Lanzarotta, Adam; Lorenz, Lisa; Voelker, Sarah; Falconer, Travis M; Batson, JaCinta S
2018-05-01
This manuscript is a continuation of a recent study that described the use of fully integrated gas chromatography with direct deposition Fourier transform infrared detection and mass spectrometric detection (GC-FT-IR-MS) to identify and confirm the presence of sibutramine and AB-FUBINACA. The purpose of the current study was to employ the GC-FT-IR portion of the same instrument to quantify these compounds, thereby demonstrating the ability to identify, confirm, and quantify drug substances using a single GC-FT-IR-MS unit. The performance of the instrument was evaluated by comparing quantitative analytical figures of merit to those measured using an established, widely employed method for quantifying drug substances, high performance liquid chromatography with ultraviolet detection (HPLC-UV). The results demonstrated that GC-FT-IR was outperformed by HPLC-UV with regard to sensitivity, precision, and linear dynamic range (LDR). However, sibutramine and AB-FUBINACA concentrations measured using GC-FT-IR were not significantly different at the 95% confidence interval compared to those measured using HPLC-UV, which demonstrates promise for using GC-FT-IR as a semi-quantitative tool at the very least. The most significant advantage of GC-FT-IR compared to HPLC-UV is selectivity; a higher level of confidence regarding the identity of the analyte being quantified is achieved using GC-FT-IR. Additional advantages of using a single GC-FT-IR-MS instrument for identification, confirmation, and quantification are efficiency, increased sample throughput, decreased consumption of laboratory resources (solvents, chemicals, consumables, etc.), and thus cost.
Hirano, Yoshiaki; Tateno, Shinsuke; Maio, Ari; Ozaki, Yukihiro
2009-03-05
We have characterized the structure of J-aggregate in a Langmuir-Blodgett film of pure merocyanine dye (MS18) fabricated under an aqueous subphase containing a cadmium ion (Cd2+) and have investigated its thermal behavior by UV-visible and IR absorption spectroscopy in the range from 25 to 250 degrees C with a continuous scan. The results of both UV-visible and IR absorption spectra indicate that temperature-dependent changes in the MS18 aggregation state in the pure MS18 system are closely and mildly linked with the MS18 intramolecular charge transfer and the behavior of the packing, orientation, conformation, and thermal mobility of MS18 hydrocarbon chain, respectively. The J-aggregate in the pure MS18 system dissociates from 25 to 150 degrees C, and the dissociation temperature at 150 degrees C is higher by 50 degrees C than that in the previous MS18- arachidic acid (C20) binary system. The lower dissociation temperature in the binary system originates from the fact that temperature-dependent structural disorder of cadmium arachidate (CdC20), being phase-separated from MS18, has an influence on the dissociation of J-aggregate. From 160 to 180 degrees C, thermally induced blue-shifted bands, caused by the oligomeric MS18 aggregation, appear at around 520 nm in the pure MS18 system by contraries, regardless of the lack of driving force by the melting phenomenon of CdC20. The temperature at which the 520 nm bands occur is in good agreement with the melting point (160 degrees C) of hydrocarbon chain in MS18 with Cd2+, whereas its chromophore part is clearly observed to melt near 205 degrees C by UV-visible spectra. Therefore, it is suggested that the driving force that induces the 520 nm band in the pure MS18 system arises from the partial melting of hydrocarbon chain in MS18 with Cd2+.
Hirano, Yoshiaki; Tateno, Shinsuke; Yamashita, Yoshihide; Ozaki, Yukihiro
2008-11-13
We have investigated the thermal behavior of H-aggregate in a mixed Langmuir-Blodgett (LB) film of the merocyanine dye (MS18)-arachidic acid (C20)- n-octadecane (AL18) ternary system by means of UV-visible and IR absorption spectroscopy in the range from 25 to 250 degrees C with a continuous scan. The results of both UV-visible and IR spectra indicate that the temperature-dependent variation in MS 18 aggregation state is linked not only with the degree of intramolecular charge transfer and the behavior of packing, orientation, conformation, and thermal mobility of the MS18 hydrocarbon chain but also with the presence and absence of AL18. The H-aggregate dissociates from 25 up to 50 degrees C, which is caused by the AL18 evaporation from the mixed LB film and the increment of thermal mobility of the MS18 hydrocarbon chain. From 110 to 160 degrees C, blue-shifted bands, attributed to the oligomeric MS18 aggregation, appear near 515 nm in the MS18-C 20-AL18 ternary system as well. The temperature at which the 515 nm band occurs is identical for both present ternary system and previously investigated MS18-deuterated arachidic acid (C20- d) binary system, and it is in good agreement with the melting point (110 degrees C) of cadmium arachidate (CdC20). Therefore, it is indicated that the driving force which induces the 515 nm band comes from the melting phenomenon of CdC20 molecules which are phase-separated from MS 18 molecules in as-deposited LB films.
A Comparison of Analytical and Data Preprocessing Methods for Spectral Fingerprinting
LUTHRIA, DEVANAND L.; MUKHOPADHYAY, SUDARSAN; LIN, LONG-ZE; HARNLY, JAMES M.
2013-01-01
Spectral fingerprinting, as a method of discriminating between plant cultivars and growing treatments for a common set of broccoli samples, was compared for six analytical instruments. Spectra were acquired for finely powdered solid samples using Fourier transform infrared (FT-IR) and Fourier transform near-infrared (NIR) spectrometry. Spectra were also acquired for unfractionated aqueous methanol extracts of the powders using molecular absorption in the ultraviolet (UV) and visible (VIS) regions and mass spectrometry with negative (MS−) and positive (MS+) ionization. The spectra were analyzed using nested one-way analysis of variance (ANOVA) and principal component analysis (PCA) to statistically evaluate the quality of discrimination. All six methods showed statistically significant differences between the cultivars and treatments. The significance of the statistical tests was improved by the judicious selection of spectral regions (IR and NIR), masses (MS+ and MS−), and derivatives (IR, NIR, UV, and VIS). PMID:21352644
Results of TLE and TGF Observation in RELEC Experiment onboard "Vernov" Mission
NASA Astrophysics Data System (ADS)
Klimov, Pavel; Garipov, Gali; Klimov, Stanislav; Rothkaehl, Hanna; Khrenov, Boris; Pozanenko, Alexei; Morozenko, Violetta; Iyudin, Anatoly; Bogomolov, Vitalij V.; Svertilov, Sergey; Panasyuk, Mikhail; Saleev, Kirill; Kaznacheeva, Margarita; Maximov, Ivan
2016-07-01
"Vernov" satellite with RELEC experiment onboard was launched on 2014 July, 8 into a polar solar-synchronous orbit. The payload includes DUV ultraviolet and red photometer and DRGE gamma-ray spectrometer providing measurements in 10-3000 keV energy range with four detectors. Both instruments directed to the atmosphere. Total area of DRGE detectors is ˜500 cm ^{2}. The data were recorded both in monitoring and gamma by gamma modes with timing accuracy ˜15 μs. Several TGF candidates with 10-40 gammas in a burst with duration <1 ms were detected. Analysis of data from other instruments on-board "Vernov" satellite shows the absence of significant electromagnetic pulses around correspondent time moments. Comparison with a world wide lightning location network (WWLLN) data base also indicates that there were no thunderstorms connected with most of detected TGF candidates. Possible connection of TGF candidates with electron precipitations is discussed. Observations of transient luminous events (TLEs) were made in UV (240-400 nm) and IR (>610 nm) wavelength bands. More than 8 thousands of flashes with duration between 1 and 128 ms were detected from the atmosphere. Time profiles of detected flashes are very diverse. There are single peak events with significant UV and IR signal, multi-peak structures visible in the both UV and IR channels and very complicated events mixed from UV and IR signals and UV flashes which can continue even during the whole waveform. In addition, there are flashes of various temporal duration and structure measured only in UV wavelength range. Number of UV photons released in the atmosphere varies in a wide range from 10 ^{20} to 10 ^{26}. Apart from the events detected in the thunderstorm regions over the continents, many flashes were observed outside of thunderstorm areas, above the ocean and even at rather high latitudes. Such events are not associated with the thunderstorm and lightning activity measured by WWLLN. Various types of UV and IR flashes measurements and their interpretation, geographical, energy and spectral distribution are presented and discussed.
Yang, Yuan-Gui; Zhang, Ji; Zhao, Yan-Li; Zhang, Jin-Yu; Wang, Yuan-Zhong
2017-07-01
A rapid method was developed and validated by ultra-performance liquid chromatography-triple quadrupole mass spectroscopy with ultraviolet detection (UPLC-UV-MS) for simultaneous determination of paris saponin I, paris saponin II, paris saponin VI and paris saponin VII. Partial least squares discriminant analysis (PLS-DA) based on UPLC and Fourier transform infrared (FT-IR) spectroscopy was employed to evaluate Paris polyphylla var. yunnanensis (PPY) at different harvesting times. Quantitative determination implied that the various contents of bioactive compounds with different harvesting times may lead to different pharmacological effects; the average content of total saponins for PPY harvested at 8 years was higher than that from other samples. The PLS-DA of FT-IR spectra had a better performance than that of UPLC for discrimination of PPY from different harvesting times. Copyright © 2016 John Wiley & Sons, Ltd.
Fragmentation mechanism of UV-excited peptides in the gas phase
DOE Office of Scientific and Technical Information (OSTI.GOV)
Zabuga, Aleksandra V., E-mail: aleksandra.zabuga@epfl.ch; Kamrath, Michael Z.; Boyarkin, Oleg V.
We present evidence that following near-UV excitation, protonated tyrosine- or phenylalanine–containing peptides undergo intersystem crossing to produce a triplet species. This pathway competes with direct dissociation from the excited electronic state and with dissociation from the electronic ground state subsequent to internal conversion. We employ UV-IR double-resonance photofragment spectroscopy to record conformer-specific vibrational spectra of cold peptides pre-excited to their S{sub 1} electronic state. The absorption of tunable IR light by these electronically excited peptides leads to a drastic increase in fragmentation, selectively enhancing the loss of neutral phenylalanine or tyrosine side-chain, which are not the lowest dissociation channels inmore » the ground electronic state. The recorded IR spectra evolve upon increasing the time delay between the UV and IR pulses, reflecting the dynamics of the intersystem crossing on a timescale of ∼80 ns and <10 ns for phenylalanine- and tyrosine-containing peptides, respectively. Once in the triplet state, phenylalanine-containing peptides may live for more than 100 ms, unless they absorb IR photons and undergo dissociation by the loss of an aromatic side-chain. We discuss the mechanism of this fragmentation channel and its possible implications for photofragment spectroscopy and peptide photostability.« less
First identification and quantification of lorcaserin in an herbal slimming dietary supplement.
Hachem, Rabab; Malet-Martino, Myriam; Gilard, Véronique
2014-09-01
The weight-loss drug lorcaserin, a FDA approved anorectic drug, was isolated from the dietary supplement "Lose quickly" claimed to be a pure natural fast slimming diet pill. After its purification by means of preparative liquid chromatography, its structure was characterized using LC-UV, NMR, MS, MS/MS, and IR spectroscopy. The amount of lorcaserin measured by qNMR was 6.6mg/capsule. Copyright © 2014 Elsevier B.V. All rights reserved.
Mesospheric circulation at the cloud top level of Venus according to Venus Monitoring Camera images
NASA Astrophysics Data System (ADS)
Khatuntsev, Igor; Patsaeva, Marina; Ignatiev, Nikolay; Titov, Dmitri; Markiewicz, Wojciech; Turin, Alexander
We present results of wind speed measurements at the cloud top level of Venus derived from manual cloud tracking in the UV (365 nm) and IR (965 nm) channels of the Venus Monitoring Camera Experiment (VMC) [1] on board the Venus Express mission. Cloud details have a maximal contrast in the UV range. More then 90 orbits have been processed. 30000 manual vectors were obtained. The period of the observations covers more than 4 venusian year. Zonal wind speed demonstrates the local solar time dependence. Possible diurnal and semidiurnal components are observed [2]. According to averaged latitude profile of winds at level of the upper clouds: -The zonal speed is slightly increasing by absolute values from 90 on the equator to 105 m/s at latitudes —47 degrees; -The period of zonal rotation has the maximum at the equator (5 earth days). It has the minimum (3 days) at altitudes —50 degrees. After minimum periods are slightly increasing toward the South pole; -The meridional speed has a value 0 on the equator, and then it is linear increasing up to 10 m/s (by absolute value) at 50 degrees latitude. "-" denotes movement from the equator to the pole. -From 50 to 80 degrees the meridional speed is again decreasing by absolute value up to 0. IR (965+10 nm) day side images can be used for wind tracking. The obtained speed of the zonal wind in the low and middle latitudes are systematically less than the wind speed derived from the UV images. The average zonal speed obtained from IR day side images in the low and average latitudes is about 65-70 m/s. The given fact can be interpreted as observation of deeper layers of mesosphere in the IR range in comparison with UV. References [1] Markiewicz W. J. et al. (2007) Planet. Space Set V55(12). P.1701-1711. [2] Moissl R., et al. (2008) J. Geophys. Res. 2008. doi:10.1029/2008JE003117. V.113.
Three new alkaloids from the fruits of Morus alba.
