collected at 2-weeks and 4-months. Results Markers of oxidative stress, 8-hydroxy-deoxyguanosine (8OHdG) and 4-hydroxynonenol (HNE), decreased in HM over time (p < 0.001) and did not differ between NW and OW/Ob women. Concentrations of inflammatory cytokines, IL-6, IL-8, and TNF-α, were all inter-correlated (p < 0.001) but did not differ between NW and OW/Ob women. HM fat, protein, lactose, and total calories did not differ between NW and OW/Ob women. Infant growth patterns did not differ by group. In a model of infant weight-for-length-Z score trajectory, there was a significant interaction between both lactose and 8OHdG with maternal group: HM lactose and 8OHdG concentrations were both positively associated with increases in WLZ trajectory only among infants breastfed by OW/Ob mothers. Conclusions for Practice HM composition was relatively stable between NW and OW/Ob women. In exclusively breastfed infants, HM concentrations of lactose and 8OHdG, a marker of oxidative stress, may contribute to regulation of infant weight gain, especially among infants of OW/Ob women.

Hyperleptinemia Exacerbates High-Fat Diet-Mediated Atrial Fibrosis and Fibrillation.

PubMed

Fukui, Akira; Ikebe-Ebata, Yuki; Kondo, Hidekazu; Saito, Shotaro; Aoki, Kohei; Fukunaga, Naoya; Shinohara, Tetsuji; Masaki, Takayuki; Teshima, Yasushi; Takahashi, Naohiko

2017-06-01

Obesity including metabolic syndrome is an independent risk factor of atrial fibrillation (AF). Although hyperleptinemia is usually a characteristic of obese subjects, the relationship with atrial fibrosis and AF is unknown. We tested the hypothesis that high-fat diet (HFD)-induced hyperleptinemia exacerbates atrial fibrosis and AF. Eight-week-old male C57BL/6 (WT) and leptin-deficient ob/ob (Ob) mice were treated with a normal-fat diet (NFD) or 60% HFD. After 8 weeks, transesophageal burst pacing and electrophysiological study using isolated perfused hearts were performed and left atrial (LA) tissues were collected for histological analysis, hydroxyproline assay, and reverse transcription-polymerase chain reaction. HFD treatment increased body weight in both WT and Ob mice compared with NFD (both P < 0.01). In WT-HFD mice, hyperleptinemia was observed as expected. While transesophageal burst pacing invariably induced AF (8/8, 100%) in WT-HFD mice, AF was induced less frequently (1/8, 12.5%) in Ob-HFD mice (P < 0.01). In isolated perfused hearts, the interatrial conduction time was prolonged in WT-HFD mice, but not in Ob-HFD mice (P < 0.05). Masson's trichrome staining and the hydroxyproline assay revealed interstitial LA fibrosis in WT-HFD mice, which was not observed in Ob-HFD mice (P < 0.05). Upregulation of collagen1, collagen3, α-smooth muscle actin, tumor necrosis factor-α, and monocyte chemoattractant protein-1 mRNA levels was noted in WT-HFD mice LA, but attenuated in Ob-HFD mice LA. Our findings suggest that hyperleptinemia exacerbates HFD-mediated atrial fibrosis and AF. Inhibition of leptin signaling may become a novel therapeutic target to prevent obesity-related AF. © 2017 Wiley Periodicals, Inc.

Hog millet (Panicum miliaceum L.)-supplemented diet ameliorates hyperlipidemia and hepatic lipid accumulation in C57BL/6J-ob/ob mice

PubMed Central

Park, Mi-Young; Jang, Hwan-Hee; Kim, Jung Bong; Yoon, Hyun Nye; Lee, Jin-Young; Lee, Young-Min; Kim, Jae-Hyun

2011-01-01

Dietary intake of whole grains reduces the incidence of chronic diseases such as obesity, diabetes, cardiovascular disease, and cancer. In an earlier study, we showed that Panicum miliaceum L. extract (PME) exhibited the highest anti-lipogenic activity in 3T3-L1 cells among extracts of nine different cereal grains tested. In this study, we hypothesized that PME in the diet would lead to weight loss and augmentation of hyperlipidemia by regulating fatty acid metabolism. PME was fed to ob/ob mice at 0%, 0.5%, or 1% (w/w) for 4 weeks. After the experimental period, body weight changes, blood serum and lipid profiles, hepatic fatty acid metabolism-related gene expression, and white adipose tissue (WAT) fatty acid composition were determined. We found that the 1% PME diet, but not the 0.5%, effectively decreased body weight, liver weight, and blood triglyceride and total cholesterol levels (P < 0.05) compared to obese ob/ob mice on a normal diet. Hepatic lipogenic-related gene (PPARα, L-FABP, FAS, and SCD1) expression decreased, whereas lipolysis-related gene (CPT1) expression increased in animals fed the 1% PME diet (P < 0.05). Long chain fatty acid content and the ratio of C18:1/C18:0 fatty acids decreased significantly in adipose tissue of animals fed the 1% PME diet (P < 0.05). Serum inflammatory mediators also decreased significantly in animals fed the 1% PME diet compared to those of the ob/ob control group (P < 0.05). These results suggest that PME is useful in the chemoprevention or treatment of obesity and obesity-related disorders. PMID:22259675

Obesity is associated with depot-specific alterations in adipocyte DNA methylation and gene expression.

PubMed

Sonne, Si Brask; Yadav, Rachita; Yin, Guangliang; Dalgaard, Marlene Danner; Myrmel, Lene Secher; Gupta, Ramneek; Wang, Jun; Madsen, Lise; Kajimura, Shingo; Kristiansen, Karsten

2017-04-03

The present study aimed to identify genes exhibiting concomitant obesity-dependent changes in DNA methylation and gene expression in adipose tissues in the mouse using diet-induced obese (DIO) C57BL/6J and genetically obese ob/ob mice as models. Mature adipocytes were isolated from epididymal and inguinal adipose tissues of ob/ob and DIO C57BL/6J mice. DNA methylation was analyzed by MeDIP-sequencing and gene expression by microarray analysis. The majority of differentially methylated regions (DMRs) were hypomethylated in obese mice. Global methylation of long interspersed elements indicated that hypomethylation did not reflect methyl donor deficiency. In both DIO and ob/ob mice, we observed more obesity-associated methylation changes in epididymal than in inguinal adipocytes. Assignment of DMRs to promoter, exon, intron and intergenic regions demonstrated that DIO-induced changes in DNA methylation in C57BL/6J mice occurred primarily in exons, whereas inguinal adipocytes of ob/ob mice exhibited a higher enrichment of DMRs in promoter regions than in other regions of the genome, suggesting an influence of leptin on DNA methylation in inguinal adipocytes. We observed altered methylation and expression of 9 genes in epididymal adipocytes, including the known obesity-associated genes, Ehd2 and Kctd15, and a novel candidate gene, Irf8, possibly involved in immune type 1/type2 balance. The use of 2 obesity models enabled us to dissociate changes associated with high fat feeding from those associated with obesity per se. This information will be of value in future studies on the mechanisms governing the development of obesity and changes in adipocyte function associated with obesity.

Arctigenin, a natural compound, activates AMP-activated protein kinase via inhibition of mitochondria complex I and ameliorates metabolic disorders in ob/ob mice.

PubMed

Huang, S-L; Yu, R-T; Gong, J; Feng, Y; Dai, Y-L; Hu, F; Hu, Y-H; Tao, Y-D; Leng, Y

2012-05-01

Arctigenin is a natural compound that had never been previously demonstrated to have a glucose-lowering effect. Here it was found to activate AMP-activated protein kinase (AMPK), and the mechanism by which this occurred, as well as the effects on glucose and lipid metabolism were investigated. 2-Deoxyglucose uptake and AMPK phosphorylation were examined in L6 myotubes and isolated skeletal muscle. Gluconeogenesis and lipid synthesis were evaluated in rat primary hepatocytes. The acute and chronic effects of arctigenin on metabolic abnormalities were observed in C57BL/6J and ob/ob mice. Changes in mitochondrial membrane potential were measured using the J-aggregate-forming dye, JC-1. Analysis of respiration of L6 myotubes or isolated mitochondria was conducted in a channel oxygen system. Arctigenin increased AMPK phosphorylation and stimulated glucose uptake in L6 myotubes and isolated skeletal muscles. In primary hepatocytes, it decreased gluconeogenesis and lipid synthesis. The enhancement of glucose uptake and suppression of hepatic gluconeogenesis and lipid synthesis by arctigenin were prevented by blockade of AMPK activation. The respiration of L6 myotubes or isolated mitochondria was inhibited by arctigenin with a specific effect on respiratory complex I. A single oral dose of arctigenin reduced gluconeogenesis in C57BL/6J mice. Chronic oral administration of arctigenin lowered blood glucose and improved lipid metabolism in ob/ob mice. This study demonstrates a new role for arctigenin as a potent indirect activator of AMPK via inhibition of respiratory complex I, with beneficial effects on metabolic disorders in ob/ob mice. This highlights the potential value of arctigenin as a possible treatment of type 2 diabetes.

Noninvasive identification of bladder cancer with subsurface backscattered light

NASA Astrophysics Data System (ADS)

Bigio, Irving J.; Mourant, Judith R.; Boyer, James D.; Johnson, Tamara M.; Shimada, Tsutomu; Conn, Richard L.

1994-05-01

We have developed and are testing early prototypes of an optical biopsy system (OBS) for detection of cancer and other tissue pathologies. The OBS invokes a unique approach to optical diagnosis of tissue pathologies based on the elastic scattering properties, over a wide range of wavelengths, of the microscopic structure of the tissue. Absorption bands in the tissue also add useful complexity to the spectral data collected. The data acquisition and storage/display time with the OBS instrument is approximately 1 second. Thus, in addition to the reduced invasiveness of this technique compared with current state-of- the-art methods, the OBS offers the possibility of impressively faster diagnostic assessment. The OBS employs a small fiber-optic probe that is amendable to use with any endoscope, catheter or hypodermic, or to direct surface examination (e.g., as in skin cancer or cervical cancer). We report here specifically on its potential application in the detection of bladder cancer.

The Est3 protein associates with yeast telomerase through an OB-fold domain

PubMed Central

Lee, Jaesung S.; Mandell, Edward K.; Tucey, Timothy M.; Morris, Danna K.; Victoria, Lundblad

2009-01-01

The Est3 protein is a small regulatory subunit of yeast telomerase which is dispensable for enzyme catalysis but essential for telomere replication in vivo. Using structure prediction combined with in vivo characterization, we show here that Est3 consists of a predicted OB (oligo-saccharide/oligo-nucleotide binding) fold. Mutagenesis of predicted surface residues was used to generate a functional map of one surface of Est3, which identified a site that mediates association with the telomerase complex. Surprisingly, the predicted OB-fold of Est3 is structurally similar to the OB-fold of the mammalian TPP1 protein, despite the fact that Est3 and TPP1, as components of telomerase and a telomere capping complex, respectively, perform functionally distinct tasks at chromosome ends. The analysis performed on Est3 may be instructive in generating comparable missense mutations on the surface of the OB-fold domain of TPP1. PMID:19172754

EBCOG Hospital Recognition: where do we stand?

PubMed Central

Wladimiroff, J.; Hornnes, P.

2010-01-01

Hospital Recognition for general Ob/Gyn training programmes was started by EBCOG (European Board & College of Obstetrics & Gynaecology) in 1996 and for subspecialty Ob/Gyn training programmes in 2005, the latter jointly with the four European scientific organisations representing the subspecialties. So far, 85 Audits/Visits have been conducted by EBCOG for general Ob/Gyn training and a good start has been made for subspecialty training, in particular Gynaecological Oncology. EBCOG Visits are conducted by two EBCOG representatives and one trainee appointed by ENTOG (European Network for Trainees in Obstetrics & Gynaecology) for general Ob/Gyn training programmes and by two subspecialty specialists and an EBCOG representative for subspecialty programmes. Each Visit lasts one day. Accredition is granted by the EBCOG Executive Board depending on the Visiting report. Ultimately, EBCOG would like to see the introduction of an auditing and accreditation system for general and subspecialty Ob/Gyn training programmes in each country in Europe PMID:25206968

Ablation of neurons expressing agouti-related protein, but not melanin concentrating hormone, in leptin-deficient mice restores metabolic functions and fertility

PubMed Central

Wu, Qi; Whiddon, Benjamin B.; Palmiter, Richard D.

2012-01-01

Leptin-deficient (Lepob/ob) mice are obese, diabetic, and infertile. Ablation of neurons that make agouti-related protein (AgRP) in moderately obese adult Lepob/ob mice caused severe anorexia. The mice stopped eating for 2 wk and then gradually recovered. Their body weight fell to within a normal range for WT mice, at which point food intake and glucose tolerance were restored to that of WT mice. Remarkably, both male and female Lepob/ob mice became fertile. Ablation of neurons that express melanin-concentrating hormone (MCH) in adult Lepob/ob mice had no effect on food intake, body weight, or fertility, but resulted in improved glucose tolerance. We conclude that AgRP-expressing neurons play a critical role in mediating the metabolic syndrome and infertility of Lepob/ob mice, whereas MCH-expressing neurons have only a minor role. PMID:22232663

Organizational Behavior: A Brief Overview and Safety Orientation.

PubMed

Waller, Mary J

2015-12-01

Organizational Behavior (OB) is a discipline of social science that seeks explanations for human behavior in organizations. OB draws on core disciplines such as psychology, sociology, anthropology, economics, communication, and law to create and investigate multilevel explanations of why people engage in particular behaviors, and which behaviors under which circumstances lead to better outcomes in organizations. Created using an applied or pragmatic lens and tested with a wide range of both quantitative and qualitative methodologies, most OB theories and research have direct implications for managers and for other organizational participants. Not surprisingly, one focal area of OB research concerns safety in organizations, and a growing body of safety-oriented literature in OB is based on data collected during simulation training across a variety of organizations such as hospitals, airlines, nuclear power plants, and other high reliability organizations. Copyright © 2015 Mosby, Inc. All rights reserved.

Cygnus OB2: Star Formation Ugly Duckling Causes a Flap

NASA Astrophysics Data System (ADS)

Drake, Jeremy J.; Wright, Nicholas; Guarcello, Mario

2015-08-01

Cygnus OB2 is one of the largest known OB associations in our Galaxy, with a total stellar mass of 30,000 Msun and boasting an estimated 65 O-type stars and hundreds of OB stars. At a distance of only 1.4kpc, it is also the closest truly massive star forming region and provides a valuable testbed for star and planet formation theory. We have performed a deep stellar census using observations from X-ray to infrared, which has enabled studies of sub-structuring, mass segregation and dynamics, while infrared data reveal a story of protoplanetary disk attrition in an extremely harsh radiation environment. I will discuss how Cygnus OB2 challenges the idea that stars must form in dense, compact clusters, and demonstrates that stars as massive as 100 Msun can form in relatively low-density environments. Convincing evidence of disk photoevaporation poses a potential problem for planet formation and growth in starburst environments.

Resampling to accelerate cross-correlation searches for continuous gravitational waves from binary systems

NASA Astrophysics Data System (ADS)

Meadors, Grant David; Krishnan, Badri; Papa, Maria Alessandra; Whelan, John T.; Zhang, Yuanhao

2018-02-01

Continuous-wave (CW) gravitational waves (GWs) call for computationally-intensive methods. Low signal-to-noise ratio signals need templated searches with long coherent integration times and thus fine parameter-space resolution. Longer integration increases sensitivity. Low-mass x-ray binaries (LMXBs) such as Scorpius X-1 (Sco X-1) may emit accretion-driven CWs at strains reachable by current ground-based observatories. Binary orbital parameters induce phase modulation. This paper describes how resampling corrects binary and detector motion, yielding source-frame time series used for cross-correlation. Compared to the previous, detector-frame, templated cross-correlation method, used for Sco X-1 on data from the first Advanced LIGO observing run (O1), resampling is about 20 × faster in the costliest, most-sensitive frequency bands. Speed-up factors depend on integration time and search setup. The speed could be reinvested into longer integration with a forecast sensitivity gain, 20 to 125 Hz median, of approximately 51%, or from 20 to 250 Hz, 11%, given the same per-band cost and setup. This paper's timing model enables future setup optimization. Resampling scales well with longer integration, and at 10 × unoptimized cost could reach respectively 2.83 × and 2.75 × median sensitivities, limited by spin-wandering. Then an O1 search could yield a marginalized-polarization upper limit reaching torque-balance at 100 Hz. Frequencies from 40 to 140 Hz might be probed in equal observing time with 2 × improved detectors.

Temporal changes in hematologic markers after splenectomy, splenic embolization, and observation for trauma.

PubMed

Wernick, B; Cipriano, A; Odom, S R; MacBean, U; Mubang, R N; Wojda, T R; Liu, S; Serres, S; Evans, D C; Thomas, P G; Cook, C H; Stawicki, S P

2017-06-01

The spleen is one of the most commonly injured abdominal solid organs during blunt trauma. Modern management of splenic trauma has evolved to include non-operative therapies, including observation and angioembolization to preclude splenectomy in most cases of blunt splenic injury. Despite the shift in management strategies, relatively little is known about the hematologic changes associated with these various modalities. The aim of this study was to determine if there are significant differences in hematologic characteristics over time based on the treatment modality employed following splenic trauma. We hypothesized that alterations seen in hematologic parameters would vary between observation (OBS), embolization (EMB), and splenectomy (SPL) in the setting of splenic injury. An institutional review board-approved, retrospective study of routine hematologic indices examined data between March 2000 and December 2014 at three academic trauma centers. A convenience sample of patients with splenic trauma and admission lengths of stay >96 h was selected for inclusion, resulting in a representative sample of each sub-group (OBS, EMB, and SPL). Basic demographics and injury severity data (ISS) were abstracted. Platelet count, red blood cell (RBC) count and RBC indices, and white blood cell (WBC) count with differential were analyzed between the time of admission and a maximum of 1080 h (45 days) post-injury. Comparisons between OBS, EMB, and SPL groups were then performed using non-parametric statistical testing, with statistical significance set at p < 0.05. Data from 130 patients (40 SPL, 40 EMB, and 50 OBS) were analyzed. The median age was 40 years, with 67 % males. Median ISS was 21.5 (21 for SPL, 19 for EMB, and 22 for OBS, p = n/s) and median Glasgow Coma Scale (GCS) was 15. Median splenic injury grade varied by interventional modality (grade 4 for SPL, 3 for EMB, and 2 for OBS, p < 0.05). Inter-group comparisons demonstrated no significant differences in RBC counts. However, mean corpuscular volume (MCV) and RBC distribution width (RDW) were elevated in the SPL and EMB groups (p < 0.01). Similarly, EMB and SPL groups had higher platelet counts than the OBS group (p < 0.01). In aggregate, WBC counts were highest following SPL, followed by EMB and OBS (p < 0.01). Similar trends were noted in neutrophil and monocyte counts (p < 0.01), but not in lymphocyte counts (p = n/s). This study describes important trends and patterns among fundamental hematologic parameters following traumatic splenic injuries managed with SPL, EMB, or OBS. As expected, observed WBC counts were highest following SPL, then EMB, and finally OBS. No differences were noted in RBC count between the three groups, but RDW was significantly greater following SPL compared to EMB and OBS. We also found that MCV was highest following OBS, when compared to EMB or SPL. Finally, our data indicate that platelet counts are similarly elevated for both SPL and EMB, when compared to the OBS group. These results provide an important foundation for further research in this still relatively unexplored area.

Sources and transport of anthropogenic radionuclides in the Ob River system, Siberia

NASA Astrophysics Data System (ADS)

Cochran, J. Kirk; Moran, S. Bradley; Fisher, Nicholas S.; Beasley, Thomas M.; Kelley, James M.

2000-06-01

The potential sources of anthropogenic radionuclides to the Ob River system of western Siberia include global stratospheric fallout, tropospheric fallout from atomic weapons tests and releases from production and reprocessing facilities. Samples of water, suspended and bottom sediments collected in 1994 and 1995 have been used to characterize the sources and transport of 137Cs, Pu isotopes, 237Np and 129I through the system. For the radionuclides that associate with particles, isotope ratios provide clues to their sources, providing any geochemical fractionation can be taken into account. Activity ratios of 239,240Pu/ 137Cs in suspended sediments are lower than the global fallout ratio in the Irtysh River before its confluence with the Ob, comparable to fallout in the central reach of the Ob, and greater than the fallout values in the lower Ob and in the Taz River. This pattern mirrors the downriver decrease in dissolved organic carbon (DOC) concentrations. Laboratory adsorption experiments with Ob River sediment and water show that Kd values for Am (and presumably other actinides) are depressed by two orders of magnitude in the presence of Ob DOC concentrations, relative to values measured in DOC-free Ob water. Iodine and cesium Kd values show little or no (less than a factor of 2) dependence on DOC. Mixing plots using plutonium isotope ratios (atom ratios) show that Pu in suspended sediments of the Ob is a mixture of stratospheric global fallout at northern latitudes, tropospheric fallout from the former Soviet Union test site at Semipalatinsk and reprocessing of spent fuel at Tomsk-7. Plutonium from Semipalatinsk is evident in the Irtysh River above its confluence with the Tobal. Suspended sediment samples taken in the Ob above its confluence with the Irtysh indicate the presence of Pu derived from the Tomsk-7 reprocessing facilities. A mixing plot constructed using 237Np/ 239Pu vs. 240Pu/ 239Pu shows similar mixtures of stratospheric and tropospheric fallout, with the likely addition of inputs from reprocessing facilities and reactor operations. As with Pu/Cs ratios, Np/Pu ratios could be modified by differential geochemical behaviors of Np and Pu. Dissolved 129I only weakly interacts with particles in the Ob; size-fractionated sampling shows that the colloidal 129I fraction (defined as 1 kDa-0.2 μm) contains generally <5% relative to that passing a 0.2 μm filter. Iodine-129 concentrations decrease from 8.3×10 9 to 0.65×10 9 atoms l -1 through the Ob system toward the Kara Sea, with highest values in the Tobal River and lowest in the Taz River. The likely source of the elevated 129I in the Tobal is release from the production-reprocessing facilities at Mayak, and decreases downriver are predominantly due to dilution as the various tributaries with low 129I join the system. Fluxes of 129I to the lower Ob at Salekhard are <1% of the releases of this radionuclide from the nuclear fuel reprocessing facilities at Sellafield, UK and La Hague, France.

Possible Detection of Pi(exp 0)-Decay Gamma-Ray Emission from Cyg OB2 by EGRET

NASA Technical Reports Server (NTRS)

Chen, W.; White, R. L.; Bertsch, D.

1996-01-01

We report possible detection of pi (exp 0) decay radiation from Cyg OB2, a nearby (1.7 kpc) massive OB star association. The EGRET flux (greater than 100 MeV) maps clearly indicate a point source whose error circle includes both Cyg OB2 and Cyg X-3. We show that Cyg X-3 is unlikely to be the counterpart for the EGRET source, because of the marginal spatial consistency and the lack of the 4.8 hour modulation seen in other high energy emissions from Cyg X-3. If confirmed, this will be the first detection by EGRET of massive stars.

Possible detection of π^0^-decay γ-ray emission from CYG OB2 by EGRET.

NASA Astrophysics Data System (ADS)

Chen, W.; White, R. L.; Bertsch, D.

1996-12-01

We report possible detection of π^0^-decay radiation from Cyg OB2, a nearby (1.7kpc) massive OB star association. The EGRET flux (>100MeV) maps clearly indicate a point source whose error circle includes both Cyg OB2 and Cyg X-3. We show that Cyg X-3 is unlikely to be the counterpart for the EGRET source, because of the marginal spatial consistency and the lack of the 4.8-hour modulation seen in other high energy emissions from Cyg X-3. If confirmed, this will be the first detection by EGRET of massive stars.

No evidence of disk destruction by OB stars

NASA Astrophysics Data System (ADS)

Richert, Alexander J. W.; Feigelson, Eric

2015-01-01

It has been suggested that the hostile environments observed in massive star forming regions are inhospitable to protoplanetary disks and therefore to the formation of planets. The Orion Proplyds show disk evaporation by extreme ultraviolet (EUV) photons from Theta1 Orionis C (spectral type O6). In this work, we examine the spatial distributions of disk-bearing and non-disk bearing young stellar objects (YSOs) relative to OB stars in 17 massive star forming regions in the MYStIX (Massive Young Star-Forming Complex Study in Infrared and X-ray) survey. Any tendency of disky YSOs, identified by their infrared excess, to avoid OB stars would reveal complete disk destruction.We consider a sample of MYStIX that includes 78 O3-O9 stars, 256 B stars, 5,606 disky YSOs, and 5,794 non-disky YSOs. For each OB star, we compare the cumulative distribution functions of distances to disky and non-disky YSOs. We find no significant avoidance of OB stars by disky YSOs. This result indicates that OB stars are not sufficiently EUV-luminous and long-lived to completely destroy a disk within its ordinary lifetime. We therefore conclude that massive star forming regions are not clearly hostile to the formation of planets.