Wang, Xin; Kang, Jie; Wang, Hong-Qing; Liu, Chao; Li, Bao-Ming; Chen, Ruo-Yun
2014-01-01
From the fruits of Morus alba, three new alkaloids, mulbaines A (1), B (2), and C (3) were isolated. The structures of these compounds were elucidated on the basis of spectroscopic methods (UV, IR, HR-ESI-MS, 1D, and 2D NMR).
Zhang, Chao-Zhi; Li, Ting; Yuan, Yang; Xu, Jianqiang
2016-06-01
Graphene and graphene oxide (GO) have already existed in air, water and soil due to their popular application in functional materials. However, degradation of graphene and GO in wastewater has not been reported. Degradation of GO plays a key role in the elimination of graphene and GO in wastewater due to graphene being easily oxidized to GO. In this paper, GO was completely degraded to give CO2 by Photo-Fenton. The degradation intermediates were determined by UV-vis absorption spectra, elemental analysis (EA), fourier transform infrared (FT-IR) and liquid chromatography-mass spectrometry (LC-MS). Experimental results showed that graphene oxide was completely degraded to give CO2 after 28 days. Based on UV, FT-IR, LC-MS spectra and EA data of these degradation intermediates, the degradation mechanisms of GO were supposed. This paper suggests an efficient and environment-friendly method to degrade GO and graphene. Copyright © 2016 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Halim, Mohammad A.; Girod, Marion; MacAleese, Luke; Lemoine, Jérôme; Antoine, Rodolphe; Dugourd, Philippe
2016-09-01
Herein we report the successful implementation of the consecutive and simultaneous photodissociation with high (213 nm) and low (10.6 μm) energy photons (HiLoPD, high-low photodissociation) on ubiquitin in a quadrupole-Orbitrap mass spectrometer. Absorption of high-energy UV photon is dispersed over the whole protein and stimulates extensive C-Cα backbone fragmentation, whereas low-energy IR photon gradually increases the internal energy and thus preferentially dissociates the most labile amide (C-N) bonds. We noticed that simultaneous irradiation of UV and IR lasers on intact ubiquitin in a single MS/MS experiment provides a rich and well-balanced fragmentation array of a/x, b/y, and z ions. Moreover, secondary fragmentation from a/x and z ions leads to the formation of satellite side-chain ions (d, v, and w) and can help to distinguish isomeric residues in a protein. Implementation of high-low photodissociation in a high-resolution mass spectrometer may offer considerable benefits to promote a comprehensive portrait of protein characterization.
Toxicological Assessment and UV/TiO2-Based Induced Degradation Profile of Reactive Black 5 Dye
NASA Astrophysics Data System (ADS)
Bilal, Muhammad; Rasheed, Tahir; Iqbal, Hafiz M. N.; Hu, Hongbo; Wang, Wei; Zhang, Xuehong
2018-01-01
In this study, the toxicological and degradation profile of Reactive Black 5 (RB5) dye was evaluated using a UV/TiO2-based degradation system. Fourier transform infrared spectroscopy (FT-IR), thin layer chromatography (TLC), high-performance liquid chromatography (HPLC) and ultra-performance liquid chromatography coupled with mass spectrometry (UPLC-MS) techniques were used to evaluate the degradation level of RB5. The UV-Vis spectral analysis revealed the disappearance of peak intensity at 599 nm (λmax). The FT-IR spectrum of UV/TiO2 treated dye sample manifest appearance of new peaks mainly because of the degraded product and/or disappearance of some characteristics peaks which were present in the untreated spectrum. The HPLC profile verified the RB5 degradation subject to the formation of metabolites at different retention times. A stable color removal higher than 96% with COD removal in the range of 74-82.3% was noted at all evaluated dye concentrations. The tentative degradation pathway of RB5 is proposed following a careful analysis of the intermediates identified by UPLC-MS. Toxicity profile of untreated and degraded dye samples was monitored using three types of human cell lines via MTT assay and acute toxicity testing with Artemia salina. In conclusion, the UV/TiO2-based degradation system could be effectively employed for the remediation of textile wastewater comprising a high concentration of reactive dyes.
Two new compounds from Helichrysum arenarium (L.).
Zhang, Yu-Wei; Sun, Wu-Xing; Li, Xian; Zhao, Chun-Chao; Meng, Da-Li; Li, Ning
2009-01-01
Two new compounds were isolated from the whole plant of Helichrysum arenarium (L.) Moench. By means of spectroscopic data (IR, UV, 1D and 2D NMR, HR-MS, ESI-MS, and NOESY) and chemical evidence, the structures were established as 6,7-dimethoxy-4-hydroxy-1-naphthoic acid (1) and (Z)-5-hydroxy-7-methoxy-4-[3-methyl-4-(O-beta-D-xylopyranosyl)but-2-enyl]isobenzofuran-1(3H)-one (2).
iSpec: A Web-Based Activity for Spectroscopy Teaching
ERIC Educational Resources Information Center
Vosegaard, Thomas
2018-01-01
Students' skills in structure elucidation of organic molecules are developed by training them to understand advanced spectroscopic measurements and elucidate structures of small organic molecules from mass spectrometry (MS) and infrared (IR), ultraviolet (UV), and [superscript 1]H and [superscript 13]C nuclear magnetic resonance (NMR)…
Three new norsesquiterpenoids from the seeds of Alpinia galanga.
Bian, Meng-Qin; Kang, Jie; Wang, Hong-Qing; Zhang, Qing-Jian; Liu, Chao; Chen, Ruo-Yun
2014-01-01
From the seeds of Alpinia galanga Willd., three new norsesquiterpenoid racemic mixtures, galanols A-C (1-3) were isolated, along with three known sesquiterpenoids (4-6). Their structures were elucidated by means of UV, IR, HR-ESI-MS, 1D NMR and 2D NMR spectroscopic data.
Cloud level winds from UV and IR images obtained by VMC onboard Venus Express
NASA Astrophysics Data System (ADS)
Khatuntsev, Igor; Patsaeva, Marina; Titov, Dmitri; Ignatiev, Nikolay; Turin, Alexander; Bertaux, Jean-Loup
2017-04-01
During eight years Venus Monitoring Camera (VMC) [1] onboard the Venus Express orbiter has observed the upper cloud layer of Venus. The largest set of images was obtained in the UV (365 nm), visible (513 nm) and two infrared channels - 965 nm and 1010 nm. The UV dayside images were used to study the atmospheric circulation at the Venus cloud tops [2], [3]. Mean zonal and meridional profiles of winds and their variability were derived from cloud tracking of UV images. In low latitudes the mean retrograde zonal wind at the cloud top (67±2 km) is about 95 m/s with a maximum of about 102 m/s at 40-50°S. Poleward from 50°S the zonal wind quickly fades out with latitude. The mean poleward meridional wind slowly increases from zero value at the equator to about 10 m/s at 50°S. Poleward from this latitude, the absolute value of the meridional component monotonically decreases to zero at the pole. The VMC observations suggest clear diurnal signature in the wind field. They also indicate a long term trend for the zonal wind speed at low latitudes to increase from 85 m/s in the beginning of the mission to 110 m/s by the middle of 2012. The trend was explained by influence of the surface topography on the zonal flow [4]. Cloud features tracking in the IR images provided information about winds in the middle cloud deck (55±4 km). In the low and middle latitudes (5-65°S) the IR mean retrograde zonal velocity is about 68-70 m/s. In contrast to poleward flow at the cloud tops, equatorward motions dominate in the middle cloud with maximum speed of 5.8±1.2 m/s at latitude 15°S. The meridional speed slowly decreases to 0 at 65-70°S. At low latitudes the zonal and meridional speed demonstrate long term variations. Following [4] we explain the observed long term trend of zonal and meridional components by the influence of surface topography of highland region Aphrodite Terra on dynamic processes in the middle cloud deck through gravity waves. Acknowledgements: I.V. Khatuntsev, M.V. Patsaeva, N.I. Ignatiev, J.-L. Bertaux were supported by the Ministry of Education and Science of Russian Federation grant 14.W03.31.0017. References: [1] Markiewicz W. J. et al.: Venus Monitoring Camera for Venus Express // Planet. Space Sci., 55(12), 1701-1711. doi:10.1016/j.pss.2007.01.004, 2007. [2] Khatuntsev I.V. et al.: Cloud level winds from the Venus Express Monitoring Camera imaging // Icarus, 226, 140-158. 2013. [3] Patsaeva M.V. et al.: The relationship between mesoscale circulation and cloud morphology at the upper cloud level of Venus from VMC/Venus Express // Planet. Space Sci., 113(08), 100-108, doi:10.1016/j.pss.2015.01.013, 2015. [4] Bertaux J.-L. et al.: Influence of Venus topography on the zonal wind and UV albedo at cloud top level: The role of stationary gravity waves // J. Geophys. Res. Planets, 121, 1087-1101, doi:10.1002/2015JE004958, 2016.
Multi-Wavelength Laser Transmitter for the Two-Step Laser Time-of-Flight Mass Spectrometer
NASA Technical Reports Server (NTRS)
Yu, Anthony W.; Li, Steven X.; Fahey, Molly E.; Grubisic, Andrej; Farcy, Benjamin J.; Uckert, Kyle; Li, Xiang; Getty, Stephanie
2017-01-01
Missions to diverse Outer Solar System bodies will require investigations that can detect a wide range of organics in complex mixtures, determine the structure of selected molecules, and provide powerful insights into their origin and evolution. Previous studies from remote spectroscopy of the Outer Solar System showed a diverse population of macromolecular species that are likely to include aromatic and conjugated hydrocarbons with varying degrees of methylation and nitrile incorporation. In situ exploration of Titan's upper atmosphere via mass and plasma spectrometry has revealed a complex mixture of organics. Similar material is expected on the Ice Giants, their moons, and other Outer Solar System bodies, where it may subsequently be deposited onto surface ices. It is evident that the detection of organics on other planetary surfaces provides insight into the chemical and geological evolution of a Solar System body of interest and can inform our understanding of its potential habitability. We have developed a prototype two-step laser desorption/ionization time-of-flight mass spectrometer (L2MS) instrument by exploiting the resonance-enhanced desorption of analyte. We have successfully demonstrated the ability of the L2MS to detect hydrocarbons in organically-doped analog minerals, including cryogenic Ocean World-relevant ices and mixtures. The L2MS instrument operates by generating a neutral plume of desorbed analyte with an IR desorption laser pulse, followed at a delay by a ultraviolet (UV) laser pulse, ionizing the plume. Desorption of the analyte, including trace organic species, may be enhanced by selecting the wavelength of the IR desorption laser to coincide with IR absorption features associated with vibration transitions of minerals or organic functional groups. In this effort, a preliminary laser developed for the instrument uses a breadboard mid-infrared (MIR) desorption laser operating at a discrete 3.475 µm wavelength, and a breadboard UV ionization laser operating at a wavelength of 266 nm. The MIR wavelength was selected to overlap the C-H stretch vibrational transition of certain aromatic hydrocarbons, and the UV wavelength provides additional selectivity to aromatic species via UV resonance-enhanced multiphoton ionization effects. The use of distinct laser wavelengths allows efficient coupling to the vibrational and electronic spectra of the analyte in independent desorption and ionization steps, mitigating excess energy that can lead to fragmentation during the ionization process and leading to selectivity that can aid in data interpretation.
Fire Protection System for Hardened Aircraft Shelters. Volume 1. Discussion and Appendixes A-C
1987-10-01
in any configuration, for exanple IR, lR-lR, UV -IR, UV , UV -IR- UV . The advantage of multiwavelength detectors is a reduced likelihood of false alarm. B...11late is ,ai led the work function if the metal. Th, operating envelope of a UV detector is . function u (i) the Inc-tal used fir the cathode, and Ŗ...second or two longer. E. DI1AL-CHANNEL UV /IR JETIT .OIRS iiarmy false alar.m sources for UV and IR detectors are mutally exclusive. Th -. has led to the
Three new metabolites from Botrytis cinerea.
Wang, Tian-Shan; Zhou, Jin-Yan; Tan, Hong
2008-01-01
Three new metabolites, gamma-abscisolactone (1), botrytisic acids A (3) and B (4) were isolated from the fermentation broth of Botrytis cinerea TB-3-H8. Their structures were elucidated on the basis of MS, IR, UV, and NMR spectroscopic data. Compound 2 was isolated from natural resource for the first time. The structure of 1 was further confirmed by single-crystal X-ray diffraction (CCDC-265897).
DNA damage and repair in plants under ultraviolet and ionizing radiations.
Gill, Sarvajeet S; Anjum, Naser A; Gill, Ritu; Jha, Manoranjan; Tuteja, Narendra
2015-01-01
Being sessile, plants are continuously exposed to DNA-damaging agents present in the environment such as ultraviolet (UV) and ionizing radiations (IR). Sunlight acts as an energy source for photosynthetic plants; hence, avoidance of UV radiations (namely, UV-A, 315-400 nm; UV-B, 280-315 nm; and UV-C, <280 nm) is unpreventable. DNA in particular strongly absorbs UV-B; therefore, it is the most important target for UV-B induced damage. On the other hand, IR causes water radiolysis, which generates highly reactive hydroxyl radicals (OH(•)) and causes radiogenic damage to important cellular components. However, to maintain genomic integrity under UV/IR exposure, plants make use of several DNA repair mechanisms. In the light of recent breakthrough, the current minireview (a) introduces UV/IR and overviews UV/IR-mediated DNA damage products and (b) critically discusses the biochemistry and genetics of major pathways responsible for the repair of UV/IR-accrued DNA damage. The outcome of the discussion may be helpful in devising future research in the current context.