Genistein treatment increases bone mass in obese, hyperglycemic mice

PubMed Central

Michelin, Richard M; Al-Nakkash, Layla; Broderick, Tom L; Plochocki, Jeffrey H

2016-01-01

Background Obesity and type 2 diabetes mellitus are associated with elevated risk of limb bone fracture. Incidences of these conditions are on the rise worldwide. Genistein, a phytoestrogen, has been shown by several studies to demonstrate bone-protective properties and may improve bone health in obese type 2 diabetics. Methods In this study, we test the effects of genistein treatment on limb bone and growth plate cartilage histomorphometry in obese, hyperglycemic ob/ob mice. Six-week-old ob/ob mice were divided into control and genistein-treated groups. Genistein-treated mice were fed a diet containing 600 mg genistein/kg for a period of 4 weeks. Cross-sectional geometric and histomorphometric analyses were conducted on tibias. Results Genistein-treated mice remained obese and hyperglycemic. However, histomorphometric comparisons show that genistein-treated mice have greater tibial midshaft diameters and ratios of cortical bone to total tissue area than the controls. Genistein-treated mice also exhibit decreased growth plate thickness of the proximal tibia. Conclusion Our results indicate that genistein treatment affects bone of the tibial midshaft in the ob/ob mouse, independent of improvements in the hyperglycemic state and body weight. PMID:27042131

The over-expression of miR-200a in the hypothalamus of ob/ob mice is linked to leptin and insulin signaling impairment.

PubMed

Crépin, Delphine; Benomar, Yacir; Riffault, Laure; Amine, Hamza; Gertler, Arieh; Taouis, Mohammed

2014-03-25

Early in life, leptin plays a crucial role in hypothalamic neural organization. Leptin, most likely, controls neural gene expression conferring then specific phenotype regarding energy homeostasis. MicroRNAs are new regulators for several physiological functions, including the regulation of metabolism. However, the impact of leptin on hypothalamic microRNA patterns remains unknown. Here, we demonstrate that miR-200a, miR-200b and miR-429 are up-regulated in the hypothalamus of genetically obese and leptin deficient ob/ob mice. Leptin treatment down-regulates these miRNAs in ob/ob hypothalamus. The hypothalamic silencing of miR-200a increased the expression level of leptin receptor and insulin receptor substrate 2, reduced body weight gain, and restored liver insulin responsiveness. In addition, the overexpression of pre-miR-200a in a human neuroblastoma cell line impaired insulin and leptin signaling. These findings link the alteration of leptin and insulin signaling to the up-regulation of hypothalamic miR-200a which could be a new target for treatment of obesity. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Modulation of Irisin and Physical Activity on Executive Functions in Obesity and Morbid obesity

PubMed Central

Fagundo, A. B.; Jiménez-Murcia, S.; Giner-Bartolomé, C.; Agüera, Z.; Sauchelli, S.; Pardo, M.; Crujeiras, A. B.; Granero, R.; Baños, R.; Botella, C.; de la Torre, R.; Fernández-Real, J. M.; Fernández-García, J. C.; Frühbeck, G.; Rodríguez, A.; Mallorquí-Bagué, N.; Tárrega, S.; Tinahones, F. J.; Rodriguez, R.; Ortega, F.; Menchón, J. M.; Casanueva, F. F.; Fernández-Aranda, F.

2016-01-01

Whether the executive profile is different between obesity (OB) and morbid obesity (MO) remains unclear. Recent evidence suggests that physical activity (PA) can act as a cognitive enhancer. Irisin is a recently discovered hormone associated with some of the positive effects of PA. The objective of the study was to investigate the executive profile in OB and MO, and to explore the role of PA and irisin. 114 participants were included (21 OB, 44 MO and 49 healthy controls-HC) in the study and assessed with the Wisconsin Card Sorting Test, Stroop Color and Word Test, and Iowa Gambling Task. All participants were female, aged between 18 and 60 years. Results showed a similar dysfunctional profile on decision making in OB and MO compared with HC. Thus, no specific neuropsychological profiles between OB and MO can be clearly observed in our sample. However, a negative correlation was found between irisin and executive functioning. These results demonstrate a specific executive profile in OB and a relevant and negative modulation of irisin on executive functioning. Although irisin might be a promising target for the treatment of obesity, its effects on cognition might be considered when thinking about its therapeutic use. PMID:27476477

Identification of Four Mouse Diabetes Candidate Genes Altering β-Cell Proliferation.

PubMed

Kluth, Oliver; Matzke, Daniela; Kamitz, Anne; Jähnert, Markus; Vogel, Heike; Scherneck, Stephan; Schulze, Matthias; Staiger, Harald; Machicao, Fausto; Häring, Hans-Ulrich; Joost, Hans-Georg; Schürmann, Annette

2015-09-01

Beta-cell apoptosis and failure to induce beta-cell regeneration are hallmarks of type 2-like diabetes in mouse models. Here we show that islets from obese, diabetes-susceptible New Zealand Obese (NZO) mice, in contrast to diabetes-resistant C57BL/6J (B6)-ob/ob mice, do not proliferate in response to an in-vivo glucose challenge but lose their beta-cells. Genome-wide RNAseq based transcriptomics indicated an induction of 22 cell cycle-associated genes in B6-ob/ob islets that did not respond in NZO islets. Of all genes differentially expressed in islets of the two strains, seven mapped to the diabesity QTL Nob3, and were hypomorphic in either NZO (Lefty1, Apoa2, Pcp4l1, Mndal, Slamf7, Pydc3) or B6 (Ifi202b). Adenoviral overexpression of Lefty1, Apoa2, and Pcp4l1 in primary islet cells increased proliferation, whereas overexpression of Ifi202b suppressed it. We conclude that the identified genes in synergy with obesity and insulin resistance participate in adaptive islet hyperplasia and prevention from severe diabetes in B6-ob/ob mice.

Identification of Four Mouse Diabetes Candidate Genes Altering β-Cell Proliferation

PubMed Central

Kamitz, Anne; Jähnert, Markus; Vogel, Heike; Scherneck, Stephan; Schulze, Matthias; Staiger, Harald; Machicao, Fausto; Häring, Hans-Ulrich; Joost, Hans-Georg; Schürmann, Annette

2015-01-01

Beta-cell apoptosis and failure to induce beta-cell regeneration are hallmarks of type 2-like diabetes in mouse models. Here we show that islets from obese, diabetes-susceptible New Zealand Obese (NZO) mice, in contrast to diabetes-resistant C57BL/6J (B6)-ob/ob mice, do not proliferate in response to an in-vivo glucose challenge but lose their beta-cells. Genome-wide RNAseq based transcriptomics indicated an induction of 22 cell cycle-associated genes in B6-ob/ob islets that did not respond in NZO islets. Of all genes differentially expressed in islets of the two strains, seven mapped to the diabesity QTL Nob3, and were hypomorphic in either NZO (Lefty1, Apoa2, Pcp4l1, Mndal, Slamf7, Pydc3) or B6 (Ifi202b). Adenoviral overexpression of Lefty1, Apoa2, and Pcp4l1 in primary islet cells increased proliferation, whereas overexpression of Ifi202b suppressed it. We conclude that the identified genes in synergy with obesity and insulin resistance participate in adaptive islet hyperplasia and prevention from severe diabetes in B6-ob/ob mice. PMID:26348837

Inner and outer segment junction (IS/OS line) integrity in ocular Behçet's disease.

PubMed

Yüksel, Harun; Türkcü, Fatih M; Sahin, Muhammed; Cinar, Yasin; Cingü, Abdullah K; Ozkurt, Zeynep; Sahin, Alparslan; Ari, Seyhmus; Caça, Ihsan

2014-08-01

In this study, we examined the spectral domain optical coherence tomography (OCT) findings of ocular Behçet's disease (OB) in patients with inactive uveitis. Specifically, we analyzed the inner and outer segment junction (IS/OS line) integrity and the effect of disturbed IS/OS line integrity on visual acuity. Patient files and OCT images of OB patients who had been followed-up between January and June of the year 2013 at the Dicle University Eye Clinic were evaluated retrospectively. Sixty-six eyes of 39 patients were included the study. OCT examination of the patients with inactive OB revealed that approximately 25% of the patients had disturbed IS/OS and external limiting membrane (EML) line integrity, lower visual acuity (VA), and lower macular thickness than others. Linear regression analysis revealed that macular thickness was not an independent variable for VA. In contrast, the IS/OS line integrity was an independent variable for VA in inactive OB patients. In this study, we showed that the IS/OS line integrity was an independent variable for VA in inactive OB patients. Further prospective studies are needed to evaluate the integrity of the IS/OS line in OB patients.

Modeling and characterization of different channels based on human body communication.

PubMed

Jingzhen Li; Zedong Nie; Yuhang Liu; Lei Wang

2017-07-01

Human body communication (HBC), which uses the human body as a transmission medium for electrical signals, provides a prospective communication solution for body sensor networks (BSNs). In this paper, an inhomogeneous model which includes the tissue layers of skin, fat, and muscle is proposed to study the propagation characteristics of different HBC channels. Specifically, the HBC channels, namely, the on-body to on-body (OB-OB)channel, on-body to in-body (OB-IB) channel, in-body to on-body (IB-OB) channel, and in-body to in-body (IB-IB)channel, are studied over different frequencies (from 1MHz to 100MHz) through numerical simulations with finite-difference time-domain (FDTD) method. The results show that the gain of OB-IB channel and IB-OB channel is almost the same. The gain of IB-IB channel is greater than other channels in the frequency range 1MHz to 70MHz. In addition, the gain of all channels is associated with the channel length and communication frequency. The simulations are verified by experimental measurements in a porcine tissue sample. The results show that the simulations are in agreement with the measurements.

The Galactic Distribution of OB Associations in Molecular Clouds

NASA Astrophysics Data System (ADS)

Williams, Jonathan P.; McKee, Christopher F.

1997-02-01

Molecular clouds account for half of the mass of the interstellar medium interior to the solar circle and for all current star formation. Using cloud catalogs of two CO surveys of the first quadrant, we have fitted the mass distribution of molecular clouds to a truncated power law in a similar manner as the luminosity function of OB associations in the companion paper to this work. After extrapolating from the first quadrant to the entire inner Galaxy, we find that the mass of cataloged clouds amounts to only 40% of current estimates of the total Galactic molecular mass. Following Solomon & Rivolo, we have assumed that the remaining molecular gas is in cold clouds, and we normalize the distribution accordingly. The predicted total number of clouds is then shown to be consistent with that observed in the solar neighborhood where cloud catalogs should be more complete. Within the solar circle, the cumulative form of the distribution is \\Nscrc(>M)=105[(Mu/M)0.6-1], where \\Nscrc is the number of clouds, and Mu = 6 × 106 M⊙ is the upper mass limit. The large number of clouds near the upper cutoff to the distribution indicates an underlying physical limit to cloud formation or destruction processes. The slope of the distribution corresponds to d\\Nscrc/dM~M-1.6, implying that although numerically most clouds are of low mass, most of the molecular gas is contained within the most massive clouds. The distribution of cloud masses is then compared to the Galactic distribution of OB association luminosities to obtain statistical estimates of the number of massive stars expected in any given cloud. The likelihood of massive star formation in a cloud is determined, and it is found that the median cloud mass that contains at least one O star is ~105 M⊙. The average star formation efficiency over the lifetime of an association is about 5% but varies by more than 2 orders of magnitude from cloud to cloud and is predicted to increase with cloud mass. O stars photoevaporate their surrounding molecular gas, and even with low rates of formation, they are the principal agents of cloud destruction. Using an improved estimate of the timescale for photoevaporation and our statistics on the expected numbers of stars per cloud, we find that 106 M⊙ giant molecular clouds (GMCs) are expected to survive for about 3 × 107 yr. Smaller clouds are disrupted, rather than photoionized, by photoevaporation. The porosity of H II regions in large GMCs is shown to be of order unity, which is consistent with self-regulation of massive star formation in GMCs. On average, 10% of the mass of a GMC is converted to stars by the time it is destroyed by photoevaporation.

Industry Payments to Obstetrician-Gynecologists: An Analysis of 2014 Open Payments Data.

PubMed

Tierney, Nicole M; Saenz, Cheryl; McHale, Michael; Ward, Kristy; Plaxe, Steven

2016-02-01

To evaluate publically available, individually identified data regarding industry payments made to obstetrician-gynecologists (ob-gyns) during 2014 posted on the Centers for Medicare & Medicaid Services' Open Payments website for the purposes of encouraging ob-gyns to partake in disclosure of their fiscal relationships to patients and to take an active role in maintaining accuracy of their payment data. In this retrospective study, we reviewed the Centers for Medicare & Medicaid Services' Open Payments website for all 2014 nonresearch payments to ob-gyns. We compared payments to ob-gyns with payments to those in other specialties as well as subspecialties within the field of obstetrics and gynecology. Univariate statistical analyses were performed. Payments to ob-gyns totaled $60,004,472 (3.3% of the total value transferred in 2014) and went to 29,783 physician recipients. Fifty percent of these payments were for royalties and licensing. Obstetrics and gynecology ranked seventh in total number of payments made to a single specialty (n=311,485), and 20th of 35 specialties for highest median payment ($140, interquartile range $50-347). Medtronic USA, Inc. was the leading payer to ob-gyns. Ob-gyns are listed as having received substantial payments from industry in 2014. Because this information is publically available, we suggest physicians become familiar with payment data and the correction process, keep independent records, and register for updates to most effectively manage perceived, or real, conflicts of interest.

Time Trend and Demographic and Geographic Disparities in Childhood Obesity Prevalence in China—Evidence from Twenty Years of Longitudinal Data

PubMed Central

Jia, Peng; Xue, Hong; Zhang, Ji; Wang, Youfa

2017-01-01

Childhood overweight and obesity (ow/ob) has become a serious threat to many countries, including China. However, limited evidence was obtained from longitudinal data in China. This study examined the secular trends and geographic variation in the prevalence of ow/ob and obesity only, and age, gender, and urban-rural disparities among school-aged children across China. Data from children aged 6–17 surveyed in China Health and Nutrition Survey (CHNS) from 1991 (n = 2712) to 2011 (n = 1054) were used. Overweight and obesity were defined based on the International Obesity Task Force (IOTF) recommended Asian age-sex-specific BMI cut-off-points. We found that: (1) childhood ow/ob and obesity prevalence increased from 11.7% to 25.2% and from 2.8% to 10.1% during 1991–2011, respectively; (2) children aged 6–12 experienced a 1.3 and 1.6 times increase in ow/ob and obesity prevalence than children aged 13–17, respectively; (3) the urban-rural gap in ow/ob prevalence widened; (4) ow/ob prevalence in boys was higher and increased faster than in girls, especially in an urban setting; and (5) geographic variation was observed with faster increases in more economically developed east, central and northeast regions than in the less developed west. The findings added more nuances to the picture of temporal changes in ow/ob prevalence among Chinese children. PMID:28362361

An All-Optical Access Metro Interface for Hybrid WDM/TDM PON Based on OBS

NASA Astrophysics Data System (ADS)

Segarra, Josep; Sales, Vicent; Prat, Josep

2007-04-01

A new all-optical access metro network interface based on optical burst switching (OBS) is proposed. A hybrid wavelength-division multiplexing/time-division multiplexing (WDM/TDM) access architecture with reflective optical network units (ONUs), an arrayed-waveguide-grating outside plant, and a tunable laser stack at the optical line terminal (OLT) is presented as a solution for the passive optical network. By means of OBS and a dynamic bandwidth allocation (DBA) protocol, which polls the ONUs, the available access bandwidth is managed. All the network intelligence and costly equipment is located at the OLT, where the DBA module is centrally implemented, providing quality of service (QoS). To scale this access network, an optical cross connect (OXC) is then used to attain a large number of ONUs by the same OLT. The hybrid WDM/TDM structure is also extended toward the metropolitan area network (MAN) by introducing the concept of OBS multiplexer (OBS-M). The network element OBS-M bridges the MAN and access networks by offering all-optical cross connection, wavelength conversion, and data signaling. The proposed innovative OBS-M node yields a full optical data network, interfacing access and metro with a geographically distributed access control. The resulting novel access metro architectures are nonblocking and, with an improved signaling, provide QoS, scalability, and very low latency. Finally, numerical analysis and simulations demonstrate the traffic performance of the proposed access scheme and all-optical access metro interface and architectures.

Delivery of RNAi reagents in murine models of obesity and diabetes.

PubMed

Wilcox, Denise M; Yang, Ruojing; Morgan, Sherry J; Nguyen, Phong T; Voorbach, Martin J; Jung, Paul M; Haasch, Deanna L; Lin, Emily; Bush, Eugene N; Opgenorth, Terry J; Jacobson, Peer B; Collins, Christine A; Rondinone, Cristina M; Surowy, Terry; Landschulz, Katherine T

2006-11-29

RNA interference (RNAi) is an exciting new tool to effect acute in vivo knockdown of genes for pharmacological target validation. Testing the application of this technology to metabolic disease targets, three RNAi delivery methods were compared in two frequently utilized preclinical models of obesity and diabetes, the diet-induced obese (DIO) and B6.V-Lep/J (ob/ob) mouse. Intraperitoneal (i.p.) and high pressure hydrodynamic intravenous (i.v.) administration of naked siRNA, and low pressure i.v. administration of shRNA-expressing adenovirus were assessed for both safety and gene knockdown efficacy using constructs targeting cJun N-terminal kinase 1 (JNK1). Hydrodynamic delivery of siRNA lowered liver JNK1 protein levels 40% in DIO mice, but was accompanied by iatrogenic liver damage. The ob/ob model proved even more intolerant of this technique, with hydrodynamic delivery resulting in severe liver damage and death of most animals. While well-tolerated, i.p. injections of siRNA in DIO mice did not result in any knockdown or phenotypic changes in the mice. On the other hand, i.v. injected adenovirus expressing shRNA potently reduced expression of JNK1 in vivo by 95% without liver toxicity. In conclusion, i.p. and hydrodynamic injections of siRNA were ineffective and/or inappropriate for in vivo gene targeting in DIO and ob/ob mice, while adenovirus-mediated delivery of shRNA provided a relatively benign and effective method for exploring liver target silencing.

Teaching obstetrics and gynaecology to male undergraduate medical students: student's perception.

PubMed

Alam, Kinza; Safdar, Chaudhry Aqeel; Munir, Tahir Ahmad; Ghani, Zeeshan

2014-01-01

In Pakistan there is a dearth of male practitioners in obstetrics and gynaecology (ObG) to cater for emergent needs. The Study was done to explore views of male medical students towards ObG as part of curriculum and to identify the problems during clerkship and its impact on selection of ObG as career. The study used a 20-item questionnaire-based survey at Shifa College of Medicine from November 2010 to December 2011. Third and fourth year male students (n=124) who completed ObG rotation were the participants. Inquiries were made regarding patient doctor interaction under residents and faculty members, perception of gender- bias during clerkship, inclusion of ObG in curriculum and subsequently as career. Results were analyzed using binary regression analysis. Sixty percent students were satisfied though embarrassed and under pressure during gynaecological examination in consultant supervision. Another 61% said that ObG should be a part of curriculum (p-0.013) and necessary for male students (p-0.008). 62% of the respondents were of the view that faculty has a major role in encouraging the students to take up ObG as career. 84% students replied in negative to adopt it as profession (p 0.002). Although basic obstetric curricular objectives are important for medical practitioners, our social set up discourages male students to have concrete clinical interaction. The faculty needs to take a special supportive role to encourage learning and motivation for this specialty.

Time Trend and Demographic and Geographic Disparities in Childhood Obesity Prevalence in China-Evidence from Twenty Years of Longitudinal Data.

PubMed

Jia, Peng; Xue, Hong; Zhang, Ji; Wang, Youfa

2017-03-31

Childhood overweight and obesity (ow/ob) has become a serious threat to many countries, including China. However, limited evidence was obtained from longitudinal data in China. This study examined the secular trends and geographic variation in the prevalence of ow/ob and obesity only, and age, gender, and urban-rural disparities among school-aged children across China. Data from children aged 6-17 surveyed in China Health and Nutrition Survey (CHNS) from 1991 (n = 2712) to 2011 (n = 1054) were used. Overweight and obesity were defined based on the International Obesity Task Force (IOTF) recommended Asian age-sex-specific BMI cut-off-points. We found that: (1) childhood ow/ob and obesity prevalence increased from 11.7% to 25.2% and from 2.8% to 10.1% during 1991-2011, respectively; (2) children aged 6-12 experienced a 1.3 and 1.6 times increase in ow/ob and obesity prevalence than children aged 13-17, respectively; (3) the urban-rural gap in ow/ob prevalence widened; (4) ow/ob prevalence in boys was higher and increased faster than in girls, especially in an urban setting; and (5) geographic variation was observed with faster increases in more economically developed east, central and northeast regions than in the less developed west. The findings added more nuances to the picture of temporal changes in ow/ob prevalence among Chinese children.

The Approach of General Surgeons to Oncoplastic and Reconstructive Breast Surgery in Turkey: A Survey of Practice Patterns

PubMed Central

Emiroğlu, Mustafa; Sert, İsmail; İnal, Abdullah; Karaali, Cem; Peker, Kemal; İlhan, Enver; Gülcelik, Mehmet; Erol, Varlık; Güngör, Hilmi; Can, Didem; Aydın, Cengiz

2014-01-01

Background: Oncoplastic Breast Surgery (OBS), which is a combination of oncological procedures and plastic surgery techniques, has recently gained widespread use. Aims: To assess the experiences, practice patterns and preferred approaches to Oncoplastic and Reconstructive Breast Surgery (ORBS) undertaken by general surgeons specializing in breast surgery in Turkey. Study Design: Cross-sectional study. Methods: Between December 2013 and February 2014, an eleven-question survey was distributed among 208 general surgeons specializing in breast surgery. The questions focused on the attitudes of general surgeons toward performing oncoplastic breast surgery (OBS), the role of the general surgeon in OBS and their training for it as well as their approaches to evaluating cosmetic outcomes in Breast Conserving Surgery (BCS) and informing patients about ORBS preoperatively. Results: Responses from all 208 surgeons indicated that 79.8% evaluated the cosmetic outcomes of BCS, while 94.2% informed their patients preoperatively about ORBS. 52.5% performed BCS (31.3% themselves, 21.1% together with a plastic surgeon). 53.8% emphasized that general surgeons should carry out OBS themselves. 36.1% of respondents suggested that OBS training should be included within mainstream surgical training, whereas 27.4% believed this training should be conducted by specialised centres. Conclusion: Although OBS procedure rates are low in Turkey, it is encouraging to see general surgeons practicing ORBS themselves. The survey demonstrates that our general surgeons aspire to learn and utilize OBS techniques. PMID:25667784

Obs4MIPS: Satellite Observations for Model Evaluation

NASA Astrophysics Data System (ADS)

Ferraro, R.; Waliser, D. E.; Gleckler, P. J.

2017-12-01

This poster will review the current status of the obs4MIPs project, whose purpose is to provide a limited collection of well-established and documented datasets for comparison with Earth system models (https://www.earthsystemcog.org/projects/obs4mips/). These datasets have been reformatted to correspond with the CMIP5 model output requirements, and include technical documentation specifically targeted for their use in model output evaluation. The project holdings now exceed 120 datasets with observations that directly correspond to CMIP5 model output variables, with new additions in response to the CMIP6 experiments. With the growth in climate model output data volume, it is increasing more difficult to bring the model output and the observations together to do evaluations. The positioning of the obs4MIPs datasets within the Earth System Grid Federation (ESGF) allows for the use of currently available and planned online tools within the ESGF to perform analysis using model output and observational datasets without necessarily downloading everything to a local workstation. This past year, obs4MIPs has updated its submission guidelines to closely align with changes in the CMIP6 experiments, and is implementing additional indicators and ancillary data to allow users to more easily determine the efficacy of an obs4MIPs dataset for specific evaluation purposes. This poster will present the new guidelines and indicators, and update the list of current obs4MIPs holdings and their connection to the ESGF evaluation and analysis tools currently available, and being developed for the CMIP6 experiments.

Major pollutants in soils of abandoned agricultural land contaminated by e-waste activities in Hong Kong.

PubMed

Lopez, Brenda Natalia; Man, Yu Bon; Zhao, Yin Ge; Zheng, Jin Shu; Leung, Anna Oi Wah; Yao, Jun; Wong, Ming Hung

2011-07-01

Polycyclic aromatic hydrocarbon (PAH), polychlorinated biphenyl (PCB), polybrominated diphenyl ether (PBDE) compounds and five heavy metals (cadmium, copper, chromium, lead, and zinc) were determined in soil samples collected from six sites of abandoned agricultural land affected by electronic-waste: e-waste dismantling workshop [EW (DW)], e-waste open burning site [EW (OBS)], e-waste storage [EW (S)], and agricultural (A) in the New Territories, Hong Kong. Persistent organic pollutants (POPs) and heavy metals were detected in all soil samples. EW (DW) contained the highest concentrations of PAHs, Cr, Cu, and Zn, whereas EW (OBS) had the highest concentrations of PCBs, PBDEs, Cd, and Pb. PAH at EW (DW) and EW (OBS) and PCB concentrations at EW (OBS) exceeded the target values of the New Dutch list, whereas Cd, Cu, Cr, Pb, and Zn levels exceeded the Chinese legislation for the protection of agricultural production and safeguarding of human health, by 3-11 times at EW (OBS) and 5-8 times at EW (DW). Lead at EW (OBS) and EW (DW) and Cr at EW (DW) greatly exceeded the Canadian Soil Quality Guidelines by 46 and 20 times and 27 times, respectively. Concentrations of POPs and heavy metals at EW (DW) and EW (OBS) were significantly higher than at EW (S) and A. It was concluded that e-waste activities led to increases of toxic chemicals at these abandoned agricultural land, which would hinder the redevelopment of the land.

Flooding of the Ob and Irtysh Rivers, Russia

NASA Technical Reports Server (NTRS)

2002-01-01

This pair of true- and false-color images shows flooding along the Ob' (large east-west running river) and Irtysh (southern tributary of the Ob') on July 7, 2002. In the false-color image, land surfaces are orange-gold and flood waters are black or dark blue. Fires are marked with red dots in both images. Rivers Credit: Jacques Descloitres, MODIS Land Rapid Response Team, NASA/GSFC

Ethical issues identified by obstetrics and gynecology learners through a novel ethics curriculum.

PubMed

Mejia, Rachel B; Shinkunas, Laura A; Ryan, Ginny L

2015-12-01

Obstetrics and gynecology (ob/gyn) is fraught with bioethical issues, the professional significance of which may vary based on clinical experience. Our objective was to utilize our novel ethics curriculum to identify ethics and professionalism issues highlighted by ob/gyn learners and to compare responses between learner levels to further inform curricular development. We introduced an integrated and dynamic ob/gyn ethics and professionalism curriculum and mixed methods analysis of 181 resulting written reflections (case observation and assessments) from third-year medical students and from first- to fourth-year ob/gyn residents. Content was compared by learner level using basic thematic analysis and summary statistics. Within the 7 major ethics and professionalism domains, learners wrote most frequently about miscellaneous ob/gyn issues such as periviability and abortion (22% of students, 20% of residents) and problematic treatment decisions (20% of students, 19% of residents) rather than professional duty, communication, justice, student-/resident-specific issues, or quality of care. The most commonly discussed ob/gyn area by both learner groups was obstetrics rather than gynecology, gynecologic oncology, or reproductive endocrinology and infertility, although residents were more likely to discuss obstetrics-related concerns than students (65% vs 48%; P = .04) and students wrote about gynecologic oncology-related concerns more frequently than residents (25% vs 6%; P = .002). In their reflections, sources of ethical value (eg, the 4 classic ethics principles, professional guidelines, and consequentialism) were cited more frequently and in greater number by students than by residents (82% of students cited at least 1 source of ethical value vs 65% of residents; P = .01). Residents disagreed more frequently with the ethical propriety of clinical management than did students (67% vs 43%; P = .005). Our study introduces an innovative and dynamic approach to an ob/gyn ethics and professionalism curriculum that highlights important learner-identified ethics and professionalism issues both specific to ob/gyn and common to clinical medicine. Findings will help ob/gyn educators best utilize and refine this flexible curriculum such that it is appropriately focused on topics relevant to each learner level. Copyright © 2015 Elsevier Inc. All rights reserved.

Enigma of Runaway Stars Solved

NASA Astrophysics Data System (ADS)

1997-01-01

Supernova Propels Companion Star through Interstellar Space The following success story is a classical illustration of scientific progress through concerted interplay of observation and theory. It concerns a 35-year old mystery which has now been solved by means of exciting observations of a strange double star. An added touch is the successive involvement of astronomers connected to the European Southern Observatory. For many years, astronomers have been puzzled by the fact that, among the thousands of very young, hot and heavy stars which have been observed in the Milky Way, there are some that move with exceptionally high velocities. In some cases, motions well above 100 km/sec, or ten times more than normal for such stars, have been measured. How is this possible? Which mechanism is responsible for the large amounts of energy needed to move such heavy bodies at such high speeds? Could it be that these stars are accelerated during the powerful explosion of a companion star as a supernova? Such a scenario was proposed in 1961 by Adriaan Blaauw [1], but until now, observational proof has been lacking. Now, however, strong supporting evidence for this mechanism has become available from observations obtained at the ESO La Silla observatory. The mysterious runaway stars OB-runaway stars [2] are heavy stars that travel through interstellar space with an anomalously high velocity. They have been known for several decades, but it has always been a problem to explain their high velocities. Although most OB-runaway stars are located at distances of several thousands of lightyears, their high velocity results in a measurable change in position on sky photos taken several years apart. The velocity component in the direction of the Earth can be measured very accurately from a spectrogram. From a combination of such observations, it is possible to measure the space velocity of OB-runaways. Bow shocks reveal runaway stars It has also been found that some OB-runaways display bow shocks of compressed matter, which look very much like the bow wave around a boat crossing the ocean. They are of the same physical nature as a bow shock created by a jet-fighter in the air. The explanation is similar: when an OB-runaway star plows through the interstellar medium (a very thin mixture of gas and dust particles) with supersonic velocity [3], interstellar matter is swept up in a bow shock. Stars of low velocity do not create bow shocks. Thus, the detection of a bow shock around a particular OB star indicates that it must have a supersonic velocity, thereby securely identifying it as a runaway star, even if its velocity has not been measured directly. Runaway stars come from stellar groups When a star's direction of motion in space is known, it is possible to reconstruct its previous path and, even more interestingly, to find the place where the star originally came from. It turns out that the paths of many OB-runaways can be traced back to socalled OB-associations , that is groups of 10 to 100 OB-type stars which are located in the spiral arms of our galaxy. About fifty OB-associations are known in the Milky Way. In fact, the majority of all known OB stars are members of an OB-association. Therefore, it is not very surprising that OB-runaway stars should also originate from OB-associations. This is also how they got their name: at some moment, they apparently left the association in which they were formed. The ejection mechanism But why were the OB-runaway stars kicked out of the OB-association and how did they achieve such high speeds? One possibility is that some OB stars in an OB-association are ejected due to strong gravitational effects at the time of close encounters between the members of the group. Complicated computer simulations show that this is in principle possible. Nevertheless, since many years, most astronomers think that a more likely scenario is that of violent supernova explosions, first proposed in 1961 by Adriaan Blaauw. Stellar evolution theory predicts that all OB stars will end their life in a supernova explosion. The heavier the OB star, the shorter its life. For instance, an OB star with a mass of 25 times that of the Sun, will explode after only 10 million years, compared to an expected life-time of about 13,000 million years for the Sun (which is not an OB star and will not become a supernova). Blaauw suggested that when an OB star is bound to another OB star in a binary system (a `double star'), the supernova explosion of one of the stars (the heaviest of the two would explode first) results in the rapid acceleration (in astronomical terminology, a `kick') of the other one. The reason for this is as follows. When two heavy stars orbit each other at high velocity, they are held together by their mutual gravitational attraction. But after the supernova explosion, one of the stars has lost most of its mass and there is no force to hold back the remaining OB star. The OB-star therefore immediately leaves its orbit and continues in a straight line while preserving its high orbital velocity. The effect is the same as when cutting a swinging rope with a stone attached to the end. Soon thereafter, this star will escape from the OB-association and start its journey through interstellar space as a new OB-runaway. Stellar evolution in a binary system About half of the known OB stars are members of a binary system. Modern evolutionary scenarios for such systems were developed by Edward van den Heuvel [4]. He realized that during the evolution of a close binary system, a phase of intensive mass transfer occurs, whereby matter flows from the heavier star towards its lighter companion. This has important consequences for the further evolution of the system. The mass transfer happens, after a few million years or even less, when the heaviest and therefore most rapidly evolving star increases in size and becomes a supergiant , many times larger than our Sun. The rate of mass transfer can become so large that this initially heaviest star eventually becomes lighter than its companion. This phase of mass transfer will not change the ultimate fate of the supergiant star and it will still be the first of the two to explode as a supernova. An important result of the mass transfer process is, however, that the central remnant of the supernova explosion, i.e. a neutron star or a black hole will remain gravitationally bound in an orbit around the companion OB star, also after it has received a high kick velocity. Compact companions of runaway stars Thus, from what is known about the evolution of heavy stars in binary systems, an OB-runaway that is expelled from an OB-association by a supernova explosion should be accompanied by a compact star. However, many astronomers have in the past looked carefully for the presence of a neutron star or a black hole around the known OB-runaway stars, but none was ever found. That negative observational result obviously did not lend support to the supernova scenario. This was a long-standing enigma. Fortunately, it now appears that it has finally been solved. Based on new observations, a group of astronomers [5], headed by Lex Kaper of ESO, has found that a well-known binary system of an OB-star and a compact neutron star possesses all the charateristics of a bona-fide runaway star. Vela X-1 is the brightest X-ray source in the Vela constellation. It consists of a so-called X-ray pulsar [6] which is definitely a neutron star produced by a supernova explosion and an OB star as companion. Detection of a bow shock around Vela X-1 ESO Press Photo 02/97 Caption to ESO PR Photo 02/97 [JPG, 184k] An image (ESO Press Photo 02/97) of the surroundings of the comparatively bright OB star HD77581 and its (optically invisible) companion Vela X-1 was obtained with the 1.54-m Danish telescope at La Silla, through a narrow-band H-alpha filter. It clearly shows the presence of a typical bow shock, thus immediately confirming the runaway status of this system. In fact, this is one of the most `perfect' bow shocks of parabolic form ever observed around an OB-runaway. Moreover, the orientation of the bow shock indicates that the system is moving towards the north; its origin must therefore lie somewhere south of its present position in the sky. It also turns out that the accordingly deduced path of HD77581 crosses a well-known OB-association with the designation Vel OB1 . At the measured distance of Vel OB1 of about 6000 lightyears, the observed proper motion and radial velocity of HD77581 indicate a space velocity of 90 km/sec. With this velocity, it would have taken HD77581 and its compact companion about 2.5 million years to travel the distance between Vel OB1 and its present position. This corresponds exactly to the expected time that has passed since the supernova explosion of the progenitor star of Vela~X-1, as deduced from the observed properties of the binary system. The puzzle comes together Now everything fits! The observation of a bow shock around the OB star HD77581 and its compact companion Vela X-1 supports the scenario originally proposed by Blaauw to create OB-runaway stars by the supernova explosion of the binary companion. Following back the path of the system resulted in the discovery of the place where it was born and from where it escaped after the violent supernova explosion which produced the neutron star that now manifests itself as the strong X-ray source known as Vela X-1. More information about this research project This research project is described in ESO Preprint no.~1199 and will appear shortly as a Letter to the Editor in `Astrophysical Journal' (ApJ 475, L37-L40). Notes: [1] Professor Adriaan Blaauw is a well-known Dutch astronomer (Leiden and Groningen). He participated very actively in the build-up of ESO in the 1950's and 60's and he was ESO Director General from 1970 - 1974. He is the author of ` ESO's Early History - The European Southern Observatory from concept to reality ' (1991). [2] The designation OB refers to the classification of their spectra which mostly show absorption lines of hydrogen and helium. Their high surface temperature, in some cases up to 50,000 o C, and large masses, from 10 to 50 times that of the Sun, are deduced by analysis of their spectra. [3] The term supersonic means that the velocity of the moving object is higher than that of the velocity of sound in the surrounding medium. While it is about 330 m/sec in the Earth's lower atmosphere, it is about 10 km/sec in the nearly empty interstellar space. [4] Professor Edward van den Heuvel works at the University of Amsterdam and is a member of the ESO Council, the highest authority of this Organisation. [5] The group members are Lex Kaper, Jacco van Loon, Thomas Augusteijn, Paul Goodfrooij, Ferdinando Patat, Albert Zijlstra (ESO) and Rens Waters (Astronomical Institute, Amsterdam, The Netherlands). [6] In 1971, the current Director General of ESO, Professor Riccardo Giacconi , was one of the first to propose that `X-ray pulsars' are rapidly rotating neutron stars. How to obtain ESO Press Information ESO Press Information is made available on the World-Wide Web (URL: http://www.eso.org../). ESO Press Photos may be reproduced, if credit is given to the European Southern Observatory.

Business and Organizational Models of Obstetric and Gynecologic Hospitalist Groups.

PubMed

Garite, Thomas J; Levine, Lisa; Olson, Rob

2015-09-01

The growth of obstetric and gynecologic (OB/GYN) hospitalists throughout the United States has led to different organizational approaches, depending on the perception of what an OB/GYN hospitalist is. There are advantages of OB/GYN hospitalist practices; however, practitioners who do this as just 1 piece of their practice are not fulfilling the promise of what this new specialty can deliver. Because those with office practices have their own business models, this article is devoted to the organizational and business models of OB/GYN hospitalists for physicians whose practice is devoted to inpatient obstetrics with or without emergency room and/or inpatient gynecology coverage. Copyright © 2015 Elsevier Inc. All rights reserved.

Diffractive dijet cross sections in photoproduction at HERA

NASA Astrophysics Data System (ADS)

Breitweg, J.; Derrick, M.; Krakauer, D.; Magill, S.; Mikunas, D.; Musgrave, B.; Repond, J.; Stanek, R.; Talaga, R. L.; Yoshida, R.; Zhang, H.; Mattingly, M. C. K.; Anselmo, F.; Antonioli, P.; Bari, G.; Basile, M.; Bellagamba, L.; Boscherini, D.; Bruni, A.; Bruni, G.; Romeo, G. Cara; Castellini, G.; Cifarelli, L.; Cindolo, F.; Contin, A.; Coppola, N.; Corradi, M.; de Pasquale, S.; Giusti, P.; Iacobucci, G.; Laurenti, G.; Levi, G.; Margotti, A.; Massam, T.; Nania, R.; Palmonari, F.; Pesci, A.; Polini, A.; Sartorelli, G.; Garcia, Y. Zamora; Zichichi, A.; Amelung, C.; Bornheim, A.; Brock, I.; Coböken, K.; Crittenden, J.; Deffner, R.; Eckert, M.; Grothe, M.; Hartmann, H.; Heinloth, K.; Heinz, L.; Hilger, E.; Jakob, H.-P.; Kappes, A.; Katz, U. F.; Kerger, R.; Paul, E.; Pfeiffer, M.; Stamm, J.; Wieber, H.; Bailey, D. S.; Campbell-Robson, S.; Cottingham, W. N.; Foster, B.; Hall-Wilton, R.; Heath, G. P.; Heath, H. F.; McFall, J. D.; Piccioni, D.; Roff, D. G.; Tapper, R. J.; Ayad, R.; Capua, M.; Iannotti, L.; Schioppa, M.; Susinno, G.; Kim, J. Y.; Lee, J. H.; Lim, I. T.; Pac, M. Y.; Caldwell, A.; Cartiglia, N.; Jing, Z.; Liu, W.; Mellado, B.; Parsons, J. A.; Ritz, S.; Sampson, S.; Sciulli, F.; Straub, P. B.; Zhu, Q.; Borzemski, P.; Chwastowski, J.; Eskreys, A.; Figiel, J.; Klimek, K.; Przybycień, M. B.; Zawiejski, L.; Adamczyk, L.; Bednarek, B.; Bukowy, M.; Czermak, A. M.; Jeleń, K.; Kisielewska, D.; Kowalski, T.; Przybycień, M.; Rulikowska-Zarbska, E.; Suszycki, L.; Zajc, J.; Duliński, Z.; Kotański, A.; Abbiendi, G.; Bauerdick, L. A. T.; Behrens, U.; Beier, H.; Bienlein, J. K.; Desler, K.; Drews, G.; Fricke, U.; Gialas, I.; Goebel, F.; Göttlicher, P.; Graciani, R.; Haas, T.; Hain, W.; Hasell, D.; Hebbel, K.; Johnson, K. F.; Kasemann, M.; Koch, W.; Kötz, U.; Kowalski, H.; Lindemann, L.; Löhr, B.; Milewski, J.; Milite, M.; Monteiro, T.; Ng, J. S. T.; Notz, D.; Park, I. H.; Pellegrino, A.; Pelucchi, F.; Piotrzkowski, K.; Rohde, M.; Roldán, J.; Ryan, J. J.; Savin, A. A.; Schneekloth, U.; Schwarzer, O.; Selonke, F.; Stonjek, S.; Surrow, B.; Tassi, E.; Westphal, D.; Wolf, G.; Wollmer, U.; Youngman, C.; Zeuner, W.; Burow, B. D.; Coldewey, C.; Grabosch, H. J.; Meyer, A.; Schlenstedt, S.; Barbagli, G.; Gallo, E.; Pelfer, P.; Maccarrone, G.; Votano, L.; Bamberger, A.; Eisenhardt, S.; Markun, P.; Raach, H.; Trefzger, T.; Wölfle, S.; Bromley, J. T.; Brook, N. H.; Bussey, P. J.; Doyle, A. T.; MacDonald, N.; Saxon, D. H.; Sinclair, L. E.; Skillicorn, I. O.; Strickland, E.; Waugh, R.; Bohnet, I.; Gendner, N.; Holm, U.; Meyer-Larsen, A.; Salehi, H.; Wick, K.; Garfagnini, A.; Gladilin, L. K.; Horstmann, D.; Kçira, D.; Klanner, R.; Lohrmann, E.; Poelz, G.; Schott, W.; Zetsche, F.; Bacon, T. C.; Butterworth, I.; Cole, J. E.; Howell, G.; Lamberti, L.; Long, K. R.; Miller, D. B.; Pavel, N.; Prinias, A.; Sedgbeer, J. K.; Sideris, D.; Walker, R.; Mallik, U.; Wang, S. M.; Wu, J. T.; Cloth, P.; Filges, D.; Fleck, J. I.; Ishii, T.; Kuze, M.; Suzuki, I.; Tokushuku, K.; Yamada, S.; Yamauchi, K.; Yamazaki, Y.; Hong, S. J.; Lee, S. B.; Nam, S. W.; Park, S. K.; Barreiro, F.; Fernández, J. P.; García, G.; Glasman, C.; Hernández, J. M.; Hervás, L.; Labarga, L.; Martínez, M.; Peso, J. Del; Puga, J.; Terrón, J.; Trocóniz, J. F. De; Corriveau, F.; Hanna, D. S.; Hartmann, J.; Hung, L. W.; Murray, W. N.; Ochs, A.; Riveline, M.; Stairs, D. G.; St-Laurent, M.; Ullmann, R.; Tsurugai, T.; Bashkirov, V.; Dolgoshein, B. A.; Stifutkin, A.; Bashindzhagyan, G. L.; Ermolov, P. F.; Golubkov, Yu. A.; Khein, L. A.; Korotkova, N. A.; Korzhavina, I. A.; Kuzinin, V. A.; Lukina, O. Yu.; Proskuryakov, A. S.; Shcheglova, L. M.; Solomin, A. N.; Zotkin, S. A.; Bokel, C.; Botje, M.; Brümmer, N.; Engelen, J.; Koffeman, E.; Kooijman, P.; van Sighem, A.; Tiecke, H.; Tuning, N.; Verkerke, W.; Vossebeld, J.; Wiggers, L.; Wolf, E. De; Acosta, D.; Bylsma, B.; Durkin, L. S.; Gilmore, J.; Ginsburg, C. M.; Kim, C. L.; Ling, T. Y.; Nylander, P.; Romanowski, T. A.; Blaikley, H. E.; Cashmore, R. J.; Cooper-Sarkar, A. M.; Devenish, R. C. E.; Edmonds, J. K.; Große-Knetter, J.; Harnew, N.; Nath, C.; Noyes, V. A.; Quadt, A.; Ruske, O.; Tickner, J. R.; Walczak, R.; Waters, D. S.; Bertolin, A.; Brugnera, R.; Carlin, R.; Corso, F. Dal; Dosselli, U.; Limentani, S.; Morandin, M.; Posocco, M.; Stanco, L.; Stroili, R.; Voci, C.; Bulmahn, J.; Oh, B. Y.; Okrasiński, J. R.; Toothacker, W. S.; Whitmore, J. J.; Iga, Y.; D'Agostini, G.; Marini, G.; Nigro, A.; Raso, M.; Hart, J. C.; McCubbin, N. A.; Shah, T. P.; Epperson, D.; Heusch, C.; Rahn, J. T.; Sadrozinski, H. F.-W.; Seiden, A.; Wichmann, R.; Williams, D. C.; Abramowicz, H.; Briskin, G.; Dagan, S.; Kananov, S.; Levy, A.; Abe, T.; Fusayasu, T.; Inuzuka, M.; Nagano, K.; Umemori, K.; Yamashita, T.; Hamatsu, R.; Hirose, T.; Homma, K.; Kitamura, S.; Matsushita, T.; Arneodo, M.; Cirio, R.; Costa, M.; Ferrero, M. I.; Maselli, S.; Monaco, V.; Peroni, C.; Petrucci, M. C.; Ruspa, M.; Sacchi, R.; Solano, A.; Staiano, A.; Dardo, M.; Bailey, D. C.; Fagerstroem, C.-P.; Galea, R.; Hartner, G. F.; Joo, K. K.; Levman, G. M.; Martin, J. F.; Orr, R. S.; Polenz, S.; Sabetfakhri, A.; Simmons, D.; Teuscher, R. J.; Butterworth, J. M.; Catterall, C. D.; Hayes, M. E.; Jones, T. W.; Lane, J. B.; Saunders, R. L.; Sutton, M. R.; Wing, M.; Ciborowski, J.; Grzelak, G.; Kasprzak, M.; Nowak, R. J.; Pawlak, J. M.; Pawlak, R.; Tymieniecka, T.; Wróblewski, A. K.; Zakrzewski, J. A.; Zarnecki, A. F.; Adamus, M.; Deppe, O.; Eisenberg, Y.; Hochman, D.; Karshon, U.; Badgett, W. F.; Chapin, D.; Cross, R.; Dasu, S.; Foudas, C.; Loveless, R. J.; Mattingly, S.; Reeder, D. D.; Smith, W. H.; Vaiciulis, A.; Wodarczyk, M.; Deshpande, A.; Dhawan, S.; Hughes, V. W.; Bhadra, S.; Frisken, W. R.; Khakzad, M.; Schmidke, W. B.

1998-08-01

Differential dijet cross sections have been measured with the ZEUS detector for photoproduction events in which the hadronic final state containing the jets is separated with respect to the outgoing proton direction by a large rapidity gap. The cross section has been measured as a function of the fraction of the photon (ϰγ OBS) and pomeron (β OBS) momentum participating in the production of the dijet system. The observed ϰγ OBS dependence shows evidence for the presence of a resolved- as well as a direct-photon component. The measured cross section da/dβ OBS increases as β OBS increases indicating that there is a sizeable contribution to dijet production from those events in which a large fraction of the pomeron momentum participates in the hard scattering. These cross sections and the ZEUS measurements of the diffractive structure function can be described by calculations based on parton densities in the pomeron which evolve according to the QCD evolution equations and include a substantial hard momentum component of gluons in the pomeron.

Genetic Relatedness of WNIN and WNIN/Ob with Major Rat Strains in Biomedical Research.

PubMed

Battula, Kiran Kumar; Nappanveettil, Giridharan; Nakanishi, Satoshi; Kuramoto, Takashi; Friedman, Jeffry M; Kalashikam, Rajender Rao

2015-06-01

WNIN (Wistar/NIN) is an inbred rat strain maintained at National Institute of Nutrition (NIN) for more than 90 years, and WNIN/Ob is an obese mutant originated from it. To determine their genetic relatedness with major rat strains in biomedical research, they were genotyped at various marker loci. The recently identified markers for albino and hooded mutations which clustered all the known albino rats into a single lineage also included WNIN and WNIN/Ob rats. Genotyping using microsatellite DNA markers and phylogenetic analysis with 49 different rat strains suggested that WNIN shares a common ancestor with many Wistar originated strains. Fst estimates and Fischer's exact test suggest that WNIN rats differed significantly from all other strains tested. WNIN/Ob though shows hyper-leptinemia, like Zucker fatty rat, did not share the Zucker fatty rat mutation. The above analyses suggest WNIN as a highly differentiated rat strain and WNIN/Ob a novel obese mutant evolved from it.

Elevated serum aminotransferase levels in children at risk for obstructive sleep apnea.

PubMed

Kheirandish-Gozal, Leila; Sans Capdevila, Oscar; Kheirandish, Ebrahim; Gozal, David

2008-01-01

Fatty liver disease (FLD) is a highly prevalent condition in obese (Ob) children, who are at increased risk for obstructive sleep apnea (OSA). However, the contribution of OSA to FLD remains unknown. Prospective study. Polysomnographic evaluation and assessment of plasma levels of insulin, glucose, and lipids, and liver function tests. A total of 518 consecutive snoring children 4 to 17 years of age who were being evaluated for habitual snoring and suspected OSA. A total of 376 children had body mass index z score of < 1.20 (non-Ob children), 3 children (<1%) had elevated serum aminotransferase (LFT) levels, and 248 had OSA (65.9%). Among the 142 overweight/Ob children, 46 had elevated LFT levels (32.4%); of these children, 42 had OSA (91.3%). In contrast, OSA was present in only 71.8% of Ob children without elevated LFT level (p < 0.01). Insulin resistance and hyperlipidemia were more likely to occur in children with FLD. Furthermore, FLD was improved after treatment of OSA in 32 of 42 Ob children (p < 0.0001). Increased liver enzyme levels are frequently found in Ob snoring children, particularly among those with OSA and/or metabolic dysfunction. Effective treatment of OSA results in improved liver function test results in the vast majority of these patients.