Ardiana, Febry; Suciati; Indrayanto, Gunawan
2015-01-01
Valsartan is an antihypertensive drug which selectively inhibits angiotensin receptor type II. Generally, valsartan is available as film-coated tablets. This review summarizes thermal analysis, spectroscopy characteristics (UV, IR, MS, and NMR), polymorphism forms, impurities, and related compounds of valsartan. The methods of analysis of valsartan in pharmaceutical dosage forms and in biological fluids using spectrophotometer, CE, TLC, and HPLC methods are discussed in details. Both official and nonofficial methods are described. It is recommended to use LC-MS method for analyzing valsartan in complex matrices such as biological fluids and herbal preparations; in this case, MRM is preferred than SIM method. © 2015 Elsevier Inc. All rights reserved.
Wang, Dandan; Wang, Jian; Huang, Xuehui; Tu, Ying; Ni, Kunyi
2007-05-09
Polymethoxylated flavones (PMFs) were extracted from Pericarpium Citri Reticulatae Viride using a procedure that obtained a consistent mixture of PMFs both in identity and proportion. The mixture consisted of isosinensetin (0.2%) (1), sinensetin (1.7%) (4), tetramethyl-o-isoscutellarein (0.3%) (5), nobiletin (40.5%) (6), tetramethyl-o-scutellarein (1.2%) (7), tangeretin (45.6%) (10), 5-demethylnobiletin (8.7%) (12), 5-demethyl tangeretin (0.8%) (14) and other flavonoids including heptamethoxyflavone (1.0%) (9), among which, compounds 1, 4, 5, 7 and 9 were identified based on their UV spectra, MS data and elution order described in the literature while compounds 6, 10, 12 and 14 were isolated and identified by UV, IR, MS, (1)H NMR, (13)C NMR and 2D NMR spectral studies. In addition, compound 14 was isolated and identified for the first time from Citrus.
ASR - 21/22 Four Point Moor Anchor Windlass Design Review
1974-01-01
IS ccK5i!>f?nio . nHviT DURXKC TMü R(: r-;:;:v;.. IW(KA< • ir.’.< L’,. . •... i rr :;... ;..■- s: ;’\\-r 3uv . 3 10 PRCUAtuas LlftlHC...pMS303> TELc MITOyON >?;f--351 .:•> N’t». Re iANIESSK« NAySSC COJc hlbli* TCLo AUTflVO^ 296-1 liv^... •..JO NA. tD
Chen, Xian-Qiang; Chen, Ling-Xiao; Li, Shao-Ping; Zhao, Jing
2017-12-01
One new expoxy nortriterpenoid (1) and one new ergostane-type steroid (2), together with seven known steroids (3-9), were obtained from the fruiting bodies of the fungus Ganoderma resinaceum. The new compounds were elucidated on the basis of extensive spectroscopic data (MS, NMR, IR, and UV) and the known compounds were identified by comparing spectroscopic data with those reported in literature.
Shimamine, M; Takahashi, K; Nakahara, Y
1992-01-01
The Reference Standards for amfepramone, cathinone, N-ethylamphetamine, fenethylline, fenproporex and mefenorex were prepared. Their purities determined by HPLC were more than 99.5%. For the identification and determination of these six drugs, their analytical data were measured and discussed by TLC, UV, IR, HPLC, GC/MS and NMR.
DNA Damage and Repair in Plants under Ultraviolet and Ionizing Radiations
Gill, Sarvajeet S.; Gill, Ritu; Jha, Manoranjan; Tuteja, Narendra
2015-01-01
Being sessile, plants are continuously exposed to DNA-damaging agents present in the environment such as ultraviolet (UV) and ionizing radiations (IR). Sunlight acts as an energy source for photosynthetic plants; hence, avoidance of UV radiations (namely, UV-A, 315–400 nm; UV-B, 280–315 nm; and UV-C, <280 nm) is unpreventable. DNA in particular strongly absorbs UV-B; therefore, it is the most important target for UV-B induced damage. On the other hand, IR causes water radiolysis, which generates highly reactive hydroxyl radicals (OH•) and causes radiogenic damage to important cellular components. However, to maintain genomic integrity under UV/IR exposure, plants make use of several DNA repair mechanisms. In the light of recent breakthrough, the current minireview (a) introduces UV/IR and overviews UV/IR-mediated DNA damage products and (b) critically discusses the biochemistry and genetics of major pathways responsible for the repair of UV/IR-accrued DNA damage. The outcome of the discussion may be helpful in devising future research in the current context. PMID:25729769
Degradation Analysis of NBR and Epichlorohydrin Rubber by New Micro Analysis Method
NASA Astrophysics Data System (ADS)
Katoh, Hisao; Kamoto, Ritsu; Murata, Jun
The degradation analysis of NBR and Epichlorohydrin rubber was carried out by infrared micro spectroscopy (μ-IR) and micro sampling mass spectrometry (μ-MS) which gives information on the scission and crosslinking of rubber molecules. Samples were prepared by three different treatments, heat as well as ultra violet (UV) and electron beam (EB) irradiations. It was found for NBR vulcanizates that the heat treatment induced the oxidation, scission and crosslinking of rubber molecules. By the UV treatment, chain scission and crosslinking accompanied by a slight oxidation were induced. The EB treatment enhanced the crosslinking, however, the extent of oxidation was negligible. For Epichlorohydrin rubber vulcanizates, the heat treatment accelerated chain scission rather than crosslinking. On the other hand, the oxidation and crosslinking were induced by the UV and EB treatments.
VizieR Online Data Catalog: WD+dMs from the SUPERBLINK proper motion survey (Skinner+, 2017)
NASA Astrophysics Data System (ADS)
Skinner, J. N.; Morgan, D. P.; West, A. A.; Lepine, S.; Thorstensen, J. R.
2018-06-01
To select for nearby WD+dMs, we used the SUPERBLINK proper motion survey (Lepine et al. 2002, J/AJ/124/1190; Lepine & Shara 2005, Cat. I/298), an ongoing all-sky survey that identifies and characterizes stars with proper motions μ>40 mas/yr. For this study, we used the 2011 July version of SUPERBLINK, which listed 2270481 stars, and was estimated to be >90% complete to V=19.0. We selected WD+dMs based on a combination of V magnitudes derived from the DSS plates (see Lepine & Shara 2005, Cat. I/298), near-UV magnitudes from GALEX, and Ks magnitudes from 2MASS. Using the UV-optical-IR color selection outlined in Skinner et al. (2014AJ....148..115S), we selected targets for spectroscopic follow-up (see bottom panel of Figure 1). We acquired optical spectroscopy of 178 newly identified WD+dM candidates, with the Boller and Chivens CCD spectrograph (CCDS), using both the Hiltner 2.4 m and McGraw-Hill 1.3 m telescopes located at the MDM Observatory. (3 data files).
Five New Alkaloids from the Roots of Sophora flavescens.
Zhang, Sheng-Yuan; Li, Wen; Nie, Hua; Liao, Mei; Qiu, Bo; Yang, Ya-Li; Chen, Yan-Fen
2018-03-01
Five new quinolizidine alkaloids, including three sparteine-type alkaloids (1 - 3) and two cytisine-type alkaloids (4 and 5), along with four known ones, were isolated from the roots of Sophora flavescens. Their structures were determined by extensive spectroscopic techniques including IR, UV, NMR, and HR-ESI-MS. All the compounds were evaluated for their antibacterial activities against Staphylococcus aureus and Escherichia coli. © 2018 Wiley-VHCA AG, Zurich, Switzerland.
UV absorbers for cellulosic apparels: A computational and experimental study
NASA Astrophysics Data System (ADS)
Sahar, Anum; Ali, Shaukat; Hussain, Tanveer; Irfan, Muhammad; Eliasson, Bertil; Iqbal, Javed
2018-01-01
Two triazine based Ultra Violet (UV) absorbers Sulfuric acid mono-(2-{4-[4-chloro-6-(4-{4-chloro-6-[4-(2-sulfooxy-ethanesulfonyl)-phenylamino]-[1,3,5] triazin-2-ylamino-phenylamino)-[1,3,5]triazin-2-ylamino]-benzenesulfonyl}-ethyl) ester (1a) and 4-{4-chloro-6-[4-(2-sulfooxy-ethanesulfonyl)-phenylamino]-[1,3,5] triazin-2-ylamino}-2-[4-chloro-6-(2-sulfooxy-ethanesulfonyl)-[1,3,5]triazin-2-ylamino]-benzenesulfonic acid (2a) with different substituents were designed computationally. The influence of different substituents on the electrochemical properties and UV spectra of the absorbers was investigated. The presence of electron deficient unit in 1a to the molecular core significantly reduces the LUMO levels and energy gap. The designed absorbers were synthesized via condensation reaction and characterized by UV-Vis, FT-IR, MS studies. The performance of synthesized compounds as UV absorbers and their fastness properties were assessed by finishing the cotton fabric through exhaust method at different concentration and results appeared in good range.
NASA Astrophysics Data System (ADS)
Vijayachamundeeswari, S. P.; Yagna Narayana, B.; Jone Pradeepa, S.; Sundaraganesan, N.
2015-11-01
Trimethadione (TMD) is an anticonvulsant drug widely used against absences seizures. We have characterised the TMD by various spectra including UV-VIS, IR, Raman, GC-MS and NMR. In this work, we made use of Density Functional Theory (DFT) B3LYP method with 6-31G (d, p) basis set, to calculate the molecular structure of TMD, and predicted its infrared, Raman and ultraviolet spectra for the first time. FT-IR and FT-Raman spectra were recorded in the region 4000-400 cm-1 and 3500-50 cm-1, respectively. The vibrational frequencies were calculated and scaled values were compared with the experimental FT-IR and FT-Raman spectra. The observed and calculated frequencies are found to be in good agreement. The complete assignments were performed on the basis of the total energy distribution (TED) of the vibrational modes. The optimized geometry parameters were calculated. NMR chemical shifts of the molecule were calculated using the gauge independent atomic orbital (GIAO) method. The predicted first hyperpolarizibility also shows that the molecule might have convincingly good nonlinear optical (NLO) activities. The calculated HOMO-LUMO energy gap discloses that charge transfer occurs within the molecule.
Synthesis, characterization, and pharmacological studies of ferrocene-1H-1,2,3-triazole hybrids
NASA Astrophysics Data System (ADS)
Haque, Ashanul; Hsieh, Ming-Fa; Hassan, Syed Imran; Haque Faizi, Md. Serajul; Saha, Anannya; Dege, Necmi; Rather, Jahangir Ahmad; Khan, Muhammad S.
2017-10-01
A series of ferrocene-1H-1,2,3-triazole hybrids namely 1-(4-nitrophenyl)-4-ferrocenyl-1H-1,2,3-triazole (1), 1-(4,4‧-dinitro-2-biphenyl)-4-ferrocenyl-1H-1,2,3-triazole (2), 1-(3-chloro-4-fluorophenyl)-4-ferrocenyl-1H-1,2,3-triazole (3), 1-(4-bromophenyl)-4-ferrocenyl-1H-1,2,3-triazole (4) and 1-(2-nitrophenyl)-4-ferrocenyl-1H-1,2,3-triazole (5) were designed and synthesized by copper-catalyzed azide alkyne cycloaddition (CuAAC) reaction. All the new hybrids were characterized by microanalyses, NMR (1H and 13C), UV-vis, IR, ESI-MS and electrochemical techniques. Crystal structure of the compound (3) was solved by single crystal X-ray diffraction method. The structural (single crystal) and spectroscopic (UV-Vis. and IR) properties of the compound 3 have been analyzed and compared by complementary quantum modeling. Hybrids 1-5 exhibited low toxicity and demonstrated neuroprotective effect.
KK parity in warped extra dimension
NASA Astrophysics Data System (ADS)
Agashe, Kaustubh; Falkowski, Adam; Low, Ian; Servant, Géraldine
2008-04-01
We construct models with a Kaluza-Klein (KK) parity in a five-dimensional warped geometry, in an attempt to address the little hierarchy problem present in setups with bulk Standard Model fields. The lightest KK particle (LKP) is stable and can play the role of dark matter. We consider the possibilities of gluing two identical slices of AdS5 in either the UV (IR-UV-IR model) or the IR region (UV-IR-UV model) and discuss the model-building issues as well as phenomenological properties in both cases. In particular, we find that the UV-IR-UV model is not gravitationally stable and that additional mechanisms might be required in the IR-UV-IR model to address flavor issues. Collider signals of the warped KK parity are different from either the conventional warped extra dimension without KK parity, in which the new particles are not necessarily pair-produced, or the KK parity in flat universal extra dimensions, where each KK level is nearly degenerate in mass. Dark matter and collider properties of a TeV mass KK Z gauge boson as the LKP are discussed.
Observational Evidence Linking Interstellar UV Absorption to PAH Molecules
DOE Office of Scientific and Technical Information (OSTI.GOV)
Blasberger, Avi; Behar, Ehud; Perets, Hagai B.