Olfactory Bulb Field Potentials and Respiration in Sleep-Wake States of Mice

PubMed Central

Jessberger, Jakob; Zhong, Weiwei; Brankačk, Jurij; Draguhn, Andreas

2016-01-01

It is well established that local field potentials (LFP) in the rodent olfactory bulb (OB) follow respiration. This respiration-related rhythm (RR) in OB depends on nasal air flow, indicating that it is conveyed by sensory inputs from the nasal epithelium. Recently RR was found outside the olfactory system, suggesting that it plays a role in organizing distributed network activity. It is therefore important to measure RR and to delineate it from endogenous electrical rhythms like theta which cover similar frequency bands in small rodents. In order to validate such measurements in freely behaving mice, we compared rhythmic LFP in the OB with two respiration-related biophysical parameters: whole-body plethysmography (PG) and nasal temperature (thermocouple; TC). During waking, all three signals reflected respiration with similar reliability. Peak power of RR in OB decreased with increasing respiration rate whereas power of PG increased. During NREM sleep, respiration-related TC signals disappeared and large amplitude slow waves frequently concealed RR in OB. In this situation, PG provided a reliable signal while breathing-related rhythms in TC and OB returned only during microarousals. In summary, local field potentials in the olfactory bulb do reliably reflect respiratory rhythm during wakefulness and REM sleep but not during NREM sleep. PMID:27247803

Ablation of Mouse Adult Neurogenesis Alters Olfactory Bulb Structure and Olfactory Fear Conditioning

PubMed Central

Valley, Matthew T.; Mullen, Tanner R.; Schultz, Lucy C.; Sagdullaev, Botir T.; Firestein, Stuart

2009-01-01

Adult neurogenesis replenishes olfactory bulb (OB) interneurons throughout the life of most mammals, yet during this constant flux it remains unclear how the OB maintains a constant structure and function. In the mouse OB, we investigated the dynamics of turnover and its impact on olfactory function by ablating adult neurogenesis with an x-ray lesion to the sub-ventricular zone (SVZ). Regardless of the magnitude of the lesion to the SVZ, we found no change in the survival of young adult born granule cells (GCs) born after the lesion, and a gradual decrease in the population of GCs born before the lesion. After a lesion producing a 96% reduction of incoming adult born GCs to the OB, we found a diminished behavioral fear response to conditioned odor cues but not to audio cues. Interestingly, despite this behavioral deficit and gradual anatomical changes, we found no electrophysiological changes in the GC population assayed in vivo through dendro-dendritic synaptic plasticity and odor-evoked local field potential oscillations. These data indicate that turnover in the granule cell layer is generally decoupled from the rate of adult neurogenesis, and that OB adult neurogenesis plays a role in a wide behavioral system extending beyond the OB. PMID:20582278

Impaired fracture healing with high non-union rates remains irreversible after traumatic brain injury in leptin-deficient mice

PubMed Central

Graef, F.; Seemann, R.; Garbe, A.; Schmidt-Bleek, K.; Schaser, K-D.; Keller, J.; Duda, G.; Tsitsilonis, S.

2017-01-01

Patients with traumatic brain injury (TBI) and long-bone fractures can show increased callus formation. This effect has already been reproduced in wild-type (wt) mice. However, the mechanisms remain poorly understood. Leptin is significantly increased following TBI, while its role in bone healing remains unclear. The aim of this study was to evaluate fracture healing in leptin-deficient ob/ob mice and to measure any possible impact of TBI on callus formation. 138 female, 12 weeks old, ob/ob mice were divided into four groups: Control, fracture, TBI and combined trauma. Osteotomies were stabilized with an external fixator; TBI was induced with Controlled Cortical Impact Injury. Callus bridging was weekly evaluated with in vivo micro-CT. Biomechanical testing was performed ex vivo. Micro-CT showed high non-union rates after three and four weeks in the fracture and combined trauma group. No differences were observed in callus volume, density and biomechanical properties at any time point. This study shows that bony bridging is impaired in the present leptin-deficient trauma model. Furthermore, the phenomenon of increased callus formation after TBI could not be reproduced in ob/ob mice, as in wt mice. Our findings suggest that the increased callus formation after TBI may be dependent on leptin signaling. PMID:28574414

From Radical Mastectomy to Breast-Conserving Therapy and Oncoplastic Breast Surgery: A Narrative Review Comparing Oncological Result, Cosmetic Outcome, Quality of Life, and Health Economy

PubMed Central

Kaviani, Ahmad; Sodagari, Nassim; Sheikhbahaei, Sara; Eslami, Vahid; Hafezi-Nejad, Nima; Safavi, Amin; Noparast, Maryam; Fitoussi, Alfred

2013-01-01

Surgical management of breast cancer has evolved considerably over the last two decades. There has been a major shift toward less-invasive local treatments, from radical mastectomy to breast-conserving therapy (BCT) and oncoplastic breast surgery (OBS). In order to investigate the efficacy of each of the three abovementioned methods, a literature review was conducted for measurable outcomes including local recurrence, survival, cosmetic outcome, quality of life (QOL), and health economy. From the point of view of oncological result, there is no difference between mastectomy and BCT in local recurrence rate and survival. Long-term results for OBS are not available. The items assessed in the QOL sound a better score for OBS in comparison with mastectomy or BCT. OBS is also associated with a better cosmetic outcome. Although having low income seems to be associated with lower BCT and OBS utilization, prognosis of breast cancer is worse in these women as well. Thus, health economy is the matter that should be studied seriously. OBS is an innovative, progressive, and complicated subspeciality that lacks published randomized clinical trials comparing surgical techniques and objective measures of outcome, especially from oncologic and health economy points of view. PMID:24167743

The linkage between patterns of daily occupations and occupational balance: Applications within occupational science and occupational therapy practice.

PubMed

Eklund, Mona; Orban, Kristina; Argentzell, Elisabeth; Bejerholm, Ulrika; Tjörnstrand, Carina; Erlandsson, Lena-Karin; Håkansson, Carita

2017-01-01

Patterns of daily occupations (PDO) and occupational balance (OB) are recurring phenomena in the literature. Both are related with health and well-being, which makes them central in occupational therapy practice and occupational science. The aim was to review how PDO and OB are described in the literature, to propose a view of how the two constructs may be linked, and elaborate on how such a view may benefit occupational science and occupational therapy. The literature was analysed by latent and manifest content analysis and comparative analysis. The findings were summarized in a model, framing PDO as the more objective and OB as the more subjective result from an interaction between personal preferences and environmental influences. The proposed model does not assume a cause-effect relationship between the targeted constructs, rather a mutual influence and a joint reaction to influencing factors. Indicators of PDO and OB were identified, as well as tools for assessing PDO and OB. The authors propose that discerning PDO and OB as separate but interacting phenomena may be useful in developing a theoretical discourse in occupational science and enhancing occupational therapy practice. Although the scope of this study was limited, the proposed view may hopefully inspire further scrutiny of constructs.

Processing of odor mixtures in the zebrafish olfactory bulb.

PubMed

Tabor, Rico; Yaksi, Emre; Weislogel, Jan-Marek; Friedrich, Rainer W

2004-07-21

Components of odor mixtures often are not perceived individually, suggesting that neural representations of mixtures are not simple combinations of the representations of the components. We studied odor responses to binary mixtures of amino acids and food extracts at different processing stages in the olfactory bulb (OB) of zebrafish. Odor-evoked input to the OB was measured by imaging Ca2+ signals in afferents to olfactory glomeruli. Activity patterns evoked by mixtures were predictable within narrow limits from the component patterns, indicating that mixture interactions in the peripheral olfactory system are weak. OB output neurons, the mitral cells (MCs), were recorded extra- and intracellularly and responded to odors with stimulus-dependent temporal firing rate modulations. Responses to mixtures of amino acids often were dominated by one of the component responses. Responses to mixtures of food extracts, in contrast, were more distinct from both component responses. These results show that mixture interactions can result from processing in the OB. Moreover, our data indicate that mixture interactions in the OB become more pronounced with increasing overlap of input activity patterns evoked by the components. Emerging from these results are rules of mixture interactions that may explain behavioral data and provide a basis for understanding the processing of natural odor stimuli in the OB.

The Role of Adult-Born Neurons in the Constantly Changing Olfactory Bulb Network

PubMed Central

Malvaut, Sarah; Saghatelyan, Armen

2016-01-01

The adult mammalian brain is remarkably plastic and constantly undergoes structurofunctional modifications in response to environmental stimuli. In many regions plasticity is manifested by modifications in the efficacy of existing synaptic connections or synapse formation and elimination. In a few regions, however, plasticity is brought by the addition of new neurons that integrate into established neuronal networks. This type of neuronal plasticity is particularly prominent in the olfactory bulb (OB) where thousands of neuronal progenitors are produced on a daily basis in the subventricular zone (SVZ) and migrate along the rostral migratory stream (RMS) towards the OB. In the OB, these neuronal precursors differentiate into local interneurons, mature, and functionally integrate into the bulbar network by establishing output synapses with principal neurons. Despite continuous progress, it is still not well understood how normal functioning of the OB is preserved in the constantly remodelling bulbar network and what role adult-born neurons play in odor behaviour. In this review we will discuss different levels of morphofunctional plasticity effected by adult-born neurons and their functional role in the adult OB and also highlight the possibility that different subpopulations of adult-born cells may fulfill distinct functions in the OB neuronal network and odor behaviour. PMID:26839709

LXR activation by GW3965 alters fat tissue distribution and adipose tissue inflammation in ob/ob female mice[S

PubMed Central

Archer, Amena; Stolarczyk, Émilie; Doria, Maria Luisa; Helguero, Luisa; Domingues, Rosário; Howard, Jane K.; Mode, Agneta; Korach-André, Marion; Gustafsson, Jan-Åke

2013-01-01

To investigate the role of liver X receptor (LXR) in adipose tissue metabolism during obesity, ob/ob mice were treated for 5 weeks with the synthetic LXR agonist GW3965. MRI analysis revealed that pharmacological activation of LXR modified fat distribution by decreasing visceral (VS) fat and inversely increasing subcutaneous (SC) fat storage without affecting whole body fat content. This was concordant with opposite regulation by GW3965 of the lipolytic markers hormone-sensitive lipase (HSL) and adipose triglyceride lipase (ATGL) in the two fat depots; moreover, the expression of genes involved in lipogenesis was significantly induced in SC fat. Lipidomic analysis suggested that changes in lipid composition in response to GW3965 also varied between VS and SC fat. In both depots, the observed alteration in lipid composition indicated an overall change toward less lipotoxic lipids. Flow cytometry analysis showed decreased immune cell infiltration in adipose tissue of ob/ob mice in response to GW3965 treatment, which in VS fat mainly affected the macrophage population and in SC fat the lymphocyte population. In line with this, the expression and secretion of proinflammatory markers was decreased in both fat deposits with GW3965 treatment. PMID:23446231

Leptin Selectively Augments Thymopoiesis in Leptin Deficiency and Lipopolysaccharide-Induced Thymic Atrophy1

PubMed Central

Hick, Ryan W.; Gruver, Amanda L.; Ventevogel, Melissa S.; Haynes, Barton F.; Sempowski, Gregory D.

2007-01-01

The thymus is a lymphoid organ that selects T cells for release to the peripheral immune system. Unfortunately, thymopoiesis is highly susceptible to damage by physiologic stressors and can contribute to immune deficiencies that occur in a variety of clinical settings. No treatment is currently available to protect the thymus from stress-induced involution. Leptin-deficient (ob/ob) mice have severe thymic atrophy and this finding suggests that this hormone is required for normal thymopoiesis. In this study, the ability of leptin to promote thymopoiesis in wild-type C57BL/6 and BALB/c mice, as well as in leptin-deficient (ob/ob) and endotoxin-stressed (Escherichia coli LPS) mice, was determined. Leptin administration induced weight loss and stimulated thymopoiesis in ob/ob mice, but did not stimulate thymopoiesis in wild-type C57BL/6 nor BALB/c mice. In endotoxin-stressed mice, however, leptin prevented LPS-induced thymus weight loss and stimulated TCRα gene rearrangement. Coadministration of leptin with LPS blunted endotoxin-induced systemic corticosterone response and production of proinflammatory cytokines. Thus, leptin has a selective thymostimulatory role in settings of leptin deficiency and endotoxin administration, and may be useful for protecting the thymus from damage and augmenting T cell reconstitution in these clinical states. PMID:16785512

Salivary habituation to food stimuli in successful weight loss maintainers, obese and normal-weight adults

PubMed Central

Bond, DS; Raynor, HA; McCaffery, JM; Wing, RR

2017-01-01

Objective Research shows that slower habituation of salivary responses to food stimuli is related to greater energy intake and that obese (Ob) individuals habituate slower than those of normal weight (NW). No study has examined habituation rates in weight loss maintainers (WLMs) who have reduced from obese to normal weight, relative to those who are Ob or NW. Design Salivation to two baseline water trials and 10 lemon-flavored lollipop trials were studied in 14 WLMs, 15 Ob and 18 NW individuals comparable in age, gender and ethnicity. Linear mixed models were used to compare WLMs with Ob and NW groups. Results Salivation in the WLM and NW groups decreased significantly (for both P <0.005) across trials, indicative of habituation. Salivary responses in the Ob group did not habituate (P=0.46). When compared with Ob group, WLMs showed a quicker reduction in salivation (P<0.05). WLM and NW groups did not differ in habituation rate (P=0.49). Conclusions WLMs have habituation rates that are comparable to NW individuals without previous history of obesity, and show quicker habituation than those who are currently obese. These results suggest that physiological responses to food may ‘normalize’ with successful weight loss maintenance. PMID:20010900

Large Scale Variability Survey of Orion II: mapping the young, low-mass stellar populations

NASA Astrophysics Data System (ADS)

Briceño, C.; Calvet, N.; Hartmann, L. W.; Vivas, A. K.

2000-12-01

We present further results of our ongoing large scale variability survey of the Orion OB1 Association, carried out with the 8k x 8k CCD Mosaic Camera on the 1m Schmidt telescope at the Venezuela National Observatory. In an area of over 60 square degrees we have unveiled new populations of low-mass young stars over a range of environments, from the dense molecular clouds of the Orion belt region, Ori OB 1b, to areas devoid of gas in Orion OB 1a. These new young stars span ages from 1-2 Myr in Ori OB 1b to roughly 10 Myr in Ori OB 1a, a likely scenario of sequential star formation triggered by the first generation of massive stars. Proxy indicators like Hα emission and near-IR excesses show that accretion from circumstellar disks in the 10 Myr stars of Ori OB 1a has mostly stopped. This population is a numerous analog of groups like TW Hya, making it an excellent laboratory to look for debris disks and study the epoch of planet formation in sparse, non-clustered environments. Research reported herein funded by NSF grant No. 9987367, and by CONICIT and Ministerio de Ciencia y Tecnología, Venezuela.

Search for OB stars running away from young star clusters. I. NGC 6611

NASA Astrophysics Data System (ADS)

Gvaramadze, V. V.; Bomans, D. J.

2008-11-01

N-body simulations have shown that the dynamical decay of the young (~1 Myr) Orion Nebula cluster could be responsible for the loss of at least half of its initial content of OB stars. This result suggests that other young stellar systems could also lose a significant fraction of their massive stars at the very beginning of their evolution. To confirm this expectation, we used the Mid-Infrared Galactic Plane Survey (completed by the Midcourse Space Experiment satellite) to search for bow shocks around a number of young (⪉several Myr) clusters and OB associations. We discovered dozens of bow shocks generated by OB stars running away from these stellar systems, supporting the idea of significant dynamical loss of OB stars. In this paper, we report the discovery of three bow shocks produced by O-type stars ejected from the open cluster NGC 6611 (M16). One of the bow shocks is associated with the O9.5Iab star HD165319, which was suggested to be one of “the best examples for isolated Galactic high-mass star formation” (de Wit et al. 2005, A&A, 437, 247). Possible implications of our results for the origin of field OB stars are discussed.

Olfactory Bulb Field Potentials and Respiration in Sleep-Wake States of Mice.

PubMed

Jessberger, Jakob; Zhong, Weiwei; Brankačk, Jurij; Draguhn, Andreas

2016-01-01

It is well established that local field potentials (LFP) in the rodent olfactory bulb (OB) follow respiration. This respiration-related rhythm (RR) in OB depends on nasal air flow, indicating that it is conveyed by sensory inputs from the nasal epithelium. Recently RR was found outside the olfactory system, suggesting that it plays a role in organizing distributed network activity. It is therefore important to measure RR and to delineate it from endogenous electrical rhythms like theta which cover similar frequency bands in small rodents. In order to validate such measurements in freely behaving mice, we compared rhythmic LFP in the OB with two respiration-related biophysical parameters: whole-body plethysmography (PG) and nasal temperature (thermocouple; TC). During waking, all three signals reflected respiration with similar reliability. Peak power of RR in OB decreased with increasing respiration rate whereas power of PG increased. During NREM sleep, respiration-related TC signals disappeared and large amplitude slow waves frequently concealed RR in OB. In this situation, PG provided a reliable signal while breathing-related rhythms in TC and OB returned only during microarousals. In summary, local field potentials in the olfactory bulb do reliably reflect respiratory rhythm during wakefulness and REM sleep but not during NREM sleep.

The integral and extrinsic bioactive proteins in the aqueous extracted soybean oil bodies.

PubMed

Zhao, Luping; Chen, Yeming; Cao, Yanyun; Kong, Xiangzhen; Hua, Yufei

2013-10-09

Soybean oil bodies (OBs), naturally pre-emulsified soybean oil, have been examined by many researchers owing to their great potential utilizations in food, cosmetics, pharmaceutical, and other applications requiring stable oil-in-water emulsions. This study was the first time to confirm that lectin, Gly m Bd 28K (Bd 28K, one soybean allergenic protein), Kunitz trypsin inhibitor (KTI), and Bowman-Birk inhibitor (BBI) were not contained in the extracted soybean OBs even by neutral pH aqueous extraction. It was clarified that the well-known Gly m Bd 30K (Bd 30K), another soybean allergenic protein, was strongly bound to soybean OBs through a disulfide bond with 24 kDa oleosin. One steroleosin isoform (41 kDa) and two caleosin isoforms (27 kDa, 29 kDa), the integral bioactive proteins, were confirmed for the first time in soybean OBs, and a considerable amount of calcium, necessary for the biological activities of caleosin, was strongly bound to OBs. Unexpectedly, it was found that 24 kDa and 18 kDa oleosins could be hydrolyzed by an unknown soybean endoprotease in the extracted soybean OBs, which might give some hints for improving the enzyme-assisted aqueous extraction processing of soybean free oil.

Adipose cell differentiation: evidence for a two-step process in the polyamine-dependent Ob1754 clonal line.

PubMed Central

Amri, E Z; Dani, C; Doglio, A; Etienne, J; Grimaldi, P; Ailhaud, G

1986-01-01

A subclone of preadipocyte Ob17 cells has been isolated (Ob1754 clonal line). Confluent Ob1754 cells treated with an inhibitor of spermidine and spermine synthesis, methylglyoxal bis(guanylhydrazone), were totally dependent upon putrescine addition for the expression of glycerol-3-phosphate dehydrogenase which behaved as a late marker of adipose conversion. Under these conditions, the early expression of lipoprotein lipase during growth arrest remained unchanged. Studies at the mRNA level showed that the expression of unidentified pOb24 and pGH3 mRNAs, which was parallel to that of lipoprotein lipase, is independent of polyamine addition whereas the late emergence of glycerol-3-phosphate dehydrogenase mRNA was putrescine-dependent and co-ordinated with the expression of pAL422 mRNA encoding for a myelin-P2 homologue [Bernlohr, Angus, Lane, Bolanowski & Kelly (1984) Proc. Natl. Acad. Sci. U.S.A. 81, 5468-5472]. The appearance of lipoprotein lipase preceded DNA synthesis and post-confluent mitoses which were both putrescine-dependent and which took place before the appearance of glycerol-3-phosphate dehydrogenase. Thus the adipose conversion of Ob1754 cells involves the expression of at least two separate sets of markers which are differently regulated. Images Fig. 3. Fig. 6. PMID:3800927

Mobile Application Use Among Obstetrics and Gynecology Residents.

PubMed

Perry, Rachel; Burns, Roshan M; Simon, Rebecca; Youm, Julie

2017-10-01

Mobile applications (apps) are increasingly used in clinical settings, particularly among resident physicians. Apps available to patients and physicians are rapidly expanding. We aimed to describe obstetrics and gynecology (ob-gyn) residents' use of and attitudes toward ob-gyn-related mobile apps. We conducted a cross-sectional survey of residents at all 19 California ob-gyn programs using a web-based questionnaire. Responses were analyzed using descriptive and chi-square statistics. Of 386 residents contacted, 197 (51%) completed the survey. All respondents owned mobile devices (100% smartphone, 74% tablet), and 93% used apps in the clinical setting. Commonly used ob-gyn-related apps were pregnancy wheels (84%), cervical cancer screening algorithms (68%), and contraceptive eligibility guidelines (47%). Only 53% of respondents recommended apps to patients, with many reporting not being aware of appropriate apps. Sixty-two percent of respondents used apps for learning, but only 3 ob-gyn-specific apps were mentioned. Most chose apps based on recommendations from other residents. Residents viewed mobile technology as an important clinical tool (92%) that improves efficiency (89%). App use did not differ by gender, age, or postgraduate year. Mobile technology and ob-gyn-related app use are widely used among California ob-gyn residents, who feel that apps enhance their ability to care for patients. Context of app use varies, with most residents using apps during clinical care, but only half recommending apps to patients. Recommendations from other residents are the common resource for discovering new apps, suggesting a need for more formal guidance on finding and evaluating apps.

Intima-Media Thickness in Severe Obesity

PubMed Central

Dalmas, Elise; Kahn, Jean-François; Giral, Philippe; Abdennour, Meriem; Bouillot, Jean-Luc; Fellahi, Soraya; Oppert, Jean-Michel; Clément, Karine; Guerre-Millo, Michèle; Poitou, Christine

2013-01-01

OBJECTIVE Obesity is associated with cardiovascular risk and a low-grade inflammatory state in both blood and adipose tissue (AT). Whether inflammation contributes to vascular alteration remains an open question. To test this hypothesis, we measured arterial intima-media thickness (IMT), which reflects subclinical atherosclerosis, in severely obese subjects and explored associations with systemic inflammation and AT inflammation. RESEARCH DESIGN AND METHODS IMT of the carotid artery (C-IMT) and IMT of the femoral artery (F-IMT) were measured in 132 nonobese (control) subjects (BMI 22.3 kg/m2; mean age 44.8 years) and 232 subjects who were severely obese without diabetes (OB/ND; n = 146; BMI 48.3 kg/m2; age 38.2 years) or severely obese with type 2 diabetes (OB/D; n = 86; BMI 47.0; age 49.4 years). In 57 OB/ND subjects, circulating soluble E-selectin, matrix metalloproteinase 9, myeloperoxidase, soluble intracellular adhesion molecule 1, soluble vascular cell adhesion molecule 1, tissue plasminogen activator inhibitor 1, cystatin C, cathepsin S, and soluble CD14 were measured in serum. AT macrophages were quantified by CD68 immunochemistry. RESULTS Both C-IMT and F-IMT increased in OB/ND and OB/D patients. In OB/ND patients, age was the sole independent determinant of IMT. No significant association was found with circulating inflammation-related molecules, number of CD68+ cells, or the presence of crown-like structures in visceral or subcutaneous AT of OB/ND patients. CONCLUSIONS IMT increased with severe obesity but was not influenced by the degree of systemic inflammation or AT macrophage accumulation. PMID:24062328

Maternal obesity downregulates myogenesis and beta-catenin signaling in fetal skeletal muscle.

PubMed

Tong, Jun F; Yan, Xu; Zhu, Mei J; Ford, Stephen P; Nathanielsz, Peter W; Du, Min

2009-04-01

Skeletal muscle is one of the primary tissues responsible for insulin resistance and type 2 diabetes (T2D). The fetal stage is crucial for skeletal muscle development. Obesity induces inflammatory responses, which might regulate myogenesis through Wnt/beta-catenin signaling. This study evaluated the effects of maternal obesity (>30% increase in body mass index) during pregnancy on myogenesis and the Wnt/beta-catenin and IKK/NF-kappaB pathways in fetal skeletal muscle using an obese pregnant sheep model. Nonpregnant ewes were assigned to a control group (C; fed 100% of National Research Council recommendations; n=5) or obesogenic (OB; fed 150% of National Research Council recommendations; n=5) diet from 60 days before to 75 days after conception (term approximately 148 days) when fetal semitendenosus skeletal muscle was sampled for analyses. Myogenic markers including MyoD, myogenin, and desmin contents were reduced in OB compared with C fetal semitendenosus, indicating the downregulation of myogenesis. The diameter of primary muscle fibers was smaller in OB fetal muscle. Phosphorylation of GSK3beta was reduced in OB compared with C fetal semitendenosus. Although the beta-catenin level was lower in OB than C fetal muscle, more beta-catenin was associated with FOXO3a in the OB fetuses. Moreover, we found phosphorylation levels of IKKbeta and RelA/p65 were both increased in OB fetal muscle. In conclusion, our data showed that myogenesis and the Wnt/beta-catenin signaling pathway were downregulated, which might be due to the upregulation of inflammatory IKK/NF-kappaB signaling pathways in fetal muscle of obese mothers.