The 2175 Å UV extinction feature was discovered in the mid-1960s, yet its physical origin remains poorly understood. One suggestion is absorption by polycyclic aromatic hydrocarbon (PAH) molecules, which is supported by theoretical molecular structure computations and by laboratory experiments. PAHs are positively detected by their 3.3, 6.2, 7.7, 8.6, 11.3, and 12.7 μ m IR emission bands, which are specified by their modes of vibration. A definitive empirical link between the 2175 Å UV extinction and the IR PAH emission bands, however, is still missing. We present a new sample of hot stars that have both 2175 Å absorptionmore » and IR PAH emission. We find significant shifts of the central wavelength of the UV absorption feature, up to 2350 Å, but predominantly in stars that also have IR PAH emission. These UV shifts depend on stellar temperature in a fashion that is similar to the shifts of the 6.2 and 7.7 μ m IR PAH bands, that is, the features are increasingly more redshifted as the stellar temperature decreases, but only below ∼15 kK. Above 15 kK both UV and IR features retain their nominal values. Moreover, we find a suggestive correlation between the UV and IR shifts. We hypothesize that these similar dependences of both the UV and IR features on stellar temperature hint at a common origin of the two in PAH molecules and may establish the missing link between the UV and IR observations. We further suggest that the shifts depend on molecular size, and that the critical temperature of ∼15 kK above which no shifts are observed is related to the onset of UV-driven hot-star winds and their associated shocks.« less
Observational Evidence Linking Interstellar UV Absorption to PAH Molecules
NASA Astrophysics Data System (ADS)
Blasberger, Avi; Behar, Ehud; Perets, Hagai B.; Brosch, Noah; Tielens, Alexander G. G. M.
2017-02-01
The 2175 Å UV extinction feature was discovered in the mid-1960s, yet its physical origin remains poorly understood. One suggestion is absorption by polycyclic aromatic hydrocarbon (PAH) molecules, which is supported by theoretical molecular structure computations and by laboratory experiments. PAHs are positively detected by their 3.3, 6.2, 7.7, 8.6, 11.3, and 12.7 μm IR emission bands, which are specified by their modes of vibration. A definitive empirical link between the 2175 Å UV extinction and the IR PAH emission bands, however, is still missing. We present a new sample of hot stars that have both 2175 Å absorption and IR PAH emission. We find significant shifts of the central wavelength of the UV absorption feature, up to 2350 Å, but predominantly in stars that also have IR PAH emission. These UV shifts depend on stellar temperature in a fashion that is similar to the shifts of the 6.2 and 7.7 μm IR PAH bands, that is, the features are increasingly more redshifted as the stellar temperature decreases, but only below ˜15 kK. Above 15 kK both UV and IR features retain their nominal values. Moreover, we find a suggestive correlation between the UV and IR shifts. We hypothesize that these similar dependences of both the UV and IR features on stellar temperature hint at a common origin of the two in PAH molecules and may establish the missing link between the UV and IR observations. We further suggest that the shifts depend on molecular size, and that the critical temperature of ˜15 kK above which no shifts are observed is related to the onset of UV-driven hot-star winds and their associated shocks.
NASA Astrophysics Data System (ADS)
Kose, Etem; Atac, Ahmet; Bardak, Fehmi
2018-07-01
This study comprises the structural and spectroscopic evaluation of a quinoline derivative, 2-chloro-3-methylquinoline (2Cl3MQ), via UV-Vis, 1H and 13C NMR, FT-IR and FT-Raman techniques experimentally, theoretically with DFT and TD-DFT quantum chemical calculations at B3LYP/6-311++G (d, p) level of theory, and investigation of the in silico pharmaceutical potent of 2Cl3MQ in comparison to 2ClnMQ (n = 3,4,7,8,9,10) substituted quinolines. The experimental measurements were recorded as follows; UV-vis spectra were obtained in the range of 200-400 nm in the water and ethanol solvents. 1H and 13C NMR spectra were recorded in CDCl3. Vibrational spectra were obtained in the region of 4000-400 cm-1 and 3500-10 cm-1 for FT-IR and FT-Raman spectra, respectively. Structural and spectroscopic features obtained through theoretical evaluations include: electrostatic features, atomic charges and molecular electrostatic potential surface, the frontier molecular orbital characteristics, the density of states and their overlapping nature, the electronic transition properties, thermodynamical and nonlinear optical characteristics, and predicted UV-Vis, 1H and 13C NMR, FT-IR and FT-Raman spectra. Ligand-enzyme interactions of 2ClnMQ (n = 3,4,7,8,9,10) substituted quinolines with Malate Synthase from Mycobacterium Tuberculosis (MtbMS) were investigated via molecular docking. The role of position of methyl substitution on the inhibitor character of the ligands was discussed on the basis of noncovalent interaction profiles.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Penner, Kyle; Dickinson, Mark; Dey, Arjun
Dusty galaxies at z {approx} 2 span a wide range of relative brightness between rest-frame mid-infrared (8 {mu}m) and ultraviolet wavelengths. We attempt to determine the physical mechanism responsible for this diversity. Dust-obscured galaxies (DOGs), which have rest-frame mid-IR to UV flux density ratios {approx}> 1000, might be abnormally bright in the mid-IR, perhaps due to prominent emission from active galactic nuclei and/or polycyclic aromatic hydrocarbons, or abnormally faint in the UV. We use far-infrared data from the GOODS-Herschel survey to show that most DOGs with 10{sup 12} L {sub Sun} {approx}< L {sub IR} {approx}< 10{sup 13} L {submore » Sun} are not abnormally bright in the mid-IR when compared to other dusty galaxies with similar IR (8-1000 {mu}m) luminosities. We observe a relation between the median IR to UV luminosity ratios and the median UV continuum power-law indices for these galaxies, and we find that only 24% have specific star formation rates that indicate the dominance of compact star-forming regions. This circumstantial evidence supports the idea that the UV- and IR-emitting regions in these galaxies are spatially coincident, which implies a connection between the abnormal UV faintness of DOGs and dust obscuration. We conclude that the range in rest-frame mid-IR to UV flux density ratios spanned by dusty galaxies at z {approx} 2 is due to differing amounts of UV obscuration. Of galaxies with these IR luminosities, DOGs are the most obscured. We attribute differences in UV obscuration to either (1) differences in the degree of alignment between the spatial distributions of dust and massive stars or (2) differences in the total dust content.« less
Nieuwjaer, N; Desfrançois, C; Lecomte, F; Manil, B; Soorkia, S; Broquier, M; Grégoire, G
2018-04-19
We report the UV and IR photofragmentation spectroscopies of protonated synephrine in a cryogenically cooled Paul trap. Single (UV or IR) and double (UV-UV and IR-UV) resonance spectroscopies have been performed and compared to quantum chemistry calculations, allowing the assignment of the lowest-energy conformer with two rotamers depending on the orientation of the phenol hydroxyl (OH) group. The IR-UV hole burning spectrum exhibits the four expected vibrational modes in the 3 μm region, i.e., the phenol OH, C β -OH, and two NH 2 + stretches. The striking difference is that, among these modes, only the free phenol OH mode is active through IRPD. The protonated amino group acts as a proton donor in the internal hydrogen bond and displays large frequency shifts upon isomerization expected during the multiphoton absorption process, leading to the so-called IRMPD transparency. More interestingly, while the C β -OH is a proton acceptor group with moderate frequency shift for the different conformations, this mode is still inactive through IRPD.
Zhang, Junyong; Chang, Shaoqing; Suryanto, Bryan H R; Gong, Chunhua; Zeng, Xianghua; Zhao, Chuan; Zeng, Qingdao; Xie, Jingli
2016-06-06
Taking advantage of a continuous-flow apparatus, the iridium(III)-containing polytungstate cluster K12Na2H2[Ir2Cl8P2W20O72]·37H2O (1) was obtained in a reasonable yield (13% based on IrCl3·H2O). Compound 1 was characterized by Fourier transform IR, UV-visible, (31)P NMR, electrospray ionization mass spectrometry (ESI-MS), and thermogravimetric analysis measurements. (31)P NMR, ESI-MS, and elemental analysis all indicated 1 was a new polytungstate cluster compared with the reported K14[(IrCl4)KP2W20O72] compound. Intriguingly, the successful isolation of 1 relied on the custom-built flow apparatus, demonstrating the uniqueness of continuous-flow chemistry to achieve crystalline materials. The catalytic properties of 1 were assessed by investigating the activity on catalyzing the electro-oxidation of ruthenium tris-2,2'-bipyridine [Ru(bpy)3](2+/3+). The voltammetric behavior suggested a coupled catalytic behavior between [Ru(bpy)3](3+/2+) and 1. Furthermore, on the highly oriented pyrolytic graphite surface, 1,3,5-tris(10-carboxydecyloxy) benzene (TCDB) was used as the two-dimensional host network to coassemble cluster 1; the surface morphology was observed by scanning tunneling microscope technique. "S"-shape of 1 was observed, indicating that the cluster could be accommodated in the cavity formed by two TCDB host molecules, leading to a TCDB/cluster binary structure.
[Study on the chemical constituents in roots of Gentiana dahurica].
Chen, Qian-Liang; Shi, Zhang-Yan; Zhang, Ya-Hui; Zheng, Jiang-Bin
2011-08-01
To systematically study the chemical constituents in the roots of Gentiana dahurica. Various column chromatographic techniques were used for isolation and purification. The structures were elucidated on the basis of spectral data (UV, IR, MS, NMR) and identified by comparing with the authentic substance. Seven compounds were isolated and identified as: roburic acid (1), oleanolic acid (2), beta-sitosterol (3), daucosterol (4), gentiopicroside(5), swertiamarine (6), sweroside (7). Compounds 1, 2 and 4 are isolated from this plant for the first time.
Two new compounds from an endophytic fungus Pestalotiopsis heterocornis.
Xing, Jian-Guang; Deng, Hui-Ying; Luo, Du-Qiang
2011-12-01
Two new compounds, 7-hydroxy-5-methoxy-4,6-dimethyl-7-O-α-L-rhamnosyl-phthalide and 7-hydroxy-5-methoxy-4,6-dimethyl-7-O-β-D-glucopyranosyl-phthalide, along with one known and related metabolite 7-hydroxy-5-methoxy-4,6-dimethylphthalide were isolated from the EtOAc extract of fermentation broth of an endophytic fungus Pestalotiopsis heterocornis. The structures of these compounds were elucidated on the basis of spectroscopic methods (UV, IR, HR-ESI-MS, 1D NMR, and 2D NMR).
Limonoid from the rhizomes of Luvunga scandens (Roxb.) Buch. Ham.
Nguyen, Tan Phat; Minh, Nhat Phan; Dat, Trong Bui; Le, Tien Dung; Tran Nguyen, Minh An; Pham, Thi Nhat Trinh; Tri, Dinh Mai
2017-10-01
For first time, the chemical constituents of the rhizomes of Luvunga scandens (Roxb.) Buch. Ham. were investigated and led to the isolation of one new limonoid named Luvunga A (1), together with seven known compounds, including one limonoid (2) and six coumarins (3-8) were isolated for the first time from the species L. scandens by various chromatography methods. Their chemical structures were elucidated by IR, UV, HR-ESI-MS, NMR 1D and 2D experiments and compared with literatures.
Two new compounds from the fruits of Arctium lappa.
He, Jun; Huang, Xiao-Ying; Yang, Ya-Nan; Feng, Zi-Ming; Jiang, Jian-Shuang; Zhang, Pei-Cheng
2016-05-01
Phytochemical investigation of the extract of Arctii Fructus led to the isolation and characterization of two new compounds, named arctiisesquineolignan B (1) and arctiiphenolglycoside A (2). Their structures were elucidated by means of spectroscopic methods (UV, IR, HR-ESI-MS, 1D and 2D NMR) and chemical evidence, as well as by comparison with known analogs in the literature. Compound 2 exhibited stronger antioxidant activity than the positive control ascorbic acid at a concentration of 10 μM.
Vitiquinolone--a quinolone alkaloid from Hibiscus vitifolius Linn.
Ramasamy, D; Saraswathy, A
2014-02-15
Phytochemical investigations of the powdered root of Hibiscus vitifolius Linn. (Malvaceae) was extracted successively with n-hexane and chloroform. Analysis of the n-hexane extract by GC-MS led to the identification of twenty-six components by comparison of their mass spectra with GC-MS library data. A novel quinolone alkaloid, vitiquinolone (5) together with eight known compounds viz. β-Amyrin acetate (1), n-octacosanol (2), β-Amyrin (3), stigmasterol (4), xanthyletin (6), alloxanthoxyletin (7), xanthoxyletin (8) and betulinic acid (9) were isolated from chloroform extract by column chromatography over silica gel. The structure of vitiquinolone was established on the basis of spectroscopic methods including UV, IR, 1D, 2D NMR and ESI-MS. The known compounds were identified on the basis of their physical and spectroscopic data as reported in the literature. Copyright © 2013 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Kumar, Devinder; Smith, Leon; Richardson, Mark A.; Ayling, Richard; Barlow, Nick
2014-10-01
The Ultraviolet (UV) band of the electromagnetic (EM) spectrum has the potential to be used as the host medium for the operation of guided weapons. Unlike in the Infrared (IR), a target propelled by an air breathing jet engine produces no detectable radiation in the UV band, and is opaque to the background UV produced by the Sun. Successful engineering of spectral airborne IR countermeasures (CM) against existing two colour IR seekers has encouraged missile counter-countermeasure (CCM) designers to utilise the silhouette signature of an aircraft in the UV as a means of distinguishing between a true target and a flare CM. In this paper we describe the modelling process of a dual band IR and UV rosette scan seeker using CounterSim, a missile engagement and countermeasure simulation software package developed by Chemring Countermeasures Ltd. Results are shown from various simulated engagements of the dual band MANPAD with a C-130 Hercules modelled by Chemring Countermeasures. These results have been used to estimate the aircrafts' vulnerability to this MANPAD threat. A discussion on possible future optical countermeasures against dual band IR-UV seekers is given in conclusion to the simulation results.