Views of American OB/GYNs on the ethics of prenatal whole-genome sequencing.

PubMed

Bayefsky, Michelle J; White, Amina; Wakim, Paul; Hull, Sara Chandros; Wasserman, David; Chen, Stephanie; Berkman, Benjamin E

2016-12-01

Given public demand for genetic information, the potential to perform prenatal whole-genome sequencing (PWGS) non-invasively in the future, and decreasing costs of whole-genome sequencing, it is likely that OB/GYN practice will include PWGS. The goal of this project was to explore OB/GYNs' views on the ethical issues surrounding PWGS and their preparedness for counseling patients on its use. A national survey was administered to 2500 members of American Congress of Obstetricians and Gynecologists. A total of 1114 respondents completed the survey (response rate = 45%). OB/GYNs are most concerned with ordering non-medical fetal genetic information, are worried about increasing parental anxiety, and feel it is appropriate to be directive when counseling parents about PWGS. Furthermore, most OB/GYNs have limited knowledge of genetics, rely heavily on genetic counselors and would like more guidance regarding the clinical adoption of PWGS. OB/GYNs do not completely accept or reject PWGS, but a substantial number have significant ethical and practical concerns. They are most concerned with issues that will directly affect their practices and interactions with patients, such as increasing parental anxiety and costs of care. Professional guidance would be instrumental in directing the adoption of PWGS and alleviating the ethical burden posed by PWGS on individual OB/GYNs. Published 2016. This article is a U.S. Government work and is in the public domain in the USA. Published 2016. This article is a U.S. Government work and is in the public domain in the USA.

Leptin Is Required for Glucose Homeostasis after Roux-en-Y Gastric Bypass in Mice.

PubMed

Mokadem, Mohamad; Zechner, Juliet F; Uchida, Aki; Aguirre, Vincent

2015-01-01

Leptin, the protein product of the ob gene, increases energy expenditure and reduces food intake, thereby promoting weight reduction. Leptin also regulates glucose homeostasis and hepatic insulin sensitivity via hypothalamic proopiomelanocortin neurons in mice. Roux-en-Y gastric bypass (RYGB) induces weight loss that is substantial and sustained despite reducing plasma leptin levels. In addition, patients who fail to undergo diabetes remission after RYGB are hypoletinemic compared to those who do and to lean controls. We have previously demonstrated that the beneficial effects of RYGB in mice require the melanocortin-4 receptor, a downstream effector of leptin action. Based on these observations, we hypothesized that leptin is required for sustained weight reduction and improved glucose homeostasis observed after RYGB. To investigate this hypothesis, we performed RYGB or sham operations on leptin-deficient ob/ob mice maintained on regular chow. To investigate whether leptin is involved in post-RYGB weight maintenance, we challenged post-surgical mice with high fat diet. RYGB reduced total body weight, fat and lean mass and caused reduction in calorie intake in ob/ob mice. However, it failed to improve glucose tolerance, glucose-stimulated plasma insulin, insulin tolerance, and fasting plasma insulin. High fat diet eliminated the reduction in calorie intake observed after RYGB in ob/ob mice and promoted weight regain, although not to the same extent as in sham-operated mice. We conclude that leptin is required for the effects of RYGB on glucose homeostasis but not body weight or composition in mice. Our data also suggest that leptin may play a role in post-RYGB weight maintenance.

Dysregulation of glucocorticoid metabolism in murine obesity: comparable effects of leptin resistance and deficiency.

PubMed

Livingstone, Dawn E W; Grassick, Sarah L; Currie, Gillian L; Walker, Brian R; Andrew, Ruth

2009-05-01

In obese humans, metabolism of glucocorticoids by 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1) and A-ring reduction (by 5 alpha- and 5 beta-reductases) is dysregulated in a tissue specific manner. These changes have been recapitulated in leptin resistant obese Zucker rats but were not observed in high-fat fed Wistar rats. Recent data from mouse models suggest that such discrepancies may reflect differences in leptin signalling. We therefore compared glucocorticoid metabolism in murine models of leptin deficiency and resistance. Male ob/ob and db/db mice and their respective littermate controls (n=10-12/group) were studied at the age of 12 weeks. Enzyme activities and mRNA expression were quantified in snap-frozen tissues. The patterns of altered pathways of steroid metabolism in obesity were similar in ob/ob and db/db mice. In liver, 5 beta-reductase activity and mRNA were increased and 11 beta-HSD1 decreased in obese mice, whereas 5 alpha-reductase 1 (5 alpha R1) mRNA was not altered. In visceral adipose depots, 5 beta-reductase was not expressed, 11 beta-HSD1 activity was increased and 5 alpha R1 mRNA was not altered in obesity. By contrast, in subcutaneous adipose tissue 11 beta-HSD1 and 5 alpha R1 mRNA were decreased. Systematic differences were not found between ob/ob and db/db murine models of obesity, suggesting that variations in leptin signalling through the short splice variant of the Ob receptor do not contribute to dysregulation of glucocorticoid metabolism.

Feeding Frequency and appetite in Lean and Obese Prepubertal children

PubMed Central

Mehra, Rinku; Tsalikian, Eva; Chenard, Catherine A.; Zimmerman, M. Bridget; Sivitz, William I.

2016-01-01

To determine the effect of feeding frequency on appetite in normal weight (NW) and obese (OB) prepubertal children, we carried out a prospective, randomized interventional study of 18 NW and 17 OB children ages 6–10. Children received three or five feedings in random order on separate days. Total calories, carbohydrate, protein, and fat composition on each day were equal. Two hours following the last feeding, children were offered ice cream ad lib. The major outcome variable was kilocalories ice cream consumed. A visual analog scale to assess fullness was also administered before consumption of ice cream. We observed that OB children consumed 73.0 ± 37.4 kcal more after five feedings than after three feedings whereas the NW children consumed 47.1 ± 27.8 kcal less. There was significant interaction between meal pattern and weight group indicating that this change in ice cream consumption differed significantly between groups (P = 0.014 by two-factor analysis). Ice cream intake/kg was less in OB compared to NW subjects (P = 0.012). Fullness ratings before ice cream did not differ by meal pattern or weight group. However, pre-ice cream fullness predicted ice cream intake in NW but not OB children. In summary, OB and NW children differed in appetite response to meal frequency. Our data suggest that: (i) satiety in OB children is related more to proximity of calories (larger supper) than to antecedent distribution of calories and; (ii) NW children may be more prone to restrict intake based on subjective fullness. PMID:20847731

Overweight and obesity: overrepresentation in the pediatric reconstructive burn population.

PubMed

Mayes, Theresa; Gottschlich, Michele M; Allgeier, Chris; Khoury, Jane; Kagan, Richard J

2010-01-01

Pediatric burn patients are predisposed to excessive weight gain in the reconstructive period, but the cause is unclear. An overweight (OW) or obese (OB) condition is associated with numerous health risks, decreased physical function, and increased morbidity. The purpose of this study was to compare the frequency of OW status in reconstructive, pediatric burn patients with the prevalence in the US population. The authors reviewed the records of 1533 pediatric patients, >1 year from acute burn, admitted for an elective reconstructive procedure. Body mass index between 85th and 95th percentile, according to the National Center for Health Statistics for 2000 growth charts, was classified as OW, and body mass index >95th percentile was classified as OB. Frequency of OW and OB and racial disparity was calculated as a percentage of total patients and compared with pediatric data from National Health and Nutrition Examination Survey for 1999 to 2006, a nationally representative sample. The rate of OW and OB was 16.3 and 24.1%, respectively, in the authors' pediatric burn population. White patients had OW and OB rates of 15.9 and 23.6%, respectively, compared with 18.2 and 30.2%, respectively, in black patients. All OW and OB rates were outside the 95% confidence interval of the nationally representative National Health and Nutrition Examination Survey population. The rates of OW and OB in pediatric reconstructive burn patients exceed the US population standard across age and race stratifications. The prevention and treatment of excessive weight gain should be a component of rehabilitation in pediatric burns.

VizieR Online Data Catalog: OB association members in ACT+TRC Catalogs (Hoogerwerf, 2000)

NASA Astrophysics Data System (ADS)

Hoogerwerf, R.

2000-05-01

The Hipparcos Catalogue (Cat. I/239) contains members of nearby OB associations brighter than 12th magnitude in V. However, membership lists are complete only to magnitude V=7.3. In this paper we discuss whether proper motions listed in the `Astrographic Catalogue+Tycho' reference catalogue (ACT, Cat. I/246) and the Tycho Reference Catalogue (TRC, Cat. I/250), which are complete to V~10.5mag, can be used to find additional association members. Proper motions in the ACT/TRC have an average accuracy of ~3mas/yr. We search for ACT/TRC stars which have proper motions consistent with the spatial velocity of the Hipparcos members of the nearby OB associations already identified by de Zeeuw et al. (1999, Cat. J/AJ/117/354). These stars are first selected using a convergent-point method, and then subjected to further constraints on the proper-motion distribution, magnitude and colour to narrow down the final number of candidate members. Monte Carlo simulations show that the proper-motion distribution, magnitude, and colour constraints remove ~97% of the field stars, while at the same time retain more than 90% of the cluster stars. The procedure has been applied to five nearby associations: the three subgroups of Sco OB2, plus Per OB3 and Cep OB6. In all cases except Cep OB6, we find evidence for new association members fainter than the completeness limit of the Hipparcos Catalogue. However, narrow-band photometry and/or radial velocities are needed to pinpoint the cluster members, and to study their physical characteristics. (1 data file).

Leptin as well as Free Leptin Receptor Is Associated with Polycystic Ovary Syndrome in Young Women

PubMed Central

Rizk, Nasser M.; Sharif, Elham

2015-01-01

Background and Aim. Leptin has two forms in the circulation: free and bound forms. The soluble leptin receptor (sOB-R) circulates in the blood and can bind to leptin. The aim of this study is to assess the concentrations of the leptin and the sOB-R in PCOS and its relation to adiposity, insulin resistance, and androgens. Methods. A cross-sectional study included 78 female students aged 17–25 years. Fasting serum leptin and sOB-R concentrations were measured. The anthropometric variables and the hormonal profile such as insulin, female and male sex hormones, and prolactin were assessed. Results. In PCOS, leptin level (ng/ml) and free leptin index (FLI) increased significantly while sOB-R (ng/ml) significantly decreased compared to control subjects. In age-matched subjects, obese PCOS had increased leptin level in ng/ml (median level with interquartile levels) of 45.67 (41.98–48.04) and decreased sOB-R in ng/ml 11.47 (7.59–16.44) compared to lean PCOS 16.97 (10.60–45.55) for leptin and 16.62 (11.61–17.96) for sOB-R with p values 0.013 and 0.042, respectively. However, body mass index (BMI) is significantly correlated with leptin and s-OBR, while no significant correlations with parameters of insulin resistance were detected. Conclusion. PCOS is associated with hyperleptinemia and increased free leptin index. Decreased sOB-R could be a compensatory mechanism for the defective action of leptin. PMID:26180527

Heterotypic contact reveals a COX-2-mediated suppression of osteoblast differentiation by endothelial cells: A negative modulatory role for prostanoids in VEGF-mediated cell: cell communication?

DOE Office of Scientific and Technical Information (OSTI.GOV)

Clarkin, Claire E.; Garonna, Elena; Pitsillides, Andrew A.

In bone, angiogenesis must be initiated appropriately, but limited once remodelling or repair is complete. Our recent findings have supported a role for prostaglandins (PG), known modulators of osteoblast (OB) and endothelial cell (EC) behaviour, in facilitating VEGF-mediated paracrine communication from OBs to 'remotely located' ECs, but the mechanism(s) regulating OB:EC crosstalk when these cells are closely opposed are undefined. In this study we have examined: (i) the effects of exogenous PGE{sub 2} on VEGF-driven events in ECs, and (ii) the role of endogenous COX-2-derived prostanoids in mediating communication between intimately opposed OBs and ECs in direct contact. Exposure ofmore » ECs to PGE{sub 2} increased ERK1/2 phosphorylation, COX-2 induction, 6-keto-PGF{sub 1{alpha}} release and EC proliferation. In contrast, PGE{sub 2} attenuated VEGF{sub 165}-induced VEGFR2/Flk1 phosphorylation, ERK1/2 activation and proliferation of ECs, suggesting that exogenous PGE{sub 2} restricts the actions of VEGF. However, the COX-2-selective inhibitor, NS398, also attenuated VEGF-induced proliferation, implying a distinct role for endogenous COX-2 activity in regulating EC behaviour. To examine the effect of OB:EC proximity and the role of COX-2 products further, we used a confrontational co-culture model. These studies showed that COX-2 blockade with NS398 enhanced EC-dependent increases in OB differentiation, that this effect was reversed by exogenous PGH{sub 2} (immediate COX-2 product), and that exogenous VEGF did not influence EC-dependent OB differentiation under these conditions. Our findings indicate that locally produced prostanoids may serve distinct roles depending on OB:EC proximity and negatively modulate VEGF-mediated changes in EC behaviour when these cells are closely opposed to control angiogenesis during bone (re)modelling.« less

Inhibition of Intestinal Bile Acid Transporter Slc10a2 Improves Triglyceride Metabolism and Normalizes Elevated Plasma Glucose Levels in Mice

PubMed Central

Snaith, Michael; Lindmark, Helena; Lundberg, Johanna; Östlund-Lindqvist, Ann-Margret; Angelin, Bo; Rudling, Mats

2012-01-01

Interruption of the enterohepatic circulation of bile acids increases cholesterol catabolism, thereby stimulating hepatic cholesterol synthesis from acetate. We hypothesized that such treatment should lower the hepatic acetate pool which may alter triglyceride and glucose metabolism. We explored this using mice deficient of the ileal sodium-dependent BA transporter (Slc10a2) and ob/ob mice treated with a specific inhibitor of Slc10a2. Plasma TG levels were reduced in Slc10a2-deficient mice, and when challenged with a sucrose-rich diet, they displayed a reduced response in hepatic TG production as observed from the mRNA levels of several key enzymes in fatty acid synthesis. This effect was paralleled by a diminished induction of mature sterol regulatory element-binding protein 1c (Srebp1c). Unexpectedly, the SR-diet induced intestinal fibroblast growth factor (FGF) 15 mRNA and normalized bile acid synthesis in Slc10a2−/− mice. Pharmacologic inhibition of Slc10a2 in diabetic ob/ob mice reduced serum glucose, insulin and TGs, as well as hepatic mRNA levels of Srebp1c and its target genes. These responses are contrary to those reported following treatment of mice with a bile acid binding resin. Moreover, when key metabolic signal transduction pathways in the liver were investigated, those of Mek1/2 - Erk1/2 and Akt were blunted after treatment of ob/ob mice with the Slc10a2 inhibitor. It is concluded that abrogation of Slc10a2 reduces hepatic Srebp1c activity and serum TGs, and in the diabetic ob/ob model it also reduces glucose and insulin levels. Hence, targeting of Slc10a2 may be a promising strategy to treat hypertriglyceridemia and diabetes. PMID:22662222

Outcomes Definitions and Statistical Tests in Oncology Studies: A Systematic Review of the Reporting Consistency.

PubMed

Rivoirard, Romain; Duplay, Vianney; Oriol, Mathieu; Tinquaut, Fabien; Chauvin, Franck; Magne, Nicolas; Bourmaud, Aurelie

2016-01-01

Quality of reporting for Randomized Clinical Trials (RCTs) in oncology was analyzed in several systematic reviews, but, in this setting, there is paucity of data for the outcomes definitions and consistency of reporting for statistical tests in RCTs and Observational Studies (OBS). The objective of this review was to describe those two reporting aspects, for OBS and RCTs in oncology. From a list of 19 medical journals, three were retained for analysis, after a random selection: British Medical Journal (BMJ), Annals of Oncology (AoO) and British Journal of Cancer (BJC). All original articles published between March 2009 and March 2014 were screened. Only studies whose main outcome was accompanied by a corresponding statistical test were included in the analysis. Studies based on censored data were excluded. Primary outcome was to assess quality of reporting for description of primary outcome measure in RCTs and of variables of interest in OBS. A logistic regression was performed to identify covariates of studies potentially associated with concordance of tests between Methods and Results parts. 826 studies were included in the review, and 698 were OBS. Variables were described in Methods section for all OBS studies and primary endpoint was clearly detailed in Methods section for 109 RCTs (85.2%). 295 OBS (42.2%) and 43 RCTs (33.6%) had perfect agreement for reported statistical test between Methods and Results parts. In multivariable analysis, variable "number of included patients in study" was associated with test consistency: aOR (adjusted Odds Ratio) for third group compared to first group was equal to: aOR Grp3 = 0.52 [0.31-0.89] (P value = 0.009). Variables in OBS and primary endpoint in RCTs are reported and described with a high frequency. However, statistical tests consistency between methods and Results sections of OBS is not always noted. Therefore, we encourage authors and peer reviewers to verify consistency of statistical tests in oncology studies.

Outcomes Definitions and Statistical Tests in Oncology Studies: A Systematic Review of the Reporting Consistency

PubMed Central

Rivoirard, Romain; Duplay, Vianney; Oriol, Mathieu; Tinquaut, Fabien; Chauvin, Franck; Magne, Nicolas; Bourmaud, Aurelie

2016-01-01

Background Quality of reporting for Randomized Clinical Trials (RCTs) in oncology was analyzed in several systematic reviews, but, in this setting, there is paucity of data for the outcomes definitions and consistency of reporting for statistical tests in RCTs and Observational Studies (OBS). The objective of this review was to describe those two reporting aspects, for OBS and RCTs in oncology. Methods From a list of 19 medical journals, three were retained for analysis, after a random selection: British Medical Journal (BMJ), Annals of Oncology (AoO) and British Journal of Cancer (BJC). All original articles published between March 2009 and March 2014 were screened. Only studies whose main outcome was accompanied by a corresponding statistical test were included in the analysis. Studies based on censored data were excluded. Primary outcome was to assess quality of reporting for description of primary outcome measure in RCTs and of variables of interest in OBS. A logistic regression was performed to identify covariates of studies potentially associated with concordance of tests between Methods and Results parts. Results 826 studies were included in the review, and 698 were OBS. Variables were described in Methods section for all OBS studies and primary endpoint was clearly detailed in Methods section for 109 RCTs (85.2%). 295 OBS (42.2%) and 43 RCTs (33.6%) had perfect agreement for reported statistical test between Methods and Results parts. In multivariable analysis, variable "number of included patients in study" was associated with test consistency: aOR (adjusted Odds Ratio) for third group compared to first group was equal to: aOR Grp3 = 0.52 [0.31–0.89] (P value = 0.009). Conclusion Variables in OBS and primary endpoint in RCTs are reported and described with a high frequency. However, statistical tests consistency between methods and Results sections of OBS is not always noted. Therefore, we encourage authors and peer reviewers to verify consistency of statistical tests in oncology studies. PMID:27716793

Trajectories of body mass index among Canadian seniors and associated mortality risk.

PubMed

Wang, Meng; Yi, Yanqing; Roebothan, Barbara; Colbourne, Jennifer; Maddalena, Victor; Sun, Guang; Wang, Peizhong Peter

2017-12-04

This study aims to characterize the heterogeneity in BMI trajectories and evaluate how different BMI trajectories predict mortality risk in Canadian seniors. Data came from the Canadian National Population Health Survey (NPHS, 1994-2011) and 1480 individuals aged 65-79 years with at least four BMI records were included in this study. Group-based trajectory model was used to identify distinct subgroups of longitudinal trajectories of BMI measured over 19 years for men and women. Cox proportional hazards models were used to examine the association between BMI trajectories and mortality risks. Distinct trajectory patterns were found for men and women: 'Normal Weight-Down'(N-D), 'Overweight-Normal weight' (OV-N), 'Obese I-Down' (OB I-D), and 'Obese II- Down' (OB II-D) for women; and 'Normal Weight-Down' (N-D), 'Overweight-Normal weight' (OV-N), 'Overweight-Stable' (OV-S), and 'Obese-Stable' (OB-S) for men. Comparing with OV-N, men in the OV-S group had the lowest mortality risk followed by the N-D (HR = 1.66) and OB-S (HR = 1.98) groups, after adjusting for covariates. Compared with OV-N, women in the OB II-D group with three or more chronic health conditions had higher mortality risk (HR = 1.61); however, women in OB II-D had lower risk (HR = 0.56) if they had less than three conditions. The course of BMI over time in Canadian seniors appears to follow one of four different patterns depending on gender. The findings suggest that men who were overweight at age 65 and lost weight over time had the lowest mortality risk. Interestingly, obese women with decreasing BMI have different mortality risks, depending on their chronic health conditions. The findings provide new insights concerning the associations between BMI and mortality risk.

Maternal obesity induces fibrosis in fetal myocardium of sheep

PubMed Central

Huang, Yan; Yan, Xu; Zhao, Jun X.; Zhu, Mei J.; McCormick, Richard J.; Ford, Stephen P.; Nathanielsz, Peter W.; Ren, Jun

2010-01-01

Maternal obesity (MO) has harmful effects on both fetal development and subsequent offspring health. The impact of MO on fetal myocardium development has received little attention. Fibrogenesis is regulated by the transforming growth factor-β (TGF-β)/p38 signaling pathway. Using the well-established model of MO in pregnant sheep, we evaluated the effect of MO on TGF-β/p38 and collagen accumulation in fetal myocardium. Nonpregnant ewes were assigned to a control diet [Con, fed 100% of National Research Council (NRC) nutrient recommendations] or obesogenic diet (OB, fed 150% of NRC recommendations) from 60 days before conception. Fetal ventricular muscle was sampled at 75 and 135 days of gestation (dG). At 75 dG, the expression of precursor TGF-β was 39.9 ± 9.9% higher (P < 0.05) in OB than Con fetal myocardium, consistent with the higher content of phosphorylated Smad3 in OB myocardium. The phosphorylation of p38 tended to be higher in OB myocardium (P = 0.08). In addition, enhanced Smad complexes were bound to Smad-binding elements in 75 dG OB fetal myocardium measured by DNA mobility shift assay (130.2 ± 26.0% higher, P < 0.05). Similar elevation of TGF-β signaling was observed in OB fetal myocardium at 135 dG. Total collagen concentration in OB was greater than Con fetal myocardium (2.42 ± 0.16 vs. 1.87 ± 0.04%, P < 0.05). Matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-3 were higher in the Con group compared with OB sheep (43.86 ± 16.01 and 37.23 ± 7.97% respectively, P < 0.05). In summary, MO results in greater fetal heart connective tissue accumulation associated with an upregulated TGF-β/p38 signaling pathway at late gestation; such changes would be expected to negatively impact offspring heart function. PMID:20876759

The OmegaWhite Survey for Short-period Variable Stars. V. Discovery of an Ultracompact Hot Subdwarf Binary with a Compact Companion in a 44-minute Orbit

NASA Astrophysics Data System (ADS)

Kupfer, T.; Ramsay, G.; van Roestel, J.; Brooks, J.; MacFarlane, S. A.; Toma, R.; Groot, P. J.; Woudt, P. A.; Bildsten, L.; Marsh, T. R.; Green, M. J.; Breedt, E.; Kilkenny, D.; Freudenthal, J.; Geier, S.; Heber, U.; Bagnulo, S.; Blagorodnova, N.; Buckley, D. A. H.; Dhillon, V. S.; Kulkarni, S. R.; Lunnan, R.; Prince, T. A.

2017-12-01

We report the discovery of the ultracompact hot subdwarf (sdOB) binary OW J074106.0-294811.0 with an orbital period of {P}{orb}=44.66279+/- 1.16× {10}-4 minutes, making it the most compact hot subdwarf binary known. Spectroscopic observations using the VLT, Gemini and Keck telescopes revealed a He-sdOB primary with an intermediate helium abundance, {T}{eff} = 39 400+/- 500 K and {log}g = 5.74 ± 0.09. High signal-to-noise ratio light curves show strong ellipsoidal modulation resulting in a derived sdOB mass {M}{sdOB}=0.23+/- 0.12 {M}⊙ with a WD companion ({M}{WD}=0.72+/- 0.17 {M}⊙ ). The mass ratio was found to be q={M}{sdOB}/{M}{WD}=0.32+/- 0.10. The derived mass for the He-sdOB is inconsistent with the canonical mass for hot subdwarfs of ≈ 0.47 {M}⊙ . To put constraints on the structure and evolutionary history of the sdOB star we compared the derived {T}{eff}, {log}g, and sdOB mass to evolutionary tracks of helium stars and helium white dwarfs calculated with Modules for Experiments in Stellar Astrophysics (MESA). We find that the best-fitting model is a helium white dwarf with a mass of 0.320 {M}⊙ , which left the common envelope ≈ 1.1 {Myr} ago, which is consistent with the observations. As a helium white dwarf with a massive white dwarf companion, the object will reach contact in 17.6 Myr at an orbital period of 5 minutes. Depending on the spin-orbit synchronization timescale the object will either merge to form an R CrB star or end up as a stably accreting AM CVn-type system with a helium white dwarf donor.