NASA Astrophysics Data System (ADS)
Khatuntsev, I. V.; Patsaeva, M. V.; Titov, D. V.; Ignatiev, N. I.; Turin, A. V.; Fedorova, A. A.; Markiewicz, W. J.
2017-11-01
For more than 8 years the Venus Monitoring Camera (VMC) onboard the Venus Express orbiter performed continuous imaging of the Venus cloud layer in UV, visible and near-IR filters. We applied the correlation approach to sequences of the near-IR images at 965 nm to track cloud features and determine the wind field in the middle and lower cloud (49-57 km). From the VMC images that spanned from December of 2006 through August of 2013 we derived zonal and meridional components of the wind field. In low-to-middle latitudes (5-65°S) the velocity of the retrograde zonal wind was found to be 68-70 m/s. The meridional wind velocity slowly decreases from peak value of +5.8 ± 1.2 m/s at 15°S to 0 at 65-70°S. The mean meridional speed has a positive sign at 5-65°S suggesting equatorward flow. This result, together with the earlier measurements of the poleward flow at the cloud tops, indicates the presence of a closed Hadley cell in the altitude range 55-65 km. Long-term variations of zonal and meridional velocity components were found during 1,200 Earth days of observation. At 20° ± 5°S the zonal wind speed increases from -67.18 ± 1.81 m/s to -77.30 ± 2.49 m/s. The meridional wind gradually increases from +1.30 ± 1.82 m/s to +8.53 ± 2.14 m/s. Following Bertaux et al. (2016) we attribute this long-term trend to the influence from the surface topography on the dynamical process in the atmosphere via the upward propagation of gravity waves that became apparent in the VMC observations due to slow drift of the Venus Express orbit over Aphrodite Terra.
Synthesis, characterization and optical properties of non-traditional tellurite-selenite glasses
NASA Astrophysics Data System (ADS)
Bachvarova-Nedelcheva, A.; Iordanova, R.; Kostov, K. L.; Ganev, V.; Yordanov, St.
2014-06-01
This study continues our investigations on non-traditional tellurite-selenite amorphous materials. Two glasses containing TeO2, SeO2, MoO3 and V2O5 were obtained at high oxygen pressure (P = 36 MPa) using pure oxides as precursors. The real bulk chemical composition of both glasses was verified by LA-ICP-MS method. The glasses were characterized by X-ray diffraction, Scanning Electron Microscopy (SEM), Differential Thermal Analysis (DTA), UV-Vis, XPS, IR and EPR spectroscopy. According to DTA the glass transition temperature (Tg) is below 300 °C. Both glasses were subjected to heat treatment (300 °C - 12 h) and as a result no crystallization was observed. The main building units (TeO3, TeO4, Mo2O8, and SеО3) were determined by IR and X-ray photoelectron spectroscopy and the existence of mixed bridging bonds only, which build up the amorphous network. It was established by UV-Vis that the obtained glasses are transparent above 550 nm and they were red colored.
Coupling of Ultrafast LC with Mass Spectrometry by DESI
NASA Astrophysics Data System (ADS)
Cai, Yi; Liu, Yong; Helmy, Roy; Chen, Hao
2014-10-01
Recently we reported a desorption electrospray ionization (DESI) interface to combine liquid chromatography (LC) with mass spectrometry (MS) using a new LC eluent splitting strategy through a tiny orifice on LC capillary tube [ J. Am. Soc. Mass Spectrom. 25, 286 (2014)]. The interface introduces negligible dead volume and back pressure, thereby allowing "near real-time" MS detection, fast LC elution, and online MS-directed purification. This study further evaluates the LC/DESI-MS performance with focus of using ultra-fast LC. Using a monolithic C18 column, metabolites in urine can be separated within 1.6 min and can be online collected for subsequent structure elucidation (e.g., by NMR, UV, IR) in a recovery yield up to 99%. Using a spray solvent with alkaline pH, negative ions could be directly generated for acidic analytes (e.g., ibuprofen) in acidic LC eluent by DESI, offering a novel protocol to realize "wrong-way around" ionization for LC/MS analysis. In addition, DESI-MS is found to be compatible with ultra-performance liquid chromatography (UPLC) for the first time.
Digital UV/IR photography for tattoo evaluation in mummified remains.
Oliver, William R; Leone, Lisa
2012-07-01
The presence and location of tattoos can be an important component in the identification of remains in the extended postmortem period if remnants of skin persist. However, when there is significant mummification, visualization of tattoos can be problematic. Multiple methods have been proposed to make tattoos more visible, but all have limitation. In this case report, a mummified body was discovered. The presumptive victim was reported to have a small tattoo on her hand but it was not visible to the naked eye. The hand was photographed using ultraviolet (UV) and infrared (IR) light. A tattoo matching the description was noted in the photographs. In contrast to film-based IR and UV photography, digital UV and IR photography allows rapid visual evaluation of results and optimization of image utility. The ability to quickly modify photographic parameters quickly greatly increases the utility of IR and UV photography in the autopsy suite. © 2012 American Academy of Forensic Sciences.
Qu, Jialin; Gong, Tianxing; Ma, Bin; Zhang, Lin; Kano, Yoshihiro; Yuan, Dan
2012-01-01
The purpose of the study is to compare alkaloid profile of Uncaria rhynchophylla hooks and leaves. Ten oxindole alkaloids and four glycosidic indole alkaloids were identified using HPLC-diode array detection (DAD) or LC-atmospheric pressure chemical ionization (APCI)-MS method, and a HPLC-UV method for simultaneous quantification of major alkaloids was validated. The hooks are characterized by high levels of four oxindole alkaloids rhynchophylline (R), isorhynchophylline (IR), corynoxeine (C) and isocorynoxeine (IC), while the leaves contained high level of two glycosidic indole alkaloids vincoside lactam (VL) and strictosidine (S). The presented methods have proven its usefulness in chemical characterization of U. rhynchophylla hooks and leaves.
NASA Astrophysics Data System (ADS)
Fachriyah, E.; Ghifari, M. A.; Anam, K.
2018-04-01
The research of the isolation and xanthine oxidation inhibition activity of alkaloid compound from Peperomia pellucida has been carried out. Alkaloid extract is isolated by column chromatography and preparative TLC. Alkaloid isolate is identified spectroscopically by UV-Vis spectrophotometer, FT-IR, and LC-MS/MS. Xanthine oxidase inhibition activity is carried out by in vitro assay. The result showed that the alkaloid isolated probably has piperidine basic structure. The alkaloid isolate has N-H, C-H, C = C, C = O, C-N, C-O-C groups and the aromatic ring. The IC50 values of ethanol and alkaloid extract are 71.6658 ppm and 76.3318 ppm, respectively. Alkaloid extract of Peperomia pellucida showed higher activity than ethanol extract.
Mandal, Sudeb; Joardar, Soumen; Das, Saktipada; Bhattacharyya, Anjan
2011-11-09
The photodegradation of the carboxamide acaricide hexythiazox in three different solvent systems (aqueous methanolic, aqueous isopropanolic, and aqueous acetonitrilic solutions) in the presence of H(2)O(2), KNO(3), and TiO(2) under ultraviolet (UV) light (λ(max) ≥ 250 nm) and sunlight (λ(max) ≥290 nm) has been assessed in this work. The kinetics of photodecomposition of hexythiazox and the identification of photoproducts were carried out using liquid chromatography-mass spectrometry. The rate of photodecomposition of hexythiazox in different solvents followed first-order kinetics in both UV radiation and natural sunlight, and the degradation rates were faster under UV light than under sunlight. Hexythiazox was found to be more efficiently photodegraded in the presence of TiO(2) than in the presence of H(2)O(2) and KNO(3). Two major photoproducts were separated in pure form using column chromatography and identified according to IR, (1)H NMR, and mass spectral information as cyclohexylamine and 5-(4-chlorophenyl)-4-methylthiazolidin-2-one. Another nine photoproducts were identified according to LC-MS/MS spectral information. The plausible photodegradation pathways of hexythiazox were proposed according to the structures of the photoproducts.
Geloneze, Bruno; Vasques, Ana Carolina Junqueira; Stabe, Christiane França Camargo; Pareja, José Carlos; Rosado, Lina Enriqueta Frandsen Paez de Lima; Queiroz, Elaine Cristina de; Tambascia, Marcos Antonio
2009-03-01
To investigate cut-off values for HOMA1-IR and HOMA2-IR to identify insulin resistance (IR) and metabolic syndrome (MS), and to assess the association of the indexes with components of the MS. Nondiabetic subjects from the Brazilian Metabolic Syndrome Study were studied (n = 1,203, 18 to 78 years). The cut-off values for IR were determined from the 90th percentile in the healthy group (n = 297) and, for MS, a ROC curve was generated for the total sample. In the healthy group, HOMA-IR indexes were associated with central obesity, triglycerides and total cholesterol (p < 0.001). The cut-off values for IR were: HOMA1-IR > 2.7 and HOMA2-IR > 1.8; and, for MS were: HOMA1-IR > 2.3 (sensitivity: 76.8%; specificity: 66.7%) and HOMA2-IR > 1.4 (sensitivity: 79.2%; specificity: 61.2%). The cut-off values identified for HOMA1-IR and HOMA2-IR indexes have a clinical and epidemiological application for identifying IR and MS in Westernized admixtured multi-ethnic populations.
A new p-hydroxybenzoic acid derivative from an endophytic fungus Penicillium sp. of Nerium indicum.
Ma, Yang-Min; Qiao, Ke; Kong, Yang; Guo, Lin-Xin; Li, Meng-Yun; Fan, Chao
2017-12-01
A new p-hydroxybenzoic acid derivative named 4-(2'R, 4'-dihydroxybutoxy) benzoic acid (1) was isolated from the fermentation of Penicillium sp. R22 in Nerium indicum. The structure was elucidated by means of spectroscopic (HR-ESI-MS, NMR, IR, UV) and X-ray crystallographic methods. The antibacterial and antifungal activity of compound 1 was tested, and the results showed that compound 1 revealed potent antifungal activity against Colletotrichum gloeosporioides, Alternaria alternata, and Alteranria brassicae with MIC value of 31.2 μg/ml.
NASA Astrophysics Data System (ADS)
Zhang, D. D.; Wang, L. Y.; Su, J. J.; Zhang, X. F.; Lei, Y. B.; Zhai, G. H.; Wen, Z. Y.
2013-05-01
A kind of trinucleus dimethine cyanine dye: 1-methyl-2,6-bis[2-(furan-2-yl)vinyl]pyridinium iodide (1) was synthesized and characterized by 1H NMR, 13C NMR, IR, MS, UV-Vis spectroscopy and elemental analysis. The crystals of dye 1, obtained from slow evaporation of solvent acetone, crystallized in the triclinic space group P - 1 with a = 9.6501(16) Å, b = 10.2308(17) Å, c = 10.7341(17) Å, V = 887.2(3) Å3, and Z = 2 (at 298(2) K), and it was stabilized by the hydrogen bonds and intermolecular face-to-face π⋯π aromatic stacking interactions. Crystallographic, IR, 1H NMR and UV-Vis data of dye 1 were compared with the results of density functional theory (DFT) method, and the calculated molecular geometries, vibrational bands, 1H NMR chemical shifts and UV-Vis maximum absorption were consistent with the experimental results. The fluorescence spectra were predicted in four different solvents with CIS/PCM methods. Compared with experimental values, the absolute deviations of emission maxima were -17.4 nm in chloroform, 6.3 nm in DMSO, 4.9 nm in methanol, and 6.8 nm in water, respectively. And the experimental fluorescence spectra were nicely reproduced by the simulated fluorescence spectra for each solvent.
NASA Astrophysics Data System (ADS)
Gladstone, R.; Greathouse, T. K.; Versteeg, M. H.; Hue, V.; Kammer, J.; Gerard, J. C. M. C.; Grodent, D. C.; Bonfond, B.; Bolton, S. J.; Connerney, J. E. P.; Levin, S.; Adriani, A.; Allegrini, F.; Bagenal, F.; Bunce, E. J.; Branduardi-Raymont, G.; Clark, G. B.; Dunn, W.; Ebert, R. W.; Hansen, C. J.; Jackman, C. M.; Kraft, R.; Kurth, W. S.; Mauk, B.; Mura, A.; Orton, G.; Ranquist, D. A.; Ravine, M. A.; Valek, P. W.