A comparative genotoxicity study of a supraphysiological dose of triiodothyronine (T₃) in obese rats subjected to either calorie-restricted diet or hyperthyroidism.

PubMed

De Sibio, Maria Teresa; Luvizotto, Renata Azevedo Melo; Olimpio, Regiane Marques Castro; Corrêa, Camila Renata; Marino, Juliana; de Oliveira, Miriane; Conde, Sandro José; Ferreira, Ana Lúcia dos Anjos; Padovani, Carlos Roberto; Nogueira, Célia Regina

2013-01-01

This study was designed to determine the genotoxicity of a supraphysiological dose of triiodothyronine (T3) in both obese and calorie-restricted obese animals. Fifty male Wistar rats were randomly assigned to one of the two following groups: control (C; n = 10) and obese (OB; n = 40). The C group received standard food, whereas the OB group was fed a hypercaloric diet for 20 weeks. After this period, half of the OB animals (n = 20) were subjected to a 25%-calorie restriction of standard diet for 8 weeks forming thus a new group (OR), whereas the remaining OB animals were kept on the initial hypercaloric diet. During the following two weeks, 10 OR animals continued on the calorie restriction diet, whereas the remaining 10 rats of this group formed a new group (ORS) given a supraphysiological dose of T3 (25 µg/100 g body weight) along with the calorie restriction diet. Similarly, the remaining OB animals were divided into two groups, one that continued on the hypercaloric diet (OB, n = 10), and one that received the supraphysiological dose of T3 (25 µg/100 g body weight) along with the hypercaloric diet (OS, n = 10) for two weeks. The OB group showed weight gain, increased adiposity, insulin resistance, increased leptin levels and genotoxicity; T3 administration in OS animals led to an increase in genotoxicity and oxidative stress when compared with the OB group. The OR group showed weight loss and normalized levels of adiposity, insulin resistance, serum leptin and genotoxicity, thus having features similar to those of the C group. On the other hand, the ORS group, compared to OR animals, showed higher genotoxicity. Our results indicate that regardless of diet, a supraphysiological dose of T3 causes genotoxicity and potentiates oxidative stress.

A Comparative Genotoxicity Study of a Supraphysiological Dose of Triiodothyronine (T3) in Obese Rats Subjected to Either Calorie-Restricted Diet or Hyperthyroidism

PubMed Central

De Sibio, Maria Teresa; Luvizotto, Renata Azevedo Melo; Olimpio, Regiane Marques Castro; Corrêa, Camila Renata; Marino, Juliana; de Oliveira, Miriane; Conde, Sandro José; Ferreira, Ana Lúcia dos Anjos; Padovani, Carlos Roberto; Nogueira, Célia Regina

2013-01-01

This study was designed to determine the genotoxicity of a supraphysiological dose of triiodothyronine (T3) in both obese and calorie-restricted obese animals. Fifty male Wistar rats were randomly assigned to one of the two following groups: control (C; n = 10) and obese (OB; n = 40). The C group received standard food, whereas the OB group was fed a hypercaloric diet for 20 weeks. After this period, half of the OB animals (n = 20) were subjected to a 25%-calorie restriction of standard diet for 8 weeks forming thus a new group (OR), whereas the remaining OB animals were kept on the initial hypercaloric diet. During the following two weeks, 10 OR animals continued on the calorie restriction diet, whereas the remaining 10 rats of this group formed a new group (ORS) given a supraphysiological dose of T3 (25 µg/100 g body weight) along with the calorie restriction diet. Similarly, the remaining OB animals were divided into two groups, one that continued on the hypercaloric diet (OB, n = 10), and one that received the supraphysiological dose of T3 (25 µg/100 g body weight) along with the hypercaloric diet (OS, n = 10) for two weeks. The OB group showed weight gain, increased adiposity, insulin resistance, increased leptin levels and genotoxicity; T3 administration in OS animals led to an increase in genotoxicity and oxidative stress when compared with the OB group. The OR group showed weight loss and normalized levels of adiposity, insulin resistance, serum leptin and genotoxicity, thus having features similar to those of the C group. On the other hand, the ORS group, compared to OR animals, showed higher genotoxicity. Our results indicate that regardless of diet, a supraphysiological dose of T3 causes genotoxicity and potentiates oxidative stress. PMID:23468891

Effect of protocatechuic acid on insulin responsiveness and inflammation in visceral adipose tissue from obese individuals: possible role for PTP1B.

PubMed

Ormazabal, Paulina; Scazzocchio, Beatrice; Varì, Rosaria; Santangelo, Carmela; D'Archivio, Massimo; Silecchia, Gianfranco; Iacovelli, Annunziata; Giovannini, Claudio; Masella, Roberta

2018-05-16

The occurrence of chronic inflammation in visceral adipose tissue (VAT) in obese subjects precipitates the development of insulin resistance and type 2 diabetes (T2D). Anthocyanins and their main metabolite protocatechuic acid (PCA) have been demonstrated to stimulate insulin signaling in human adipocytes. The aim of this study was to investigate whether PCA is able to modulate insulin responsiveness and inflammation in VAT from obese (OB) and normal weight (NW) subjects. VATs obtained from NW and OB subjects were incubated or not (control) with 100 μM PCA for 24 h. After incubation, tissues untreated and treated with PCA were acutely stimulated with insulin (20 nM, 20 min). PTP1B, p65 NF-κB, phospho-p65 NF-κB, IRS-1, IRβ, Akt, GLUT4 as well as basal and insulin-stimulated Tyr-IRS-1 and Ser-Akt phosphorylations were assessed by Western blotting in NW- and OB-VAT. Samples were assessed for PTP1B activity and adipocytokine secretion. PCA restored insulin-induced phosphorylation in OB-VAT by increasing phospho-Tyr-IRS-1 and phospho-Ser-Akt after insulin stimulation as observed in NW-VAT (p < 0.05). PTP1B activity was lower in OB-VAT treated with PCA with respect to untreated (p < 0.05). Compared to non-treated tissues, PCA reduced phospho-p65 NF-κB and IL-6 in OB-VAT, and IL-1β in NW-VAT (p < 0.05); and increased adiponectin secretion in NW-VAT (p < 0.05). PCA restores the insulin responsiveness of OB-VAT by increasing IRS-1 and Akt phosphorylation which could be related with the lower PTP1B activity found in PCA-treated OB-VAT. Furthermore, PCA diminishes inflammation in VAT. These results support the beneficial role of an anthocyanin-rich diet against inflammation and insulin resistance in obesity.

Leptin Receptor Metabolism Disorder in Primary Chondrocytes from Adolescent Idiopathic Scoliosis Girls.

PubMed

Wang, Yun-Jia; Yu, Hong-Gui; Zhou, Zhen-Hai; Guo, Qiang; Wang, Long-Jie; Zhang, Hong-Qi

2016-07-20

To investigate the underlying mechanisms of low metabolic activity of primary chondrocytes obtained from girls with adolescent idiopathic scoliosis (AIS); AIS is a spine-deforming disease that often occurs in girls. AIS is associated with a lower bone mass than that of healthy individuals and osteopenia. Leptin was shown to play an important role in bone growth. It can also regulate the function of chondrocytes. Changes in leptin and Ob-R levels in AIS patients have been reported in several studies. The underlying mechanisms between the dysfunction of peripheral leptin signaling and abnormal chondrocytes remain unclear; The following parameters were evaluated in AIS patients and the control groups: total serum leptin levels; Ob-R expression in the plasma membrane of primary chondrocytes; JAK2 and STAT3 phosphorylation status. Then, we inhibited the lysosome and proteasome and knocked down clathrin heavy chain (CHC) expression in primary chondrocytes isolated from girls with AIS and evaluated Ob-R expression. We investigated the effects of leptin combined with a lysosome inhibitor or CHC knockdown in primary chondrocytes obtained from AIS patients; Compared with the controls, AIS patients showed similar total serum leptin levels, reduced JAK2 and STAT3 phosphorylation, and decreased cartilage matrix synthesis in the facet joint. Lower metabolic activity and lower membrane expression of Ob-R were observed in primary chondrocytes from the AIS group than in the controls. Lysosome inhibition increased the total Ob-R content but had no effect on the membrane expression of Ob-R or leptin's effects on AIS primary chondrocytes. CHC knockdown upregulated the membrane Ob-R levels and enhanced leptin's effects on AIS primary chondrocytes; The underlying mechanism of chondrocytes that are hyposensitive to leptin in some girls with AIS is low plasma membrane Ob-R expression that results from an imbalance between the rate of receptor endocytosis and the insertion of newly synthesized receptors into the membrane.

Improving OBS operations in ultra-deep ocean during the Southern Mariana Trench expeditions

NASA Astrophysics Data System (ADS)

Zeng, X.; Lin, J.; Xu, M.; Zhou, Z.

2017-12-01

The Mariana Trench Research Initiative, led by the South China Sea Institute of Oceanology of the Chinese Academy of Sciences and through international collaboration, focuses on investigating the deep and shallow lithospheric structure, earthquake characteristics, extreme geological environments, and the controlling geodynamic mechanisms for the formation of Earth's deepest basins in the southern Mariana Trench. Two multidisciplinary research expeditions were executed during December 2016 and June 2017, respectively, on board R/V Shiyan 3. A main task of the Mariana Initiative is to conduct the Southern Mariana OBS Experiment (SMOE), the first OBS seismic experiment across the Challenger Deep. The SMOE expeditions include both active and passive source seismic experiments and employed a large number of broadband OBS instruments. Due to the deep water, rough weather, strong winds, and other unfavorable factors, it was challenging to deploy/recover the OBSs. During the two expeditions we developed and experimented with a number of ways to improve the success rate of OBS operations in the harsh ultra-deep ocean environment of the Southern Mariana Trench. All newly acquired OBSs underwent a series of uniquely designed deep-ocean tests to improve the instrument performance and maximize reliability during their deployment under the ultra-high pressure conditions. The OBS deployment and recovery followed a unified standard operation procedure and aided by an instrumental checklist, which were specifically designed and strictly enforced for operation during the expeditions. Furthermore, an advanced ship-based radio positioning system was developed to rapidly and accurately locate the OBS instruments when they reached the sea surface; the system proved its effectiveness even under extreme weather conditions. Through the development and application of the novel methods for operation in deep oceans, we overcame the rough sea and other unfavorable factors during the first two expeditions to the southern Mariana Trench and achieved a highly successful OBS operation program.

Long-term expression of glomerular genes in diabetic nephropathy.

PubMed

Chittka, Dominik; Banas, Bernhard; Lennartz, Laura; Putz, Franz Josef; Eidenschink, Kathrin; Beck, Sebastian; Stempfl, Thomas; Moehle, Christoph; Reichelt-Wurm, Simone; Banas, Miriam C

2018-01-11

Although diabetic nephropathy (DN) is the most common cause for end-stage renal disease in western societies, its pathogenesis still remains largely unclear. A different gene pattern of diabetic and healthy kidney cells is one of the probable explanations. Numerous signalling pathways have emerged as important pathophysiological mechanisms for diabetes-induced renal injury. Glomerular cells, as podocytes or mesangial cells, are predominantly involved in the development of diabetic renal lesions. While many gene assays concerning DN are performed with whole kidney or renal cortex tissue, we isolated glomeruli from black and tan, brachyuric (BTBR) obese/obese (ob/ob) and wildtype mice at four different timepoints (4, 8, 16 and 24 weeks) and performed an mRNA microarray to identify differentially expressed genes (DEGs). In contrast to many other diabetic mouse models, these homozygous ob/ob leptin-deficient mice develop not only a severe type 2 diabetes, but also diabetic kidney injury with all the clinical and especially histologic features defining human DN. By functional enrichment analysis we were able to investigate biological processes and pathways enriched by the DEGs at different disease stages. Altered expression of nine randomly selected genes was confirmed by quantitative polymerase chain reaction from glomerular RNA. Ob/ob type 2 diabetic mice showed up- and downregulation of genes primarily involved in metabolic processes and pathways, including glucose, lipid, fatty acid, retinol and amino acid metabolism. Members of the CYP4A and ApoB family were found among the top abundant genes. But more interestingly, altered gene loci showed enrichment for processes and pathways linked to angioneogenesis, complement cascades, semaphorin pathways, oxidation and reduction processes and renin secretion. The gene profile of BTBR ob/ob type 2 diabetic mice we conducted in this study can help to identify new key players in molecular pathogenesis of diabetic kidney injury. © The Author(s) 2018. Published by Oxford University Press on behalf of ERA-EDTA. All rights reserved.

Observation Data Model Core Components, its Implementation in the Table Access Protocol Version 1.1

NASA Astrophysics Data System (ADS)

Louys, Mireille; Tody, Doug; Dowler, Patrick; Durand, Daniel; Michel, Laurent; Bonnarel, Francos; Micol, Alberto; IVOA DataModel Working Group; Louys, Mireille; Tody, Doug; Dowler, Patrick; Durand, Daniel

2017-05-01

This document defines the core components of the Observation data model that are necessary to perform data discovery when querying data centers for astronomical observations of interest. It exposes use-cases to be carried out, explains the model and provides guidelines for its implementation as a data access service based on the Table Access Protocol (TAP). It aims at providing a simple model easy to understand and to implement by data providers that wish to publish their data into the Virtual Observatory. This interface integrates data modeling and data access aspects in a single service and is named ObsTAP. It will be referenced as such in the IVOA registries. In this document, the Observation Data Model Core Components (ObsCoreDM) defines the core components of queryable metadata required for global discovery of observational data. It is meant to allow a single query to be posed to TAP services at multiple sites to perform global data discovery without having to understand the details of the services present at each site. It defines a minimal set of basic metadata and thus allows for a reasonable cost of implementation by data providers. The combination of the ObsCoreDM with TAP is referred to as an ObsTAP service. As with most of the VO Data Models, ObsCoreDM makes use of STC, Utypes, Units and UCDs. The ObsCoreDM can be serialized as a VOTable. ObsCoreDM can make reference to more complete data models such as Characterisation DM, Spectrum DM or Simple Spectral Line Data Model (SSLDM). ObsCore shares a large set of common concepts with DataSet Metadata Data Model (Cresitello-Dittmar et al. 2016) which binds together most of the data model concepts from the above models in a comprehensive and more general frame work. This current specification on the contrary provides guidelines for implementing these concepts using the TAP protocol and answering ADQL queries. It is dedicated to global discovery.

Reorganization of neuronal circuits of the central olfactory system during postprandial sleep

PubMed Central

Yamaguchi, Masahiro; Manabe, Hiroyuki; Murata, Koshi; Mori, Kensaku

2013-01-01

Plastic changes in neuronal circuits often occur in association with specific behavioral states. In this review, we focus on an emerging view that neuronal circuits in the olfactory system are reorganized along the wake-sleep cycle. Olfaction is crucial to sustaining the animals' life, and odor-guided behaviors have to be newly acquired or updated to successfully cope with a changing odor world. It is therefore likely that neuronal circuits in the olfactory system are highly plastic and undergo repeated reorganization in daily life. A remarkably plastic feature of the olfactory system is that newly generated neurons are continually integrated into neuronal circuits of the olfactory bulb (OB) throughout life. New neurons in the OB undergo an extensive selection process, during which many are eliminated by apoptosis for the fine tuning of neuronal circuits. The life and death decision of new neurons occurs extensively during a short time window of sleep after food consumption (postprandial sleep), a typical daily olfactory behavior. We review recent studies that explain how olfactory information is transferred between the OB and the olfactory cortex (OC) along the course of the wake-sleep cycle. Olfactory sensory input is effectively transferred from the OB to the OC during waking, while synchronized top-down inputs from the OC to the OB are promoted during the slow-wave sleep. We discuss possible neuronal circuit mechanisms for the selection of new neurons in the OB, which involves the encoding of olfactory sensory inputs and memory trace formation during waking and internally generated activities in the OC and OB during subsequent sleep. The plastic changes in the OB and OC are well coordinated along the course of olfactory behavior during wakefulness and postbehavioral rest and sleep. We therefore propose that the olfactory system provides an excellent model in which to understand behavioral state-dependent plastic mechanisms of the neuronal circuits in the brain. PMID:23966911

Correlates of Overweight and Obesity Among Adolescents With Bipolar Disorder in the National Comorbidity Survey-Adolescent Supplement (NCS-A).

PubMed

Goldstein, Benjamin I; Blanco, Carlos; He, Jian-Ping; Merikangas, Kathleen

2016-12-01

Despite substantial evidence on the prevalence and correlates of overweight and obesity (OW/OB) in adults with bipolar disorder (BD), little is known about this topic in adolescents with BD. The method consisted of the National Comorbidity Survey-Adolescent Supplement, a face-to-face survey of mental disorders from 2001 through 2004, using a modified version of the fully structured World Health Organization Composite International Diagnostic Interview. Participants were adolescents 13 to 17 years of age, with bipolar disorder I or II (n = 295), major depressive disorder (n = 1,112), or controls with neither mood disorder (n = 8,716). Analyses examined for group differences in the prevalence of OW/OB and for correlates of OW/OB in the group with BD. There were no significant differences in weight categories across groups. OW and OB in adolescents with BD were associated with significantly higher lifetime rates of suicide attempt (odds ratio 3.02, 95% CI 1.11-8.24), physical or sexual abuse (2.82, 1.20-6.60), binge eating or bulimia (2.66, 1.13-6.26), and conduct disorder (2.60, 1.10-6.13) in covariate-adjusted analyses. OW and OB also were significantly associated with seeing a professional for depression, being hospitalized overnight for depression, and receiving general medical treatment. The similar prevalence of OW/OB in adolescents with and without BD suggests that this potent association in adults likely comprises a consequence of BD or its correlates. In contrast, the strong association of OW/OB with proxies for depression severity, including suicide attempts and hospitalization, is already evident even in this young, nonclinical sample. Studies are warranted to determine whether early intervention of OW/OB in BD might optimize physical and mental health. Copyright © 2016 American Academy of Child and Adolescent Psychiatry. All rights reserved.

Advective transport observations with MODPATH-OBS--documentation of the MODPATH observation process

USGS Publications Warehouse

Hanson, R.T.; Kauffman, L.K.; Hill, M.C.; Dickinson, J.E.; Mehl, S.W.

2013-01-01

The MODPATH-OBS computer program described in this report is designed to calculate simulated equivalents for observations related to advective groundwater transport that can be represented in a quantitative way by using simulated particle-tracking data. The simulated equivalents supported by MODPATH-OBS are (1) distance from a source location at a defined time, or proximity to an observed location; (2) time of travel from an initial location to defined locations, areas, or volumes of the simulated system; (3) concentrations used to simulate groundwater age; and (4) percentages of water derived from contributing source areas. Although particle tracking only simulates the advective component of conservative transport, effects of non-conservative processes such as retardation can be approximated through manipulation of the effective-porosity value used to calculate velocity based on the properties of selected conservative tracers. This program can also account for simple decay or production, but it cannot account for diffusion. Dispersion can be represented through direct simulation of subsurface heterogeneity and the use of many particles. MODPATH-OBS acts as a postprocessor to MODPATH, so that the sequence of model runs generally required is MODFLOW, MODPATH, and MODPATH-OBS. The version of MODFLOW and MODPATH that support the version of MODPATH-OBS presented in this report are MODFLOW-2005 or MODFLOW-LGR, and MODPATH-LGR. MODFLOW-LGR is derived from MODFLOW-2005, MODPATH 5, and MODPATH 6 and supports local grid refinement. MODPATH-LGR is derived from MODPATH 5. It supports the forward and backward tracking of particles through locally refined grids and provides the output needed for MODPATH_OBS. For a single grid and no observations, MODPATH-LGR results are equivalent to MODPATH 5. MODPATH-LGR and MODPATH-OBS simulations can use nearly all of the capabilities of MODFLOW-2005 and MODFLOW-LGR; for example, simulations may be steady-state, transient, or a combination. Though the program name MODPATH-OBS specifically refers to observations, the program also can be used to calculate model prediction of observations. MODPATH-OBS is primarily intended for use with separate programs that conduct sensitivity analysis, data needs assessment, parameter estimation, and uncertainty analysis, such as UCODE_2005, and PEST. In many circumstances, refined grids in selected parts of a model are important to simulated hydraulics, detailed inflows and outflows, or other system characteristics. MODFLOW-LGR and MODPATH-LGR support accurate local grid refinement in which both mass (flows) and energy (head) are conserved across the local grid boundary. MODPATH-OBS is designed to take advantage of these capabilities. For example, particles tracked between a pumping well and a nearby stream, which are simulated poorly if a river and well are located in a single large grid cell, can be simulated with improved accuracy using a locally refined grid in MODFLOW-LGR, MODPATH-LGR, and MODPATH-OBS. The locally-refined-grid approach can provide more accurate simulated equivalents to observed transport between the well and the river. The documentation presented here includes a brief discussion of previous work, description of the methods, and detailed descriptions of the required input files and how the output files are typically used.

Search for Intra-day Optical Variability in Mrk 501

NASA Astrophysics Data System (ADS)

Feng, Hai-Cheng; Liu, H. T.; Fan, X. L.; Zhao, Yinghe; Bai, J. M.; Wang, Fang; Xiong, D. R.; Li, S. K.

2017-11-01

We present our observations of the optical intra-day variability (IDV) in γ-ray BL Lac object Mrk 501. The observations were run with the 1.02 m and 2.4 m optical telescopes at Yunnan Observatories from 2005 April to 2012 May. The light curve at the R band on 2010 May 15 passes both variability tests (the F-test and the ANOVA test). A flare within the light curve on 2010 May 15 has a magnitude change of {{Δ }}m=0.03+/- {0.005}{stat}+/- {0.007}{sys} mag, a darkening timescale of {τ }{{d}}=26.7 minutes, and an amplitude of IDV {Amp}=2.9 % +/- 0.7 % . A decline described by 11 consecutive flux measurements within the flare can be fitted linearly with a Pearson’s correlation coefficient r = 0.945 at the confidence level of > 99.99 % . Under the assumptions that the IDV is tightly connected to the mass of the black hole, and that the flare duration, being two times {τ }{{d}}, is representative of the minimum characteristic timescale, we can derive upper bounds to the mass of the black hole. In the case of the Kerr black hole, the timescale of {{Δ }}{t}\\min {ob}=0.89 hr gives {M}\\bullet ≲ {10}9.20{M}⊙ , which is consistent with measurements reported in the literature. This agreement indicates that the hypothesis about {M}\\bullet and {{Δ }}{t}\\min {ob} is consistent with the measurements/data.

A comparison between two permanent broad band ocean bottom seismometers in the western Mediterranean Sea

NASA Astrophysics Data System (ADS)

Frontera, T.; Deschamps, A.; Ugalde, A.; Jara, J. A.; Hello, Y.; Goula, X.; Olivera, C.

2009-04-01

The aim of this work is to compare two permanent broad band ocean bottom seismometers (OBS) in terms of noise conditions by taking to account their similar instrumentation types, but their very different site characteristics. Both OBS stations have Güralp CMG-3T three component broad band sensors and differential pressure gauges (DPG). The first sensor operates since August 2005 under the framework of a research project that aims to improve the knowledge of the seismicity and seismic risk in the Tarragona region (north eastern Spain). This pioneering project in Spain is being carried out by the Institut Geològic de Catalunya (IGC) and the Observatori de l'Ebre, in collaboration with the Spanish oil company Repsol Investigaciones Petrolíferas, and is being financed by the Ministerio de Educación y Ciencia (CASABLANCA REN2003-06577), FEDER funding, the IGC and the Institut Cartogràfic de Catalunya. The OBS is installed inside the security perimeter of the Casablanca oil platform, which is located 40 km offshore Tarragona. The sensors are submerged at about 400 m to the SW of the oil platform at about 150 m in depth. Data are digitized on-site and are transmitted through a submarine cable to the platform, where they are recorded. In July 2007 some improvements were made: i) the OBS was completely buried and the DPG was moved about 10 m away from the OBS; and ii) via satellite signal transmission was implemented, which allowed to have continuous and real time data in Barcelona so that the OBS could be integrated into the Catalan Seismic Network. The second seismometer operates in the frame of the Antares neutrino telescope project developed in Liguria Sea. Geoazur is carrying out the project of deployment of a broad band seismological instrument in the aim of developing the permanent sea floor observation knowledge necessary to characterize Ligurian Sea seismicity and seismic risk along French Riviera coast (SE France). The operation was facilitated by the deployment of an opto-electrical cable to provide power and data transmission from the coast to a recording point at 2550 m in depth and 15km south to Porquerolles Island in the frame of the Antares neutrino telescope project. The program was founded in the 2002-2006 CPER (State-Region Research plan) by PACA region and CNRS/INSU and in the Antares collaboration which is responsible of all the marine operations on the site. The OBS and the DPG were set up by the ROV "Victor" from Ifremer (French Research Institute for Exploitation of the Sea) and partially buried; levelling and orientation were performed directly on the site. The instrument was running from April 2005 to April 2007. In April 2006 the sensor was completely buried. Data transmitted in quasi real time to Geoazur were integrated to the regional data center. In April 2007 the sensor was retrieved and reinstalled with data transmission protocol modification in October 2008. A water leak detected in December forced to cut the alimentation in January 2009. Because both sensors have not operated over the same time period, two different periods have been analysed: 2006 for the Antares OBS and 2008 for the Casablanca's one. In this way we are able to make a comparison of the noise behaviour by observing also the seasonal evolution. As observed on most of the ocean floor observatories, the noise is quite large on all components for both OBS. In general, the Antares OBS shows a better behaviour than the Casablanca OBS, due to the more favourable site conditions. Both OBS have been reinstalled to ameliorate some site condition deficiencies, which has basically affected the low frequency band, between 0.008 and 0.07 Hz. After the reinstallations, the noise conditions have improved at least 10 dB. A comparison of the power spectral density (PSD) curves for both stations concerning the periods after the reinstallations of the OBS show that, at low frequencies, the vertical component PSD curve for the Casablanca OBS is about 20 dB higher than the Antares PSD curve. However, both fall in between Peterson's new high (NHNM) and low (NLNM) noise models. The PSD of the horizontal components for the Casablanca OBS in the same frequency band is higher than that of the vertical component and is also higher than the NHNM. For the Antares OBS the PSD curves of the horizontal components are higher than the Antares vertical component PSD curve, but they lie inside the margins marked by Peterson's models. On the microseismic band, between 0.07 and 2 Hz, quieter PSD curves for the Antares OBS than for the Casablanca's one are observed. Nevertheless, the primary microseismic peak is not seen on the Antares PSD curves, whereas it can be observed on the vertical component PSD curve for the Casablanca OBS. As for the secondary microseimic peak, it is much better defined on the Antares PSD curves than for the Casablanca case for all components. Finally, at high frequencies between 2 and 50 Hz, high noise levels are observed for all components and both OBS.

Olecranon Bursitis in a Military Population: Epidemiology and Evidence for Prolonged Morbidity in Combat Recruits.

PubMed

Schermann, Haggai; Karakis, Isabella; Dolkart, Oleg; Maman, Eran; Kadar, Assaf; Chechik, Ofir

2017-09-01

Olecranon bursitis (OB) is a benign but disturbing condition that may adversely affect a military recruit's combat preparedness. This study was designed to assess incidence, risk factors, and associated medical burden of OB in the Israel Defense Forces. This is a retrospective study drawing on medical records of all Israel Defense Forces soldiers diagnosed as having OB between 2005 and 2015. OB was classified as septic and noninfectious. Crude incidence rates and duty-specific incidence rates were calculated. Medical burden was defined by the number of physician visits, referrals to orthopedic specialist consultations, duration of symptoms, and duration of pharmaceutical treatment. Demographic and occupational information (age, sex, height, weight, socioeconomic status, country of origin, type of military service, time of presentation to medical services) was used to identify risk factors for septic bursitis and longer duration of symptoms. Statistical analysis was performed in R statistical software. Risk factors were evaluated using the Chi-square test for categorical variables and Pearson correlation coefficients were used for continuous variables. The study was approved by the Israeli Defense Force IRB. A total of 2,692 soldiers were diagnosed with OB during the study period. The crude annual incidence rate of OB was 29/100,000 person-years (PY). Combat duty had an incidence of 97/100,000 PY, and noncombat duties had an incidence of 12/10,000 PY (p < 0.001). Female incidence (8.4/100,000 PY) was similar to male incidence (11/100,000 PY) in administrative duties (p = 0.54). More cases were diagnosed during summer and autumn than in other seasons (p = 0.016). Septic bursitis constituted 24% of all cases, was more frequent in combat soldiers (32%), and on average presented earlier in service than noninfectious OB (13 vs. 17 weeks since recruitment). The mean duration of symptoms was estimated at 17.58 weeks, with a mean of 1.75 physician visits per soldier. About 19% received a specialist referral. Origin from the former USSR was associated with a higher duration of symptoms (p = 0.012). Type of military service was the principal risk factor for OB, as indicated by a higher incidence of the disorder among combat compared to noncombat units, possibly the result of field training without protective gear and repetitive trauma to elbows. The greater number of diagnoses of OB during summer and autumn, when training is more intensive, support that explanation. Sex did not affect incidence of OB in administrative units. The medical burden appears to be relatively low, since most of the soldiers had only one physician visit. OB is highly prevalent in military compared to civilian populations. Outdoor training involving crawling is a probable explanation for the much higher rates among combat units and increased number of diagnoses during warm summer and autumn months. Prevention by use of protective gear seems to be the most promising intervention. Reprint & Copyright © 2017 Association of Military Surgeons of the U.S.

OBS development for long term observation in the Marmara Sea, NW Turkey

NASA Astrophysics Data System (ADS)

Takahashi, Narumi; Shimizu, Satoshi; Maekawa, Takuya; Kalafat, Dogan; Pinar, Ali; Citak, Seckin; Kaneda, Yoshiyuki

2015-04-01

We have carried out a collaboration study between Japan and Turkey since 2013, which is one of SATREPS projects, "Earthquake and Tsunami Disaster Mitigation in The Marmara Region and Disaster Education in Turkey". The main objective of this project is to reduce risk brought by earthquakes and tsunamis. In particular, the North Anatolian Fault system runs through the Marmara sea and it is expected that the seismic gap exists there according to past seismic studies. The details of seismicity distribution in the Marmara Sea is, however, still insufficient to construct fault model along the active faults. Therefore, we prepare ten ocean bottom seismographs (OBSs) to realize long term observation. We aim to identify size and depth of seismogenic zones using micro seismicity. In addition, we need to cover relative broad area from off-shore Istanbul city to the western end of the Marmara Sea. To clear these conditions, OBS specifications we need are high dynamic range and low instrument noise to observe micro seismicity, low electrical consumption to realize long term observation of over one year, high cost performance to cover the broad area for OBS installation, low cost implementation, and good operability to treat by relatively small number of persons. All items, which are three components velocity sensor, batteries, a recorder, a GPS receiver, a transponder and its transducer to control OBS retrieval, a flasher and a beacon, are installed in the 17 inches glass sphere. The natural frequency of the velocity sensor is 4.5 Hz and the frequency range of our OBS is from 4.5 Hz to 250 Hz. Data sampling is selectable among 100 Hz, 250 Hz and 500 Hz. Because our OBS is deployed by free fall, accuracy of the OBS clock is essentially one of important factors, and it is less than 0.1 ppm. And the resolution of A/D conversion performed on the recorder is 24 bit and we keep the dynamic range of over 135 dB. These data is stored on a semiconductor memory and the capacity is over 300 days with 100 Hz sampling observation. We adopted noncontact charge using lithium ion batteries to reduce implementation cost. And we can charge batteries and transfer stored data without opening glass sphere. All parameters of each OBS are controlled using wireless LAN. In this presentation, we introduce details of OBS development for Japan-Turkey project.

Reduced active transcellular intestinal oxalate secretion contributes to the pathogenesis of obesity-associated hyperoxaluria.

PubMed

Amin, Ruhul; Asplin, John; Jung, Daniel; Bashir, Mohamed; Alshaikh, Altayeb; Ratakonda, Sireesha; Sharma, Sapna; Jeon, Sohee; Granja, Ignacio; Matern, Dietrich; Hassan, Hatim

2018-05-01

Most kidney stones are composed of calcium oxalate, and minor changes in urine oxalate affect the stone risk. Obesity is a risk factor for kidney stones and a positive correlation of unknown etiology between increased body size, and elevated urinary oxalate excretion has been reported. Here, we used obese ob/ob (ob) mice to elucidate the pathogenesis of obesity-associated hyperoxaluria. These ob mice have significant hyperoxaluria (3.3-fold) compared with control mice, which is not due to overeating as shown by pair-feeding studies. Dietary oxalate removal greatly ameliorated this hyperoxaluria, confirming that it is largely enteric in origin. Transporter SLC26A6 (A6) plays an essential role in active transcellular intestinal oxalate secretion, and ob mice have significantly reduced jejunal A6 mRNA (- 80%) and total protein (- 62%) expression. While net oxalate secretion was observed in control jejunal tissues mounted in Ussing chambers, net absorption was seen in ob tissues, due to significantly reduced secretion. We hypothesized that the obesity-associated increase in intestinal and systemic inflammation, as reflected by elevated proinflammatory cytokines, suppresses A6-mediated intestinal oxalate secretion and contributes to obesity-associated hyperoxaluria. Indeed, proinflammatory cytokines (elevated in ob mice) significantly decreased intestinal oxalate transport in vitro by reducing A6 mRNA and total protein expression. Proinflammatory cytokines also significantly reduced active mouse jejunal oxalate secretion, converting oxalate transport from net secretion in vehicle-treated tissues to net absorption in proinflammatory cytokines-treated tissues. Thus, reduced active intestinal oxalate secretion, likely secondary to local and systemic inflammation, contributes to the pathogenesis of obesity-associated hyperoxaluria. Hence, proinflammatory cytokines represent potential therapeutic targets. Copyright © 2017 International Society of Nephrology. Published by Elsevier Inc. All rights reserved.

Children of parents with BED have more eating behavior disturbance than children of parents with obesity or healthy weight.

PubMed

Lydecker, Janet A; Grilo, Carlos M

2017-06-01

A limited literature suggests an association between parental eating disorders and child eating-disorder behaviors although this research has focused primarily on restrictive-type eating disorders and very little is known about families with binge-eating disorder (BED). The current study focused on parents (N = 331; 103 fathers and 226 mothers), comparing parents with core features of BED (n = 63) to parents with obesity and no eating disorder (OB; n = 85) and parents with healthy-weight and no eating disorder (HW; n = 183). Parents with BED were significantly more likely than OB and HW parents to report child binge eating, and more likely than HW parents to report child overeating. Parents with BED felt greater responsibility for child feeding than OB parents, and felt more concern about their child's weight than OB and HW parents. Dietary restriction of the child by the parents was related to child binge eating, overeating, and child overweight, and parental group was related to child binge eating (parental BED), overeating (parental BED), and child weight (parental OB). Parents with BED report greater disturbance in their children's eating than OB and HW parents, and OB parents report higher child weight than HW parents. This suggests that it is important to consider both eating-disorder psychopathology and obesity in clinical interventions and research. Our cross-sectional findings, which require experimental and prospective confirmations, provide preliminary evidence suggesting potential factors in families with parental BED and obesity to address in treatment and prevention efforts for pediatric eating disorders and obesity. © 2016 Wiley Periodicals, Inc.(Int J Eat Disord 2017; 50:648-656). © 2016 Wiley Periodicals, Inc.

[Prevalence of obesity and arterial hypertension and their relationship with age and gender in the city of Resistencia, Argentina, in the years 2008-2014].

PubMed

Bianchi, M E V; Cusumano, A M; Torres, C; Rojas, N G; Velasco, G A

2018-05-17

Obesity (OB) is a global pandemic, which is associated with arterial hypertension (AH). The differences in this relationship according to gender and age remain unclear. The objectives of this study were to establish the prevalence of OB and AH in an adult population, and to determine the risk of AH associated with OB in relationship to gender and age. A cross-sectional study was performed using the database of successive cross-sectional studies carried out in 5 city squares in Resistencia (Argentina) during the years 2008-2014. The sample was randomised according to gender and age, according to the distribution of the last National Argentine Census. A total of 7,898 passers-by (46.8% males) with a mean age 42.74 ± 16.70 years were included. OB in men increased from 21.3% to 26.9%, and in women from 15.2% to 23%, the former having the highest prevalence between 40-49 years, and the latter between 50-59 years, and thereafter it was always higher in women. AH increased in men from 39.9% to 42.7%, and in women from 25.8% to 29.2%, the former having the highest prevalence between 60-69 years, the latter between 70-79 years. In the 7 years of the study, OB and AH prevalence increased. It was higher in men, although the risk of developing AH associated with OB was greater in older women. The highest prevalence of OB and AH appears a decade earlier in men. Copyright © 2018 SEH-LELHA. Publicado por Elsevier España, S.L.U. All rights reserved.

Associations between Child Anxiety Symptoms and Child and Family Factors in Pediatric Obesity

PubMed Central

Lim, Crystal S.; Espil, Flint M.; Viana, Andres G.; Janicke, David M.

2015-01-01

Objective The current study compared child weight status, social skills, body dissatisfaction, and health-related quality of life (HRQOL), as well as parent distress and family functioning in youth who are overweight and obese (OV/OB) with versus without clinical anxiety symptoms. Method Participants included 199 children 7–12 years old (Mage= 9.88 years) who were OV/OB and their parents. Children completed social skills, body dissatisfaction, and HRQOL questionnaires. Parents completed the Child Behavior Checklist (CBCL) and child HRQOL, parent distress, family functioning, and demographic questionnaires. Children were placed in two groups based on CBCL Anxiety Problems scale scores; the OV/OB + Clinical Anxiety group included children with T-scores ≥ 65 (n = 23) and children with T-scores ≤ 59 comprised the OV/OB group (n = 176). Results After controlling for covariates, children in the OV/OB + Clinical Anxiety group reported more body dissatisfaction (F [1,198] = 5.26, p =.023, partial η2 = .027) and lower total HRQOL (F [1,198] = 8.12, p = .005, η2=.041) and had parents who reported higher psychological distress (F [1,198] = 5.48, p = .020, η2=.028) and lower child total HRQOL (F [1,198] = 28.23, p < .001, η2=.128) compared to children in the OV/OB group. Group differences were not significant for child weight status, social skills, or family functioning. Conclusion Clinically significant anxiety among children who are OV/OB is associated with increased body dissatisfaction and parent psychological distress, as well as decreased HRQOL. Findings have implications for the assessment and treatment of anxiety symptoms in pediatric obesity. PMID:26468940

A theoretical framework for analyzing coupled neuronal networks: Application to the olfactory system.

PubMed

Barreiro, Andrea K; Gautam, Shree Hari; Shew, Woodrow L; Ly, Cheng

2017-10-01

Determining how synaptic coupling within and between regions is modulated during sensory processing is an important topic in neuroscience. Electrophysiological recordings provide detailed information about neural spiking but have traditionally been confined to a particular region or layer of cortex. Here we develop new theoretical methods to study interactions between and within two brain regions, based on experimental measurements of spiking activity simultaneously recorded from the two regions. By systematically comparing experimentally-obtained spiking statistics to (efficiently computed) model spike rate statistics, we identify regions in model parameter space that are consistent with the experimental data. We apply our new technique to dual micro-electrode array in vivo recordings from two distinct regions: olfactory bulb (OB) and anterior piriform cortex (PC). Our analysis predicts that: i) inhibition within the afferent region (OB) has to be weaker than the inhibition within PC, ii) excitation from PC to OB is generally stronger than excitation from OB to PC, iii) excitation from PC to OB and inhibition within PC have to both be relatively strong compared to presynaptic inputs from OB. These predictions are validated in a spiking neural network model of the OB-PC pathway that satisfies the many constraints from our experimental data. We find when the derived relationships are violated, the spiking statistics no longer satisfy the constraints from the data. In principle this modeling framework can be adapted to other systems and be used to investigate relationships between other neural attributes besides network connection strengths. Thus, this work can serve as a guide to further investigations into the relationships of various neural attributes within and across different regions during sensory processing.

Maternal obesity and overnutrition alter fetal growth rate and cotyledonary vascularity and angiogenic factor expression in the ewe.

PubMed

Ma, Yan; Zhu, Mei J; Zhang, Liren; Hein, Sarah M; Nathanielsz, Peter W; Ford, Stephen P

2010-07-01

In pregnant sheep, maternal:fetal exchange occurs across placentomes composed of placental cotyledonary and uterine caruncular tissues. Recently, we reported that fetal weights of obese (OB) ewes [fed a diet of 150% of National Research Council (NRC) recommendations] were approximately 30% greater than those of control (C) ewes (fed a diet 100% of NRC recommendations) at midgestation (MG), but fetal weights were similar in late gestation (LG). Transplacental nutrient exchange is dependent on placental blood flow, which itself is dependent on placental vascularity. The current study investigated whether the observed initial faster and subsequent slower fetal growth rate of OB compared with C was associated with changes in cotyledonary vascularity and expression of angiogenic factors (vascular endothelial growth factor, fibroblast growth factor-2, placental growth factor, angiopoietin-1 and -2). Cotyledonary arteriole diameters were markedly greater (P < 0.05) in OB than C ewes at MG, but while arteriole diameter of C ewes increased (P < 0.05) from MG to LG, they remained unchanged in OB ewes. Cotyledonary arterial angiogenic factors mRNA and protein expression were lower (P < 0.05) in OB than C ewes at MG and remained low from MG to LG. In contrast, mRNA levels of angiogenic factors in C ewes declined from high levels at MG to reach those of OB ewes by LG. The increase in cotyledonary arteriole diameter in early to MG may function to accelerate fetal growth rate in OB ewes, while the decreased cotyledonary arterial angiogenic factors from MG-LG may function to protect the fetus from excessive placental vascular development, increased maternal nutrient delivery, and excessive weight gain.

Neutrophilic Iron-Oxidizing “Zetaproteobacteria” and Mild Steel Corrosion in Nearshore Marine Environments ▿ †

PubMed Central

McBeth, Joyce M.; Little, Brenda J.; Ray, Richard I.; Farrar, Katherine M.; Emerson, David

2011-01-01

Microbiologically influenced corrosion (MIC) of mild steel in seawater is an expensive and enduring problem. Little attention has been paid to the role of neutrophilic, lithotrophic, iron-oxidizing bacteria (FeOB) in MIC. The goal of this study was to determine if marine FeOB related to Mariprofundus are involved in this process. To examine this, field incubations and laboratory microcosm experiments were conducted. Mild steel samples incubated in nearshore environments were colonized by marine FeOB, as evidenced by the presence of helical iron-encrusted stalks diagnostic of the FeOB Mariprofundus ferrooxydans, a member of the candidate class “Zetaproteobacteria.” Furthermore, Mariprofundus-like cells were enriched from MIC biofilms. The presence of Zetaproteobacteria was confirmed using a Zetaproteobacteria-specific small-subunit (SSU) rRNA gene primer set to amplify sequences related to M. ferrooxydans from both enrichments and in situ samples of MIC biofilms. Temporal in situ incubation studies showed a qualitative increase in stalk distribution on mild steel, suggesting progressive colonization by stalk-forming FeOB. We also isolated a novel FeOB, designated Mariprofundus sp. strain GSB2, from an iron oxide mat in a salt marsh. Strain GSB2 enhanced uniform corrosion from mild steel in laboratory microcosm experiments conducted over 4 days. Iron concentrations (including precipitates) in the medium were used as a measure of corrosion. The corrosion in biotic samples (7.4 ± 0.1 mM) was significantly higher than that in abiotic controls (5.0 ± 0.1 mM). These results have important implications for the role of FeOB in corrosion of steel in nearshore and estuarine environments. In addition, this work shows that the global distribution of Zetaproteobacteria is far greater than previously thought. PMID:21131509

Maternal obesity and overnutrition alter fetal growth rate and cotyledonary vascularity and angiogenic factor expression in the ewe

PubMed Central

Ma, Yan; Zhu, Mei J.; Zhang, Liren; Hein, Sarah M.; Nathanielsz, Peter W.

2010-01-01

In pregnant sheep, maternal:fetal exchange occurs across placentomes composed of placental cotyledonary and uterine caruncular tissues. Recently, we reported that fetal weights of obese (OB) ewes [fed a diet of 150% of National Research Council (NRC) recommendations] were ∼30% greater than those of control (C) ewes (fed a diet 100% of NRC recommendations) at midgestation (MG), but fetal weights were similar in late gestation (LG). Transplacental nutrient exchange is dependent on placental blood flow, which itself is dependent on placental vascularity. The current study investigated whether the observed initial faster and subsequent slower fetal growth rate of OB compared with C was associated with changes in cotyledonary vascularity and expression of angiogenic factors (vascular endothelial growth factor, fibroblast growth factor-2, placental growth factor, angiopoietin-1 and -2). Cotyledonary arteriole diameters were markedly greater (P < 0.05) in OB than C ewes at MG, but while arteriole diameter of C ewes increased (P < 0.05) from MG to LG, they remained unchanged in OB ewes. Cotyledonary arterial angiogenic factors mRNA and protein expression were lower (P < 0.05) in OB than C ewes at MG and remained low from MG to LG. In contrast, mRNA levels of angiogenic factors in C ewes declined from high levels at MG to reach those of OB ewes by LG. The increase in cotyledonary arteriole diameter in early to MG may function to accelerate fetal growth rate in OB ewes, while the decreased cotyledonary arterial angiogenic factors from MG-LG may function to protect the fetus from excessive placental vascular development, increased maternal nutrient delivery, and excessive weight gain. PMID:20427725

Effects of Body Fat on the Associations of High-Molecular-Weight Adiponectin, Leptin and Soluble Leptin Receptor with Metabolic Syndrome in Chinese

PubMed Central

Yu, Danxia; Yu, Zhijie; Sun, Qi; Sun, Liang; Li, Huaixing; Song, Jun; Mi, Ming; Wu, Hongyu; Lu, Ling; Liu, Chen; Zhang, Geng; Hu, Frank B.; Lin, Xu

2011-01-01

Background Little is known regarding the associations between high-molecular-weight (HMW-) adiponectin, leptin and soluble leptin receptor (sOB-R) and metabolic syndrome (MetS) in Chinese. Also few studies elucidate the effects of inflammation and body fat mass on the relations. Methods Plasma HMW-adiponectin, leptin and sOB-R were measured among 1055 Chinese men and women (35∼54 yrs). Whole body and trunk fat mass were determined by Dual-energy X-ray absorptiometry. MetS was defined by the updated NCEP/ATPIII criterion for Asian-Americans. Results HMW-adiponectin was inversely associated with MetS in multivariate model including fat mass index (FMI), inflammatory markers, leptin and sOB-R (OR in the highest quartile  = 0.30, 95%CI 0.18∼0.50, P<.0001). Plasma sOB-R was also inversely associated with MetS independent of body fatness and inflammatory markers, whereas the association was somewhat attenuated after adjusting HMW-adiponectin (OR for the highest quartile  = 0.78, 95%CI 0.47∼1.32, P = 0.15). In contrast, leptin was associated with increased odds of MetS independent of inflammatory markers, HMW-adiponectin, and sOB-R (OR for the highest quartile  = 2.64, 95%CI 1.35∼5.18, P = 0.006), although further adjustment for FMI abolished this association. Conclusions HMW-adiponectin exhibited strong inverse associations with MetS independent of body composition, inflammation, leptin and sOB-R; while the associations of leptin and sOB-R were largely explained by fat mass or HMW-adiponectin, respectively. PMID:21347230

[Mortality study in a cohort of workers employed in the hot working processing of plastics and rubber].

PubMed

Gerosa, Alberto; Scarnato, Corrado; Marchesini, Bruno; Ietri, Evi; Pavone, Venere Leda Mara

2017-01-01

to study mortality rates among workers in companies manufacturing thermoplastic and rubber articles (excluding tyres). cohort study. the cohort includes 4,543 workers employed up to 2000 in 131 companies in the Province of Bologna (Emilia-Romagna Region, Northern Italy) exposed to emissions from hot processing of plastics (3,937) and rubber (606). general- and cause-specific Standardized Mortality Rates (SMR), with 95% confidence intervals; entire reference population resides in the Emilia-Romagna Region. excess mortality for all causes (116 Obs; SMR: 1.20; 95%CI 1.00-1.44) and for lung cancer (18 Obs; SMR: 1.67; 95%CI 1.05-2.65) in men of the rubber factories. Increased mortality rates for oesophageal cancers in women (3 Obs; SMR: 5.41; 95%CI 1.74-16.8) and in men (6 Obs; SMR: 2.16; 95%CI 0.97-4.81), for malignant tumours of pancreas (16 Obs; SMR: 1.65; 95%CI 1.01- 2.70), rectum (11 Obs; SMR: 2.17; 95%CI 1.20-3.92) and kidney (11 Obs; SMR: 1.98; 95%CI 1.10-3.58) in men occupied in plastic processing. in this study, we observed an excess of mortality rates for lung cancer in men of rubber factories and for malignant tumours of the digestive tract, pancreas, and kidney in workers employed in the production of plastic articles. Nevertheless, these results must be interpreted with caution, because exposures to non-occupational risk factors, like tobacco smoke or other occupational exposures outside the companies concerned, are not known. The results suggest to continue epidemiological surveillance.