2017-12-01
Juno's Ultraviolet Spectrograph (Juno-UVS) has observed the Jovian aurora during eight perijove passes. UVS typically observes Jupiter for 10 hours centered on closest approach in a series of swaths, with one swath per Juno spin ( 30s). During this period the spacecraft range to Jupiter's aurora decreases from 6 RJ to 0.3 RJ (or less) in the north, and then reverses this in the south, so that spatial resolution changes dramatically. A scan mirror is used to target different features or raster across the entire auroral region. Juno-UVS observes a particular location for roughly 17 ms/swath, so the series of swaths provide snapshots of ultraviolet auroral brightness and color. A variety of forms and activity levels are represented in the Juno-UVS data-some have been described before with HST observations, but others are new. One interesting result is that the color ratio, often used as a proxy for energetic particle precipitation, may instead (in certain regions) indicate excitation of H2 by low-energy ionospheric electrons. Additional results from comparisons with simultaneous observations at x-ray, visible, and near-IR wavelengths will also be presented.
Infrared measurements on ultraviolet photolysis products at cryogenic temperatures
NASA Astrophysics Data System (ADS)
Dong, Weibing; He, Ping; Wang, Jessie; Zhou, Zhaohui; Wang, Hongxin
2013-01-01
Combination of ultraviolet (UV) photolysis with infrared (IR) spectroscopy (or UV/IR for abbreviation) is a powerful tool to study various chemical photoreactions, while cryostat and sample-cell windows define the working ranges for both UV and IR beams. Although diamond window has a very wide transmission range from UV to IR, the extreme cost, the absorptions at 1800-2600 cm-1 and other problems prevent it from being the solution for all cases. In this paper, a gas-exchange cryostat was modified to realize a UV/mid-IR experiment at cryogenic temperatures. Several windows (including diamond) were discussed as options. A di-nitrogen iron complex trans-[Fe(DMeOPrPE)2(N2)H][BPh4] [DMeOPrPE = 1,2-bis(dimethoxypropylphosphino)ethane] was studied as a real photolysis example. Alternatively, a cold-finger cryostat was modified for UV/far-IR compatible experiments. Non-photolysis samples K5[Mo4O11(R,S-Hhomocit)2]Cl·5H2O (H4homocit = homocitric acid) and [(n-Bu)4N]2[Fe4S4(PPh)4] were studied at cryogenic temperatures. Sample cell windows can also be used as a natural way for choosing photolysis wavelength (in addition to the use of optical filters).
Spectroscopy for Industrial Applications: High-Temperature Processes
NASA Astrophysics Data System (ADS)
Fateev, Alexander; Grosch, Helge; Clausen, Sonnik; Barton, Emma J.; Yurchenko, Sergei N.; Tennyson, Jonathan
2014-06-01
The continuous development of the spectroscopic databases brings new perspectives in the environmental and industrial on-line process control, monitoring and stimulates further optical sensor developments. This is because no calibration gases are needed and, in general, temperature-dependent spectral absorption features gases of interest for a specific instrument can in principle be calculated by knowing only the gas temperature and pressure in the process under investigation/monitoring. The latest HITRAN-2012 database contains IR/UV spectral data for 47 molecules and it is still growing. However use of HITRAN is limited to low-temperature processes (< 400 K) and therefor can be used for absorption spectra calculations at limited temperature/pressure ranges. For higher temperatures, the HITEMP-2010 database is available. Only a few molecules CO2, H2O, CO and NO are those of interest for e.g. various combustion and astronomical applications are included. In the recent few years, several efforts towards a development of hot line lists have been made; those have been implemented in the latest HITRAN2012 database1. High-resolution absorption measurements of NH3 (IR, 0.1 cm-1) and phenol (UV, 0.019 nm) on a flow gas cell2 up to 800 K are presented. Molecules are of great interest in various high-temperature environments including exoplanets, combustion and gasification. Measured NH3 hot lines have been assigned and spectra have been compared with that obtained by calculations based on the BYTe hot line list1. High-temperature NH3 absorption spectra have been used in the analysis of in situ high-resolution IR absorption measurements on the producer gas in low-temperature gasification process on a large scale. High-resolution UV temperature-dependent absorption cross-sections of phenol are reported for the first time. All UV data have been calibrated by relevant GC/MS measurements. Use of the data is demonstrated by the analysis of in situ UV absorption measurements on a small-scale low-temperature gasifier. A comparison between in situ, gas extraction and conventional gas sampling measurements is presented. Overall the presentation shows an example of successful industrial and academic partnerships within the framework of national and international ongoing projects.
Arjmand, Farukh; Sharma, Girish Chandra; Sayeed, Fatima; Muddassir, Mohd; Tabassum, Sartaj
2011-12-02
N,N-bis[(R-/S-)-1-benzyl-2-ethoxyethane] tin (IV) complexes were synthesized by applying de novo design strategy by the condensation reaction of (R-/S-)2-amino-2-phenylethanol and dibromoethane in presence of dimethyltin dichloride and thoroughly characterized by elemental analysis, conductivity measurements, IR, ESI-MS, (1)H, (13)C and (119)Sn, multinuclear NMR spectroscopy and XRD study. Enantioselective and specific binding profile of R-enantiomer 1 in comparison to S-enantiomer 2 with ultimate molecular target CT-DNA was validated by UV-visible, fluorescence, circular dichroism, (1)H and (31)P NMR techniques. This was further corroborated well by interaction of 1 and 2 with 5'-GMP. Copyright © 2011 Elsevier B.V. All rights reserved.
1993-09-01
designed to respond to. No data exists on spectral irradiances in the IR or UV spectral bands where the current detectors operate. A need exists to...appropriate fire/explosion detection spectral bands. Setting a pyrotechnic fire and testing the responses of commercial UV and IR detectors that are designed...PNZ B. DETECTOR BACKGROUND ............... 30 C. UV DETECTORS . . ............ . . . 32 D. IR DETECTORS . . . ......... . . ... 34 E. MACHINE VISION
Towards universal hybrid star formation rate estimators
NASA Astrophysics Data System (ADS)
Boquien, M.; Kennicutt, R.; Calzetti, D.; Dale, D.; Galametz, M.; Sauvage, M.; Croxall, K.; Draine, B.; Kirkpatrick, A.; Kumari, N.; Hunt, L.; De Looze, I.; Pellegrini, E.; Relaño, M.; Smith, J.-D.; Tabatabaei, F.
2016-06-01
Context. To compute the star formation rate (SFR) of galaxies from the rest-frame ultraviolet (UV), it is essential to take the obscuration by dust into account. To do so, one of the most popular methods consists in combining the UV with the emission from the dust itself in the infrared (IR). Yet, different studies have derived different estimators, showing that no such hybrid estimator is truly universal. Aims: In this paper we aim at understanding and quantifying what physical processes fundamentally drive the variations between different hybrid estimators. In so doing, we aim at deriving new universal UV+IR hybrid estimators to correct the UV for dust attenuation at local and global scales, taking the intrinsic physical properties of galaxies into account. Methods: We use the CIGALE code to model the spatially resolved far-UV to far-IR spectral energy distributions of eight nearby star-forming galaxies drawn from the KINGFISH sample. This allows us to determine their local physical properties, and in particular their UV attenuation, average SFR, average specific SFR (sSFR), and their stellar mass. We then examine how hybrid estimators depend on said properties. Results: We find that hybrid UV+IR estimators strongly depend on the stellar mass surface density (in particular at 70 μm and 100 μm) and on the sSFR (in particular at 24 μm and the total infrared). Consequently, the IR scaling coefficients for UV obscuration can vary by almost an order of magnitude: from 1.55 to 13.45 at 24 μm for instance. This result contrasts with other groups who found relatively constant coefficients with small deviations. We exploit these variations to construct a new class of adaptative hybrid estimators based on observed UV to near-IR colours and near-IR luminosity densities per unit area. We find that they can reliably be extended to entire galaxies. Conclusions: The new estimators provide better estimates of attenuation-corrected UV emission than classical hybrid estimators published in the literature. Taking naturally variable impact of dust heated by old stellar populations into account, they constitute an important step towards universal estimators.
Airborne pipeline leak detection: UV or IR?
NASA Astrophysics Data System (ADS)
Babin, François; Gravel, Jean-François; Allard, Martin
2016-05-01
This paper presents a study of different approaches to the measurement of the above ground vapor plume created by the spill caused by a small 0.1 l/min (or less) leak in an underground liquid petroleum pipeline. The scenarios are those for the measurement from an airborne platform. The usual approach is that of IR absorption, but in the case of liquid petroleum products, there are drawbacks that will be discussed, especially when using alkanes to detect a leak. The optical measurements studied include UV enhanced Raman lidar, UV fluorescence lidar and IR absorption path integrated lidars. The breadboards used for testing the different approaches will be described along with the set-ups for leak simulation. Although IR absorption would intuitively be the most sensitive, it is shown that UV-Raman could be an alternative. When using the very broad alkane signature in the IR, the varying ground spectral reflectance are a problem. It is also determined that integrated path measurements are preferred, the UV enhanced Raman measurements showing that the vapor plume stays very close to the ground.
Simultaneous infrared and UV-visible absorption spectra of matrix-isolated carbon vapor
NASA Technical Reports Server (NTRS)
Kurtz, Joe; Huffman, Donald R.
1989-01-01
Carbon molecules were suggested as possible carriers of the diffuse interstellar bands. In particular, it was proposed that the 443 nm diffuse interstellar band is due to the same molecule which gives rise to the 447 nm absorption feature in argon matrix-isolated carbon vapor. If so, then an associated C-C stretching mode should be seen in the IR. By doing spectroscopy in both the IR and UV-visible regions on the same sample, the present work provides evidence for correlating UV-visible absorption features with those found in the IR. Early data indicates no correlation between the strongest IR feature (1997/cm) and the 447 nm band. Correlation with weaker IR features is being investigated.
Hagiwara, Kehau; Garcia Hernandez, Jaaziel E; Harper, Mary Kay; Carroll, Anthony; Motti, Cherie A; Awaya, Jonathan; Nguyen, Hoang-Yen; Wright, Anthony D
2015-02-27
From the organic extract of a deep-water Hawaiian sponge Dactylospongia sp., a new potent antioxidant and antimicrobial meroterpenoid, puupehenol (1), was isolated. The structure of 1 was determined using spectroscopic techniques ((1)H and (13)C NMR, MS, IR, UV, [α]D). The known compound puupehenone (2) was also isolated and suggested as a probable artifact of the isolation procedures. Complete unambiguous (1)H and (13)C NMR data are provided for compounds 1 and 2. Bioassays performed with 1 and 2 showed them both to be very effective antioxidants and to have antimicrobial properties.
Chalcones and other constituents of Dorstenia prorepens and Dorstenia zenkeri.
Abegaz, Berhanu M; Ngadjui, Bonaventure T; Dongo, Etienne; Ngameni, Bathelemy; Nindi, Mathew N; Bezabih, Merhatibeb
2002-04-01
The twigs of Dorstenia prorepens furnished the digeranylated chalcone, 5,3'-(3,7-dimethyl-2,6-octadienyl)-3,4, 2',4'-tetrahydroxychalcone while Dorstenia zenkeri yielded the 3',4'-(3-hydroxy-2,2-dimethyldihydropyrano)-4,2'-dihydroxychalcone and a bichalcone. 4-Hydroxylonchocarpin was found in both plants. D. prorepens also yielded the known compounds: psoralen, bergapten, beta-sitosterol and its D-glucopyranosyl derivative. D. zenkeri yielded p-hydroxybenzaldehyde, dorsmanin A, 4,2',4'-trihydroxychalcone and 4,2',4'-trihydroxy-3'-prenylchalcone. Structures of the new compounds were established by UV, IR, MS and 2-D NMR analysis.
[Studies on the flavonoids from Dendranthema lavandulifolium].
Shen, Y X; Quan, L H; Guan, L; Chen, J M
1997-06-01
From the whole plant of Dendranthema lavandulifolium, two flavonoides (I, II) and two flavone glycosides (III, IV) were isolated. They were identified as luteolin (I), apigenin (II), 5-hydroxy-4'-methoxy-flavone-7-O-alpha-L-rhamnopyranosyl(1-->6)-beta- D-glucopyranosyl (acaciin III) and 5-hydroxy-4'-methoxy-flavone-7-O-alpha-L-rhamnopyranosyl (1-->6) [2-O-acetyl-beta-D-glucopyranosyl(1-->2)]-beta-D-glucopyranoside (IV) by means of IR, UV, 1H-NMR, 13C-NMR, EI-MS, HRFAB, etc. Among these four compounds, I, II were isolated for the first time from this plant, IV is a new compound.
Enteridinines A and B from slime mold Enteridium lycoperdon.
Rezanka, Tomás; Dvoráková, Radmila; Hanus, Lumír O; Dembitsky, Valery M
2004-02-01
Two novel deoxysugar esters, named enteridinines A and B, were isolated from the slime mold Enteridium lycoperdon. Their structures, including the absolute configurations of the hydroxyl and methyl groups, were determined by means of extensive spectroscopic data such as UV, IR, MS, 1D and 2D NMR spectra. Enteridinines A and B have unique structures containing 1,7-dioxaspiro[5.5]undecanes with an O-beta-D-mycarosyl-(1-->4)-beta-D-olivosyl and an O-beta-L-olivomycosyl-(1-->4)-beta-D-amicetosyl-(1-->4)-beta-L-digitoxosyl unit, respectively, and showed growth inhibitory activities against Gram positive bacteria.
[Chemical constituents from the rhizoma of Arundina graminifolia].
Liu, Mei-feng; Han, Yun; Xing, Dong-ming; Wang, Wei; Xu, Li-zhen; Du, Li-jun; Ding, Yi
2004-02-01
To isolate and elucidate the chemical constituents from the tuber of Arundina graminifolia. The compounds were extracted by 95% alcohol and isolated by column chromatography on silica gel, SephedaxLH-20 and ODS. The structures were determined by UV, IR, NMR and MS spectral analysis. Five compounds were isolated, and their structures were identified as (2E)-, 2-propenoic acid, 3-(4-hydroxy-3-methoxyphenyl)-decosyl ester (I), p-hydroxybenzyl alcohol (II), triacontanol (III) and p-hydroxybenzylethyl ether (IV), 3-hydroxy-5-methoxybibenzyl (V), respectively. All compounds were isolated from the genus of Arundina for the first time.
Flavonoids from the roots of Artocarpus heterophyllus.
Yuan, Wen-Jun; Yuan, Jin-Bin; Peng, Jia-Bing; Ding, Yuan-Qing; Zhu, Ji-Xiao; Ren, Gang
2017-03-01
Four new flavonoids, artoheteroids A-D (1-4), together with six known ones (5-10), were isolated from the roots of Artocarpus heterophyllus. Their structures were elucidated by spectroscopic methods, including 1D and 2D NMR, UV, IR, CD, and HR-ESI-MS. All isolated compounds were screened for their inhibitory abilities against cathepsin K (CatK). Among them, compounds 1-2, 4-6, and 10 were found to have suppression capabilities against CatK with IC 50 values ranging from 1.4 to 93.9μM. Copyright © 2017 Elsevier B.V. All rights reserved.
UV-Enhanced IR Raman System for Identifying Biohazards
NASA Technical Reports Server (NTRS)
Stirbl, Robert; Moynihan, Philip; Lane, Arthur
2003-01-01
An instrumentation system that would include an ultraviolet (UV) laser or light-emitting diode, an infrared (IR) laser, and the equivalent of an IR Raman spectrometer has been proposed to enable noncontact identification of hazardous biological agents and chemicals. In prior research, IR Raman scattering had shown promise as a means of such identification, except that the Raman-scattered light was often found to be too weak to be detected or to enable unambiguous identification in practical applications. The proposed system would utilize UV illumination as part of a two-level optical-pumping scheme to intensify the Raman signal sufficiently to enable positive identification.
Photoabsorption and photodissociation of molecules important in the interstellar medium
NASA Technical Reports Server (NTRS)
Lee, Long C.; Suto, Masako
1991-01-01
The photoabsorption, photodissociation, and fluorescence cross sections of interstellar molecules are measured at 90 to 250 nm. These quantitative optical data are needed for the understanding of the formation and destruction processes of molecules under the intense interstellar UV radiation field. Research covering the following topics is presented: (1) fluorescences from photoexcitation of CH4, CH3OH, and CH3SH; (2) NO gamma emission from photoexcitation of NO; (3) photoexcitation cross sections of aromatic molecules; (4) IR emission from UV excitation of HONO2; (5) IR emission from UV excitation of benzene and methyl-derivitives; and (6) IR emission from UV excitation of polycyclic aromatic hydrocarbon molecules.
Yun, Jisuk; Shin, Kye Jung; Choi, Jangduck; Jo, Cheon-Ho
2018-05-01
A novel sibutramine analogue was detected in a slimming formula by high performance liquid chromatography with a photo diode detector array (HPLC-PDA). The unknown compound exhibited an ultraviolet (UV) spectrum that was similar to that of chlorosibutramine, despite having a different HPLC retention time. Further analysis of the slimming formula by LC-quadrupole time-of-flight mass spectrometry (LC-Q-TOF/MS) showed that the unknown compound had the formula C 18 H 27 Cl 2 N. To elucidate the structure of this new sibutramine analogue, the target compound in the slimming formula was isolated on a preparative-LC system equipped with a PDA. After analysis by fourier transform infrared (FT-IR) and nuclear magnetic resonance (NMR) spectroscopy, the unknown compound was identified as a sibutramine analogue in which the iso-butyl group on the side chain is replaced with an iso-pentyl group. This new sibutramine analogue was identified to be 1-(1-(3,4-dichlorophenyl)cyclobutyl)-N,N,4-trimethylpentan-1-amine and has been named as chlorosipentramine. Copyright © 2018 Elsevier B.V. All rights reserved.
Singh, Yashpal; Garg, M K; Tandon, Nikhil; Marwaha, Raman Kumar
2013-01-01
Insulin resistance (IR) and associated metabolic abnormalities are increasingly being reported in the adolescent population. Cut-off value of homeostasis model of assessment IR (HOMA-IR) as an indicator of metabolic syndrome (MS) in adolescents has not been established. This study aimed to investigate IR by HOMA-IR in urban Indian adolescents and to establish cut-off values of HOMA-IR for defining MS. A total of 691 apparently healthy adolescents (295 with normal body mass index (BMI), 205 overweight, and 199 obese) were included in this cross-sectional study. MS in adolescents was defined by International Diabetes Federation (IDF) and Adult Treatment Panel III (ATP III) criteria. IR was calculated using the HOMA model. Mean height, waist circumference (WC), waist/hip ratio (WHR), waist/height ratio (WHtR), and blood pressure were significantly higher in boys as compared to girls. The HOMA-IR values increased progressively from normal weight to obese adolescents in both sexes. Mean HOMA-IR values increased progressively according to sexual maturity rating in both sexes. HOMA-IR value of 2.5 had a sensitivity of >70% and specificity of >60% for MS. This cut-off identified larger number of adolescents with MS in different BMI categories (19.7% in normal weight, 51.7% in overweight, and 77.0% in obese subjects) as compared to the use of IDF or ATP III criteria for diagnosing MS. Odds ratio for having IR (HOMA-IR of >2.5) was highest with WHtR (4.9, p p<0.0001) and WC (4.8, p p<0.0001), compared to WHR (3.3, p p<0.0001). In Indian adolescents, HOMA-IR increased with sexual maturity and with progression from normal to obese. A HOMA-IR cut-off of 2.5 provided the maximum sensitivity and specificity in diagnosing MS in both genders as per ATP III and IDF criteria.
Singh, Yashpal; Garg, MK; Tandon, Nikhil; Marwaha, Raman Kumar
2013-01-01
Objective: Insulin resistance (IR) and associated metabolic abnormalities are increasingly being reported in the adolescent population. Cut-off value of homeostasis model of assessment IR (HOMA-IR) as an indicator of metabolic syndrome (MS) in adolescents has not been established. This study aimed to investigate IR by HOMA-IR in urban Indian adolescents and to establish cut-off values of HOMA-IR for defining MS. Methods: A total of 691 apparently healthy adolescents (295 with normal body mass index (BMI), 205 overweight, and 199 obese) were included in this cross-sectional study. MS in adolescents was defined by International Diabetes Federation (IDF) and Adult Treatment Panel III (ATP III) criteria. IR was calculated using the HOMA model. Results: Mean height, waist circumference (WC), waist/hip ratio (WHR), waist/height ratio (WHtR), and blood pressure were significantly higher in boys as compared to girls. The HOMA-IR values increased progressively from normal weight to obese adolescents in both sexes. Mean HOMA-IR values increased progressively according to sexual maturity rating in both sexes. HOMA-IR value of 2.5 had a sensitivity of >70% and specificity of >60% for MS. This cut-off identified larger number of adolescents with MS in different BMI categories (19.7% in normal weight, 51.7% in overweight, and 77.0% in obese subjects) as compared to the use of IDF or ATP III criteria for diagnosing MS. Odds ratio for having IR (HOMA-IR of >2.5) was highest with WHtR (4.9, p <0.0001) and WC (4.8, p <0.0001), compared to WHR (3.3, p <0.0001). Conclusions: In Indian adolescents, HOMA-IR increased with sexual maturity and with progression from normal to obese. A HOMA-IR cut-off of 2.5 provided the maximum sensitivity and specificity in diagnosing MS in both genders as per ATP III and IDF criteria. Conflict of interest:None declared. PMID:24379034
Synthesis of photochromic oligophenylenimines: optical and computational studies.
Pérez, Armando I Martínez; Alonso, Oscar Coreño; Borbolla, Julián Cruz; Vásquez-Pérez, José M; Alonso, Juan Coreño; Ayala, Karina Alemán; Luna-Bárcenas, Gabriel; Pandiyan, Thangarasu; García, Rosa A Vázquez
2015-03-27
Phenyleneimine oligomers 4,4'-(((1E,1'E)-(((1E,1'E)-(1,4-phenylenebis-(azanylylidene))bis(methanylylidene))bis(2,5-bis(octyloxy)-4,1-phenylene))bis(methanylyl-idene))-bis(azanylylidene))dianiline (OIC1MS) and 7,7'-(((1E,1'E)-(((1E,1'E)-((9H-fluorene-2,7-diyl)bis(azanylylidene))bis(methanylylidene))bis(2,5-bis(octyloxy)-4,1phenylene))bis- (methanylylidene))bis(azanylylidene))bis(9H-fluoren-2-amine) (OIC2MS) were prepared by means of conventional and mechanochemical synthesis and characterized by FT-IR, 1H- and 13C-NMR techniques. The optical properties of the compounds were studied in solution by using UV-visible spectroscopy, and the optical effects were analyzed as a function of solvent. The results show that OIC2MS exhibits interesting photochromic properties. Furthermore, the structural and electronic properties of the compounds were analyzed by TD-DFT. It was found that the mechanosynthesis is an efficient method for the synthesis of both tetraimines.
Feasibility of the silver-UV process for drinking water disinfection.
Butkus, Michael A; Talbot, Mark; Labare, Michael P
2005-12-01
A synergistic effect between cationic silver and UV radiation (silver-UV disinfection) has been observed that can appreciably enhance inactivation of viruses. The purpose of this work was to assess the feasibility of this technique for drinking water disinfection and evaluate the effects of selected impurities, found in fresh water, and common parameters on inactivation of the coliphage MS-2 with the silver-UV process. Turbidity (kaolin), calcium hardness, carbonate alkalinity, and pH did not significantly degrade inactivation. Inactivation was reduced in the presence of chloride, at concentrations greater than 30 mg/L, and in water samples with UV-254 absorbance values greater than ca. 0.1 cm(-1). Inactivation of MS-2 with silver-UV disinfection was also reduced at high phosphate concentrations (above ca. 5 mM). Silver-UV inactivation of MS-2 increased with increases in temperature between 10 and 20 degrees C. Silver-UV inactivation of MS-2 was increased by greater than 1-log over UV alone, in two untreated fresh water sources, which indicates that silver-UV may be a viable treatment technology. An assessment of operation and management costs suggests that an increase in inactivation of MS-2 with silver-UV disinfection could be economically beneficial.
Metabolic syndrome in Mexican children: Low effectiveness of diagnostic definitions.
Peña-Espinoza, Barbara Itzel; Granados-Silvestre, María de Los Ángeles; Sánchez-Pozos, Katy; Ortiz-López, María Guadalupe; Menjivar, Marta
Early identification of children with metabolic syndrome (MS) is essential to decrease the risk of developing diabetes and cardiovascular disease in adulthood. Detection of MS is however challenging because of the different definitions for diagnosis; as a result, preventive actions are not taken in some children at risk. The study objective was therefore to compare prevalence of MS in children according to the IDF, NCEP-ATP-III, Cook, de Ferranti and Weiss definitions, considering insulin resistance (IR) markers such as HOMA-IR and/or metabolic index (MI). A total of 508 Mexican children (aged 9 to 13 years) from seven schools were enrolled in a cross-sectional study. Somatometric, biochemical, and hormonal measurements were evaluated. Frequency of MS was 2.4-45.9% depending on the definition used. Frequency of IR in children not diagnosed with MS was 12.4-25.2% using HOMA-IR and 4.0-16.3% using MI. When HOMA-IR or MI was included in each of the definitions, frequency of MS was 8.5-50.2% and 7.7-46.9% respectively. The kappa value including HOMA-IR and/or MI was greater than 0.8. This study demonstrated the poor effectiveness of the current criteria used to diagnose MS in Mexican children, as shown by the variability in the definitions and by the presence of IR in children who not diagnosed with MS. Inclusion of HOMA-IR and/or MI in definitions of MS (thus increasing agreement between them) decreases the chance of excluding children at risk and allows for MS prevalence between populations. Copyright © 2017 SEEN y SED. Publicado por Elsevier España, S.L.U. All rights reserved.
Park, Ah Yeon; Park, So-Young; Lee, Jaehyun; Jung, Mihye; Kim, Jinwoong; Kang, Sam Sik; Youm, Jeong-Rok; Han, Sang Beom
2009-10-01
Rapid, simple and reliable HPLC/UV and LC-ESI-MS/MS methods for the simultaneous determination of five active coumarins of Angelicae dahuricae Radix, byakangelicol (1), oxypeucedanin (2), imperatorin (3), phellopterin (4) and isoimperatorin (5) were developed and validated. The separation condition for HPLC/UV was optimized using a Develosil RPAQUEOUS C(30) column using 70% acetonitrile in water as the mobile phase. This HPLC/UV method was successful for providing the baseline separation of the five coumarins with no interfering peaks detected in the 70% ethanol extract of Angelicae dahuricae Radix. The specific determination of the five coumarins was also accomplished by a triple quadrupole tandem mass spectrometer equipped with an electrospray ionization source (LC-ESI-MS/MS). Multiple reaction monitoring (MRM) in the positive mode was used to enhance the selectivity of detection. The LC-ESI-MS/MS methods were successfully applied for the determination of the five major coumarins in Angelicae dahuricae Radix. These HPLC/UV and LC-ESI-MS/MS methods were validated in terms of recovery, linearity, accuracy and precision (intra- and inter-day validation). Taken together, the shorter analysis time involved makes these HPLC/UV and LC-ESI-MS/MS methods valuable for the commercial quality control of Angelicae dahuricae Radix extracts and its pharmaceutical preparations. Copyright (c) 2009 John Wiley & Sons, Ltd.