UDP-Glucuronosyltransferase Expression in Mouse Liver Is Increased in Obesity- and Fasting-Induced Steatosis

PubMed Central

Xu, Jialin; Kulkarni, Supriya R.; Li, Liya

2012-01-01

UDP-glucuronosyltransferases (Ugt) catalyze phase II conjugation reactions with glucuronic acid, which enhances chemical polarity and the elimination from the body. Few studies have addressed whether Ugt expression and activity are affected by liver disease, such as steatosis. The purpose of this study was to determine whether steatosis induced by obesity or fasting could affect liver Ugt mRNA expression and activity. Male C57BL/6J and Lepob/ob (ob/ob) mice were fed ad libitum or food was withheld for 24 h. In steatotic livers of ob/ob mice, Ugt1a1, -1a6, -1a9, -2a3, -3a1, and -3a2 mRNA expression increased. Fasting, which also induced steatosis, increased hepatic Ugt1a1, -1a6, -1a7, -1a9, -2b1, -2b5, -2a3, -3a1, and -3a2 mRNA expression in mouse liver. Likewise, acetaminophen glucuronidation increased by 47% in hepatic microsomes from ob/ob mice compared with that in C57BL/6J mice, but not after fasting. In both steatosis models, Ugt induction was accompanied by increased aryl hydrocarbon receptor, constitutive androstane receptor (CAR), peroxisome proliferator-activated receptor (PPAR)-α, pregnane X receptor, nuclear factor (erythroid-derived 2)-like 2 (Nrf2), and peroxisome proliferator-activated receptor-γ coactivator-1α mRNA expression. In addition, fasting increased CAR, PPAR, and Nrf2 binding activity. The work points to hepatic triglyceride concentrations corresponding with nuclear receptor and Ugt expression. The findings indicate that steatosis significantly alters hepatic Ugt expression and activity, which could have a significant impact on determining circulating hormone levels, drug efficacy, and environmental chemical clearance. PMID:22031624

Temporal Profiling and Pulsed SILAC Labeling Identify Novel Secreted Proteins During Ex Vivo Osteoblast Differentiation of Human Stromal Stem Cells*

PubMed Central

Kristensen, Lars P.; Chen, Li; Nielsen, Maria Overbeck; Qanie, Diyako W.; Kratchmarova, Irina; Kassem, Moustapha; Andersen, Jens S.

2012-01-01

It is well established that bone forming cells (osteoblasts) secrete proteins with autocrine, paracrine, and endocrine function. However, the identity and functional role for the majority of these secreted and differentially expressed proteins during the osteoblast (OB) differentiation process, is not fully established. To address these questions, we quantified the temporal dynamics of the human stromal (mesenchymal, skeletal) stem cell (hMSC) secretome during ex vivo OB differentiation using stable isotope labeling by amino acids in cell culture (SILAC). In addition, we employed pulsed SILAC labeling to distinguish genuine secreted proteins from intracellular contaminants. We identified 466 potentially secreted proteins that were quantified at 5 time-points during 14-days ex vivo OB differentiation including 41 proteins known to be involved in OB functions. Among these, 315 proteins exhibited more than 2-fold up or down-regulation. The pulsed SILAC method revealed a strong correlation between the fraction of isotope labeling and the subset of proteins known to be secreted and involved in OB differentiation. We verified SILAC data using qRT-PCR analysis of 9 identified potential novel regulators of OB differentiation. Furthermore, we studied the biological effects of one of these proteins, the hormone stanniocalcin 2 (STC2) and demonstrated its autocrine effects in enhancing osteoblastic differentiation of hMSC. In conclusion, combining complete and pulsed SILAC labeling facilitated the identification of novel factors produced by hMSC with potential role in OB differentiation. Our study demonstrates that the secretome of osteoblastic cells is more complex than previously reported and supports the emerging evidence that osteoblastic cells secrete proteins with endocrine functions and regulate cellular processes beyond bone formation. PMID:22801418

Neutrophilic iron-oxidizing "zetaproteobacteria" and mild steel corrosion in nearshore marine environments.

PubMed

McBeth, Joyce M; Little, Brenda J; Ray, Richard I; Farrar, Katherine M; Emerson, David

2011-02-01

Microbiologically influenced corrosion (MIC) of mild steel in seawater is an expensive and enduring problem. Little attention has been paid to the role of neutrophilic, lithotrophic, iron-oxidizing bacteria (FeOB) in MIC. The goal of this study was to determine if marine FeOB related to Mariprofundus are involved in this process. To examine this, field incubations and laboratory microcosm experiments were conducted. Mild steel samples incubated in nearshore environments were colonized by marine FeOB, as evidenced by the presence of helical iron-encrusted stalks diagnostic of the FeOB Mariprofundus ferrooxydans, a member of the candidate class "Zetaproteobacteria." Furthermore, Mariprofundus-like cells were enriched from MIC biofilms. The presence of Zetaproteobacteria was confirmed using a Zetaproteobacteria-specific small-subunit (SSU) rRNA gene primer set to amplify sequences related to M. ferrooxydans from both enrichments and in situ samples of MIC biofilms. Temporal in situ incubation studies showed a qualitative increase in stalk distribution on mild steel, suggesting progressive colonization by stalk-forming FeOB. We also isolated a novel FeOB, designated Mariprofundus sp. strain GSB2, from an iron oxide mat in a salt marsh. Strain GSB2 enhanced uniform corrosion from mild steel in laboratory microcosm experiments conducted over 4 days. Iron concentrations (including precipitates) in the medium were used as a measure of corrosion. The corrosion in biotic samples (7.4 ± 0.1 mM) was significantly higher than that in abiotic controls (5.0 ± 0.1 mM). These results have important implications for the role of FeOB in corrosion of steel in nearshore and estuarine environments. In addition, this work shows that the global distribution of Zetaproteobacteria is far greater than previously thought.

Assessing the osteoblast transcriptome in a model of enhanced bone formation due to constitutive Gs-G protein signaling in osteoblasts

PubMed Central

Wattanachanya, Lalita; Wang, Liping; Millard, Susan M.; Lu, Wei-Dar; O’Carroll, Dylan; Hsiao, Edward C.; Conklin, Bruce R.; Nissenson, Robert A.

2015-01-01

G protein–coupled receptor (GPCR) signaling in osteoblasts (OBs) is an important regulator of bone formation. We previously described a mouse model expressing Rs1, an engineered constitutively active Gs-coupled GPCR, under the control of the 2.3-kb Col I promoter. These mice showed a dramatic age-dependent increase in trabecular bone of femurs. Here, we further evaluated the effects of enhanced Gs signaling in OBs on intramembranous bone formation by examining calvariae of 1- and 9-week-old Col1(2.3)/Rs1 mice and characterized the in vivo gene expression specifically occurring in osteoblasts with activated Gs G protein–coupled receptor signaling, at the cellular level rather than in a whole bone. Rs1 calvariae displayed a dramatic increase in bone volume with partial loss of cortical structure. By immunohistochemistry, Osterix was detected in cells throughout the inter-trabecular space while Osteocalcin was expressed predominantly in cells along bone surfaces, suggesting the role of paracrine mediators secreted from OBs driven by 2.3-kb Col I promoter could influence early OB commitment, differentiation, and/or proliferation. Gene expression analysis of calvarial OBs revealed that genes affected by Rs1 signaling include those encoding proteins important for cell differentiation, cytokines and growth factors, angiogenesis, coagulation, and energy metabolism. The set of Gs-GPCRs and other GPCRs that may contribute to the observed skeletal phenotype and candidate paracrine mediators of the effect of Gs signaling in OBs were also determined. Our results identify novel detailed in vivo cellular changes of the anabolic response of the skeleton to Gs signaling in mature OBs. PMID:25704759

Microarray profiling of human white adipose tissue after exogenous leptin injection.

PubMed

Taleb, S; Van Haaften, R; Henegar, C; Hukshorn, C; Cancello, R; Pelloux, V; Hanczar, B; Viguerie, N; Langin, D; Evelo, C; Zucker, J; Clément, K; Saris, W H M

2006-03-01

Leptin is a secreted adipocyte hormone that plays a key role in the regulation of body weight homeostasis. The leptin effect on human white adipose tissue (WAT) is still debated. The aim of this study was to assess whether the administration of polyethylene glycol-leptin (PEG-OB) in a single supraphysiological dose has transcriptional effects on genes of WAT and to identify its target genes and functional pathways in WAT. Blood samples and WAT biopsies were obtained from 10 healthy nonobese men before treatment and 72 h after the PEG-OB injection, leading to an approximate 809-fold increase in circulating leptin. The WAT gene expression profile before and after the PEG-OB injection was compared using pangenomic microarrays. Functional gene annotations based on the gene ontology of the PEG-OB regulated genes were performed using both an 'in house' automated procedure and GenMAPP (Gene Microarray Pathway Profiler), designed for viewing and analyzing gene expression data in the context of biological pathways. Statistical analysis of microarray data revealed that PEG-OB had a major down-regulated effect on WAT gene expression, as we obtained 1,822 and 100 down- and up-regulated genes, respectively. Microarray data were validated using reverse transcription quantitative PCR. Functional gene annotations of PEG-OB regulated genes revealed that the functional class related to immunity and inflammation was among the most mobilized PEG-OB pathway in WAT. These genes are mainly expressed in the cell of the stroma vascular fraction in comparison with adipocytes. Our observations support the hypothesis that leptin could act on WAT, particularly on genes related to inflammation and immunity, which may suggest a novel leptin target pathway in human WAT.

Seismic structure and activity of the north-central Lesser Antilles subduction zone from an integrated approach: Similarities with the Tohoku forearc

NASA Astrophysics Data System (ADS)

Laigle, M.; Hirn, A.; Sapin, M.; Bécel, A.; Charvis, P.; Flueh, E.; Diaz, J.; Lebrun, J.-F.; Gesret, A.; Raffaele, R.; Galvé, A.; Evain, M.; Ruiz, M.; Kopp, H.; Bayrakci, G.; Weinzierl, W.; Hello, Y.; Lépine, J.-C.; Viodé, J.-P.; Sachpazi, M.; Gallart, J.; Kissling, E.; Nicolich, R.

2013-09-01

The 300-km-long north-central segment of the Lesser Antilles subduction zone, including Martinique and Guadeloupe islands has been the target of a specific approach to the seismic structure and activity by a cluster of active and passive offshore-onshore seismic experiments. The top of the subducting plate can be followed under the wide accretionary wedge by multichannel reflection seismics. This reveals the hidden updip limit of the contact of the upper plate crustal backstop onto the slab. Two OBS refraction seismic profiles from the volcanic arc throughout the forearc domain constrain a 26-km-large crustal thickness all along. In the common assumption that the upper plate Moho contact on the slab is a proxy of its downdip limit these new observations imply a three times larger width of the potential interplate seismogenic zone under the marine domain of the Caribbean plate with respect to a regular intra-oceanic subduction zone. Towards larger depth under the mantle corner, the top of the slab imaged from the conversions of teleseismic body-waves and the locations of earthquakes appears with kinks which increase the dip to 10-20° under the forearc domain, and then to 60° from 70 km depth. At 145 km depth under the volcanic arc just north of Martinique, the 2007 M 7.4 earthquake, largest for half a century in the region, allows to document a deep slab deformation consistent with segmentation into slab panels. In relation with this occurrence, an increased seismic activity over the whole depth range provides a new focussed image thanks to the OBS and land deployments. A double-planed dipping slab seismicity is thus now resolved, as originally discovered in Tohoku (NE Japan) and since in other subduction zones. Two other types of seismic activity uniquely observed in Tohoku, are now resolved here: "supraslab" earthquakes with normal-faulting focal mechanisms reliably located in the mantle corner and "deep flat-thrust" earthquakes at 45 km depth on the interplate fault under the Caribbean plate forearc mantle. None such types of seismicity should occur under the paradigm of a regular peridotitic mantle of the upper plate which is expected to be serpentinized by the fluids provided from the dehydrating slab beneath. This process is commonly considered as limiting the downward extent of the interplate coupling. Interpretations are not readily available either for the large crustal thickness of this shallow water marine upper plate, except when remarking its likeness to oceanic plateaus formed above hotspots. The Caribbean Oceanic Plateau of the upper plate has been formed earlier by the material advection from a mantle plume. It could then be underlain by a correspondingly modified, heterogeneous mantle, which may include pyroxenitic material among peridotites. Such heterogeneity in the mantle corner of the present subduction zone may account for the notable peculiarities in seismic structure and activity and impose regions of stick-slip behavior on the interplate among stable-gliding areas.

Seismic Attenuation of Teleseismic Body Waves in Cascadia, Measured on the Amphibious Array

NASA Astrophysics Data System (ADS)

Eilon, Z.; Abers, G. A.

2015-12-01

Fundamental questions remain about the nature of the asthenosphere, including its dynamical relationship to overlying lithosphere, melt content, and entrainment in subduction zones. We examine the evolution of this low-velocity, highly attenuating layer using data from the Cascadia Initiative's Amphibious Array, which provides unprecedented coverage of an oceanic plate from ridge crest to trench to sub-arc. Our study extends the suite of measurements achievable with OBS data, augmenting traditional travel time analysis with integrated attenuation data that are a powerful tool for imaging melt/fluids and the variation of asthenospheric character with age. Cooling models, coupled with experimentally-derived anelastic scaling relationships, indicate that thermal gradients should cause appreciable decrease in attenuation of teleseismic body waves with increasing age. This long-wavelength cooling trend may be perturbed by highly attenuating melt or volatiles concentrated at the ridge axis or beneath the Cascades arc, depending on melt fraction and pore geometry. Attenuation beyond the trench should be a strong function of the fate of asthenospheric entrainment beneath subducted plates, with implications for mass transfer to the deep mantle as well as recent models of sub-slab anisotropy. The Amphibious Array, with <70 km spacing of OBS and on-land broadband seismometers deployed between 2011 and 2015, provides a dataset of ~1 x 105 arrivals from ~700 Mw>6.0 teleseismic earthquakes. We use a spectral ratio method to compute differential attenuation (Δt*) from body wave teleseisms recorded at OBS and land stations, allowing us to estimate path-integrated quality factor in the upper mantle. Preliminary results reveal variations of ~3 s in differential travel time and >0.5 s in ΔtS* across the 0-10 Ma oceanic plate, demonstrating the strong thermal control on anelasticity. Large values of Δt* observed east of the trench may indicate entrainment of highly attenuating asthenosphere during subduction, although more work is required to categorize and remove the signal of the overriding plate. This work complements previous studies using surface waves and contributes to our developing understanding of anelastic controls on seismic parameters by probing the Earth in a different frequency range.

Sterculic Oil, a Natural SCD1 Inhibitor, Improves Glucose Tolerance in Obese ob/ob Mice

PubMed Central

Ortinau, Laura C.; Pickering, R. Taylor; Nickelson, Karen J.; Stromsdorfer, Kelly L.; Naik, Chaitasi Y.; Haynes, Rebecca A.; Bauman, Dale E.; Rector, R. Scott; Fritsche, Kevin L.; Perfield, James W.

2012-01-01

Obesity and its metabolic complications are associated with increased expression/activity of stearoyl-CoA desaturase-1 (SCD1), a major regulator of lipid metabolism. Reduction or ablation of this enzyme is associated with an improved metabolic profile and has gained attention as a target for pharmaceutical development. Sterculic oil (SO) is a known inhibitor of SCD1 and may provide a natural approach for treating obesity and/or insulin resistance. The purpose of this study was to evaluate the effects of SO consumption in leptin-deficient ob/ob mice, a model of obesity and insulin resistance. Five-week-old male mice received either an AIN-93G (control) or an AIN-93G diet containing 0.5% SO. After 9 weeks, SO supplementation did not alter food intake or body weight; however, the desaturase indices, a proxy of SCD1 activity, were reduced in liver and adipose tissue of SO-supplemented animals. This reduction was associated with improved glucose and insulin tolerance and attenuated hepatic inflammation in obese ob/ob mice, while no appreciable changes were observed in lean control mice receiving SO. Future studies are needed to better understand the mechanism(s) by which SO is functioning to improve glucose metabolism and to further explore the nutraceutical potential and health implications of SO supplementation. PMID:23209931

Association of obesity with healthcare utilization and costs in a Medicare population.

PubMed

Suehs, Brandon T; Kamble, Pravin; Huang, Joanna; Hammer, Mette; Bouchard, Jonathan; Costantino, Mary E; Renda, Andrew

2017-12-01

To examine the association of obesity with healthcare resource utilization and costs in a Medicare population. This study was a retrospective cohort study using Humana Medicare Advantage (MA) claims data. Body mass index (BMI) was assessed using ICD-9-CM status codes (V85 hierarchy) that have been validated in the data source to classify patients into BMI categories: normal (N), overweight (Ow), obese class I (ObI), obese class II (ObII), and obese class III (ObIII). Healthcare resource utilization (HRU) and costs were determined based on claims data. Descriptive statistics were used to examine baseline characteristics and HRU across BMI classes. Multivariable analysis was used to examine the association between BMI class and outcome measures. Among the 172,866 patients aged ≥65 years that were identified, BMI distribution was: N, 21%; Ow 37%; ObI, 24%, ObII, 10%; and ObIII, 9%. Inpatient, emergency department and outpatient utilization increased with greater BMI level, and greater BMI level was associated with higher total healthcare, medical and pharmacy costs. Greater prevalence of several cardiometabolic conditions, total medication use, and use of specific medication classes was observed with increasing BMI class. Greater BMI was associated with greater HRU and costs and observed increase in prevalence of cardiometabolic conditions. These results reflect an urgent need to address the epidemic of obesity and the resulting excessive clinical and economic burden on the healthcare system.

Systemic anti-TNFalpha treatment restores diabetes-impaired skin repair in ob/ob mice by inactivation of macrophages.

PubMed

Goren, Itamar; Müller, Elke; Schiefelbein, Dana; Christen, Urs; Pfeilschifter, Josef; Mühl, Heiko; Frank, Stefan

2007-09-01

To date, diabetes-associated skin ulcerations represent a therapeutic problem of clinical importance. The insulin-resistant type II diabetic phenotype is functionally connected to obesity in rodent models of metabolic syndrome through the release of inflammatory mediators from adipose tissue. Here, we used the impaired wound-healing process in obese/obese (ob/ob) mice to investigate the impact of obesity-mediated systemic inflammation on cutaneous wound-healing processes. Systemic administration of neutralizing monoclonal antibodies against tumor necrosis factor (TNF)alpha (V1q) or monocyte/macrophage-expressed EGF-like module-containing mucin-like hormone receptor-like (Emr)-1 (F4/80) into wounded ob/ob mice at the end of acute wound inflammation initiated a rapid and complete neo-epidermal coverage of impaired wound tissue in the presence of a persisting diabetic phenotype. Wound closure in antibody-treated mice was paralleled by a marked attenuation of wound inflammation. Remarkably, anti-TNFalpha- and anti-F4/80-treated mice exhibited a strong reduction in circulating monocytic cells and reduced numbers of viable macrophages at the wound site. Our data provide strong evidence that anti-TNFalpha therapy, widely used in chronic inflammatory diseases in humans, might also exert effects by targeting "activated" TNFalpha-expressing macrophage subsets, and that inactivation or depletion of misbehaving macrophages from impaired wounds might be a novel therapeutic clue to improve healing of skin ulcers.

Obesity alters immune and metabolic profiles: new insight from obese-resistant mice on high fat diet

PubMed Central

Boi, Shannon K.; Buchta, Claire M.; Pearson, Nicole A.; Francis, Meghan B.; Meyerholz, David K.; Grobe, Justin L.; Norian, Lyse A.

2016-01-01

Objective Diet-induced obesity has been shown to alter immune function in mice, but distinguishing the effects of obesity from changes in diet composition is complicated. We hypothesized that immunological differences would exist between diet-induced obese (DIO) and obese-resistant (OB-Res) mice fed the same high-fat diet (HFD). Methods BALB/c mice were fed either standard chow or HFD to generate lean or DIO and OB-Res mice, respectively. Resulting mice were analyzed for serum immunologic and metabolic profiles, and cellular immune parameters. Results BALB/c mice on HFD can be categorized as DIO or OB-Res, based on body weight versus lean controls. DIO mice are physiologically distinct from OB-Res mice, whose serum Insulin, Leptin, GIP, and Eotaxin concentrations remain similar to lean controls. DIO mice have increased macrophage+ crown-like structures in white adipose tissue, although macrophage percentages were unchanged from OB-Res and lean mice. DIO mice also have decreased splenic CD4+ T cells, elevated serum GM-CSF, and increased splenic CD11c+ dendritic cells, but impaired dendritic cell stimulatory capacity (p < 0.05 versus lean controls). These parameters were unaltered in OB-Res mice versus lean controls. Conclusions Diet-induced obesity results in alterations in immune and metabolic profiles that are distinct from effects caused by HFD alone. PMID:27515998

Obstetrician-gynecologists' knowledge and opinions about the United States Preventive Services Task Force (USPSTF) committee, the Women's Health Amendment, and the Affordable Care Act: national study after the release of the USPSTF 2009 Breast Cancer Screening Recommendation Statement.

PubMed

Anderson, Britta L; Urban, Renata R; Pearlman, Mark; Schulkin, Jay

2014-02-01

Investigate the knowledge and opinions of obstetrician and gynecologists (ob-gyns) regarding the USPSTF committee and statement, and to assess their reactions to healthcare legislation. A national cross-sectional survey study of ob-gyns was conducted six months after a controversial USPSTF recommendation statement was released in November 2009. Ob-gyns' opinions about the Women's Health Amendment (WHA) and the Affordable Care Act (ACA) were also assessed. A total of 54% of ob-gyns knew that the USPSTF recommendations do not represent the position of the U.S. government and 40% knew that the USPSTF is not comprised of federal employees. A majority (60%) thought that the USPSTF was influenced by potential costs more than guidelines should be. When examining ob-gyns opinions about new national health policies, 88% support the mammography coverage provided by the WHA but support for the ACA varied. This study provides a snapshot of ob-gyns' knowledge and opinions about the USPSTF and breast cancer screening guidelines at a controversial point in time. Our findings are a unique contribution to larger efforts to understand health and political policy as the culture of medicine continues to evolve. Copyright © 2013 Elsevier Inc. All rights reserved.

An allosteric antibody to the leptin receptor reduces body weight and reverses the diabetic phenotype in the Lep(ob) /Lep(ob) mouse.

PubMed

Bhaskar, Vinay; Goldfine, Ira D; Gerstner, Resi; Michelson, Kristen; Tran, Catarina; Nonet, Genevieve; Bohmann, David; Pongo, Elizabeth; Zhao, Jingsong; Horwitz, Arnold H; Takeuchi, Toshihiko; White, Mark; Corbin, John A

2016-08-01

Leptin (LEP) deficiency results in major metabolic perturbations, including obesity, dyslipidemia, and diabetes. Although LEP deficiency can be treated with daily injections of a recombinant LEP, generation of an antibody activating the LEP receptor (LEPR) that has both an intrinsically long half-life and low immunogenicity could be useful in the treatment of this condition. Phage display technology coupled with flow cytometry and cell-based in vitro assays were employed to identify an allosteric agonist of the mouse LEPR. LEP-deficient Lep(ob) /Lep(ob) mice were used to compare in vivo effects of LEP to antibody administration. To evaluate hypothalamic effects of treatment, changes in mRNA levels of neuropeptide Y and proopiomelanocortin were measured. XPA.80.037 is a monoclonal antibody that demonstrates allosteric agonism of the mouse LEPR. Treatment of Lep(ob) /Lep(ob) mice with XPA.80.037 markedly reduced hyperphagia and body weight, normalized blood glucose and plasma insulin levels, and corrected dyslipidemia. These metabolic alterations correlated with changes in mRNA levels of neuropeptide Y and proopiomelanocortin, suggesting that XPA.80.037 had hypothalamic effects. Agonist allosteric monoclonal antibodies to the LEPR can correct metabolic effects associated with LEP deficiency in vivo and thereby have the potential to treat conditions of LEP deficiency. © 2016 The Obesity Society.

Metformin Restores Parkin-Mediated Mitophagy, Suppressed by Cytosolic p53

PubMed Central

Song, Young Mi; Lee, Woo Kyung; Lee, Yong-ho; Kang, Eun Seok; Cha, Bong-Soo; Lee, Byung-Wan

2016-01-01

Metformin is known to alleviate hepatosteatosis by inducing 5’ adenosine monophosphate (AMP)-kinase-independent, sirtuin 1 (SIRT1)-mediated autophagy. Dysfunctional mitophagy in response to glucolipotoxicities might play an important role in hepatosteatosis. Here, we investigated the mechanism by which metformin induces mitophagy through restoration of the suppressed Parkin-mediated mitophagy. To this end, our ob/ob mice were divided into three groups: (1) ad libitum feeding of a standard chow diet; (2) intraperitoneal injections of metformin 300 mg/kg; and (3) 3 g/day caloric restriction (CR). HepG2 cells were treated with palmitate (PA) plus high glucose in the absence or presence of metformin. We detected enhanced mitophagy in ob/ob mice treated with metformin or CR, whereas mitochondrial spheroids were observed in mice fed ad libitum. Metabolically stressed ob/ob mice and PA-treated HepG2 cells showed an increase in expression of endoplasmic reticulum (ER) stress markers and cytosolic p53. Cytosolic p53 inhibited mitophagy by disturbing the mitochondrial translocation of Parkin, as demonstrated by immunoprecipitation. However, metformin decreased ER stress and p53 expression, resulting in induction of Parkin-mediated mitophagy. Furthermore, pifithrin-α, a specific inhibitor of p53, increased mitochondrial incorporation into autophagosomes. Taken together, these results indicate that metformin treatment facilitates Parkin-mediated mitophagy rather than mitochondrial spheroid formation by decreasing the inhibitory interaction with cytosolic p53 and increasing degradation of mitofusins. PMID:26784190