Low cost, patterning of human hNT brain cells on parylene-C with UV & IR laser machining.
Raos, Brad J; Unsworth, C P; Costa, J L; Rohde, C A; Doyle, C S; Delivopoulos, E; Murray, A F; Dickinson, M E; Simpson, M C; Graham, E S; Bunting, A S
2013-01-01
This paper describes the use of 800nm femtosecond infrared (IR) and 248nm nanosecond ultraviolet (UV) laser radiation in performing ablative micromachining of parylene-C on SiO2 substrates for the patterning of human hNT astrocytes. Results are presented that support the validity of using IR laser ablative micromachining for patterning human hNT astrocytes cells while UV laser radiation produces photo-oxidation of the parylene-C and destroys cell patterning. The findings demonstrate how IR laser ablative micromachining of parylene-C on SiO2 substrates can offer a low cost, accessible alternative for rapid prototyping, high yield cell patterning.
Ren, Tiegang; Liu, Shuyun; Li, Guihui; Zhang, Jinglai; Guo, Jia; Li, Weijie; Yang, Lirong
2012-11-01
A series of novel bis-Schiff base were synthesized from 1-aryl-3-methyl-4-benzoyl-5-pyrazolones and diethylenetriamine (or triethylenetetramine) as the starting materials. All of these bis-Schiff bases were characterized by means of NMR, IR, and MS. The UV-vis absorption spectra and fluorescent spectra of these bis-Schiff bases were also measured. Moreover, the B3LYP/6-31G(d) method was used to optimize the ground state geometry of the bis-Schiff bases; and the UV-vis spectroscopic properties of the products were computed and compared with corresponding experimental data based on cc-pVDZ basis set of TD-B3LYP method. It has been found that all of these bis-Schiff bases show a remarkable absorption peak in a wavelength range of 270-340 nm; and their maximum emission peaks are around 348 nm. Copyright © 2012 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Law, Ka-Hei; Gordon, Karl D.; Misselt, Karl A.
2018-06-01
Understanding the properties of stellar populations and interstellar dust has important implications for galaxy evolution. In normal star-forming galaxies, stars and the interstellar medium dominate the radiation from ultraviolet (UV) to infrared (IR). In particular, interstellar dust absorbs and scatters UV and optical light, re-emitting the absorbed energy in the IR. This is a strongly nonlinear process that makes independent studies of the UV-optical and IR susceptible to large uncertainties and degeneracies. Over the years, UV to IR spectral energy distribution (SED) fitting utilizing varying approximations has revealed important results on the stellar and dust properties of galaxies. Yet the approximations limit the fidelity of the derived properties. There is sufficient computer power now available that it is now possible to remove these approximations and map out of landscape of galaxy SEDs using full dust radiative transfer. This improves upon previous work by directly connecting the UV, optical, and IR through dust grain physics. We present the DIRTYGrid, a grid of radiative transfer models of SEDs of dusty stellar populations in galactic environments designed to span the full range of physical parameters of galaxies. Using the stellar and gas radiation input from the stellar population synthesis model PEGASE, our radiative transfer model DIRTY self-consistently computes the UV to far-IR/sub-mm SEDs for each set of parameters in our grid. DIRTY computes the dust absorption, scattering, and emission from the local radiation field and a dust grain model, thereby physically connecting the UV-optical to the IR. We describe the computational method and explain the choices of parameters in DIRTYGrid. The computation took millions of CPU hours on supercomputers, and the SEDs produced are an invaluable tool for fitting multi-wavelength data sets. We provide the complete set of SEDs in an online table.
Optical radiation in modern medicine
Sowa, Paweł; Rutkowska-Talipska, Joanna; Rutkowski, Krzysztof; Kosztyła-Hojna, Bożena
2013-01-01
Optical radiation extends between microwaves and X-rays of the electromagnetic radiation and includes ultraviolet (UV), visible light (VL) and infrared (IR) components. The dose of radiation that reaches the skin is influenced by the ozone layer, position of the Sun, latitude, altitude, cloud cover and ground reflections. The photobiological effects of UV, VL and IR bands depend on their wavelength, frequency and mechanism of action. They are modified by the thickness, structure, vasculature and pigmentation of skin's stratum corneum, epidermis and dermis. Following absorption, IR affects the body mainly through transfer of thermal energy to tissues. Visible light and skin interact either thermally or photochemically, whereas UV acts mainly photochemically. Optical radiation in the form of sunlight therapy had been used already in ancient times. Nowadays IR, VL and UV are widely applied in the therapy of allergic, dermatological, cardiovascular, respiratory, rheumatic, neonatal, pediatric and psychiatric disorders. PMID:24278082
The JLab high power ERL light source
NASA Astrophysics Data System (ADS)
Neil, G. R.; Behre, C.; Benson, S. V.; Bevins, M.; Biallas, G.; Boyce, J.; Coleman, J.; Dillon-Townes, L. A.; Douglas, D.; Dylla, H. F.; Evans, R.; Grippo, A.; Gruber, D.; Gubeli, J.; Hardy, D.; Hernandez-Garcia, C.; Jordan, K.; Kelley, M. J.; Merminga, L.; Mammosser, J.; Moore, W.; Nishimori, N.; Pozdeyev, E.; Preble, J.; Rimmer, R.; Shinn, M.; Siggins, T.; Tennant, C.; Walker, R.; Williams, G. P.; Zhang, S.
2006-02-01
A new THz/IR/UV photon source at Jefferson Lab is the first of a new generation of light sources based on an Energy-Recovered, (superconducting) Linac (ERL). The machine has a 160 MeV electron beam and an average current of 10 mA in 75 MHz repetition rate hundred femtosecond bunches. These electron bunches pass through a magnetic chicane and therefore emit synchrotron radiation. For wavelengths longer than the electron bunch the electrons radiate coherently a broadband THz ˜ half cycle pulse whose average brightness is >5 orders of magnitude higher than synchrotron IR sources. Previous measurements showed 20 W of average power extracted [Carr, et al., Nature 420 (2002) 153]. The new facility offers simultaneous synchrotron light from the visible through the FIR along with broadband THz production of 100 fs pulses with >200 W of average power. The FELs also provide record-breaking laser power [Neil, et al., Phys. Rev. Lett. 84 (2000) 662]: up to 10 kW of average power in the IR from 1 to 14 μm in 400 fs pulses at up to 74.85 MHz repetition rates and soon will produce similar pulses of 300-1000 nm light at up to 3 kW of average power from the UV FEL. These ultrashort pulses are ideal for maximizing the interaction with material surfaces. The optical beams are Gaussian with nearly perfect beam quality. See www.jlab.org/FEL for details of the operating characteristics; a wide variety of pulse train configurations are feasible from 10 ms long at high repetition rates to continuous operation. The THz and IR system has been commissioned. The UV system is to follow in 2005. The light is transported to user laboratories for basic and applied research. Additional lasers synchronized to the FEL are also available. Past activities have included production of carbon nanotubes, studies of vibrational relaxation of interstitial hydrogen in silicon, pulsed laser deposition and ablation, nitriding of metals, and energy flow in proteins. This paper will present the status of the system and discuss some of the discoveries we have made concerning the physics performance, design optimization, and operational limitations of such a first generation high power ERL light source.
Homocysteine is the confounding factor of metabolic syndrome-confirmed by siMS score.
Srećković, Branko; Soldatovic, Ivan; Colak, Emina; Mrdovic, Igor; Sumarac-Dumanovic, Mirjana; Janeski, Hristina; Janeski, Nenad; Gacic, Jasna; Dimitrijevic-Sreckovic, Vesna
2018-04-06
Abdominal adiposity has a central role in developing insulin resistance (IR) by releasing pro-inflammatory cytokines. Patients with metabolic syndrome (MS) have higher values of homocysteine. Hyperhomocysteinemia correlates with IR, increasing the oxidative stress. Oxidative stress causes endothelial dysfunction, hypertension and atherosclerosis. The objective of the study was to examine the correlation of homocysteine with siMS score and siMS risk score and with other MS co-founding factors. The study included 69 obese individuals (age over 30, body mass index [BMI] >25 kg/m2), classified into two groups: I-with MS (33 patients); II-without MS (36 patients). Measurements included: anthropometric parameters, lipids, glucose regulation parameters and inflammation parameters. IR was determined by homeostatic model assessment for insulin resistance (HOMA-IR). ATP III classification was applied for diagnosing MS. SiMS score was used as continuous measure of metabolic syndrome. A significant difference between groups was found for C-reactive protein (CRP) (p<0.01) apolipoprotein (Apo) B, HOMA-IR and acidum uricum (p<0.05). siMS risk score showed a positive correlation with homocysteine (p=0.023), while siMS score correlated positively with fibrinogen (p=0.013), CRP and acidum uricum (p=0.000) and homocysteine (p=0.08). Homocysteine correlated positively with ApoB (p=0.036), HbA1c (p=0.047), HOMA-IR (p=0.008) and negatively with ApoE (p=0.042). Correlation of siMS score with homocysteine, fibrinogen, CRP and acidum uricum indicates that they are co-founding factors of MS. siMS risk score correlation with homocysteine indicates that hyperhomocysteinemia increases with age. Hyperhomocysteinemia is linked with genetic factors and family nutritional scheme, increasing the risk for atherosclerosis.
Increased prevalence of metabolic syndrome in non-obese asian Indian-an urban-rural comparison.
Mahadik, S R; Deo, S S; Mehtalia, S D
2007-06-01
In the present study we evaluated the association of insulin resistance (IR) with different components of Metabolic Syndrome (MS) in an Asian Indian population, and performed a comparative study between urban and rural populations of India. A Total of 267 urban men and women aged 25-70 years participated in this study. RESULTS were compared with rural data from a previously published study. Fasting serum insulin, uric acid, and lipid profile were measured along with fasting and 2 hour plasma glucose. Association of MS and IR was studied by using univariate regression analysis. Prevalence of MS was significantly higher in the urban population compared to that of the rural population (35.2% vs 20.6%, chi(2) = 23.2, p < 0.001). Calculated insulin resistence (HOMA-IR) was common in MS group of both populations. Percentage prevalence of IR was high and almost the same in both population (42%). Percentage prevalence of abdominal obesity and hypertriglyceridemia was significantly higher in the urban population compared to the rural population. Linear regression analysis of IR significantly correlated with different components of MS of both the population. The significant finding of the present study was that the rural population exhibited a high prevalence of MS and IR, though nonobese. IR correlated with components of MS not only in the urban but also in the rural population. To reduce the incidence of Type 2 Diabetes (T2DM) and cardiovascular disease (CVD) in our populations, early identification of populations at risk based on prevalence of MS and IR will become of prime importance.
Extending Supernova Spectral Templates for Next Generation Space Telescope Observations
NASA Astrophysics Data System (ADS)
Roberts-Pierel, Justin; Rodney, Steven A.; Steven Rodney
2018-01-01
Widely used empirical supernova (SN) Spectral Energy Distributions (SEDs) have not historically extended meaningfully into the ultraviolet (UV), or the infrared (IR). However, both are critical for current and future aspects of SN research including UV spectra as probes of poorly understood SN Ia physical properties, and expanding our view of the universe with high-redshift James Webb Space Telescope (JWST) IR observations. We therefore present a comprehensive set of SN SED templates that have been extended into the UV and IR, as well as an open-source software package written in Python that enables a user to generate their own extrapolated SEDs. We have taken a sampling of core-collapse (CC) and Type Ia SNe to get a time-dependent distribution of UV and IR colors (U-B,r’-[JHK]), and then generated color curves are used to extrapolate SEDs into the UV and IR. The SED extrapolation process is now easily duplicated using a user’s own data and parameters via our open-source Python package: SNSEDextend. This work develops the tools necessary to explore the JWST’s ability to discriminate between CC and Type Ia SNe, as well as provides a repository of SN SEDs that will be invaluable to future JWST and WFIRST SN studies.
da Silva, Rodolfo R; Moraes, Marcilio M; Camara, Claudio A G; Ramos, Clécio S
2015-11-01
This present work addresses research on the discovery of new compounds from natural sources. It is based on a study of Mangifera indica leaf metabolism by the Tropidacris collaris grasshopper. We found that the grasshopper hydrolyzed the flavonoid isoquercitrin to quercetin when the O-glycosidic bond was broken and sugar released as a probable energy source for the insect. There was not, however, hydrolysis of the major compound in the leaves, mangiferin, which contains the C-glycosidic bond. All compounds were isolated and their chemical structure determined by UV, IR, MS, 1H and 13C NMR.
Pestalactams A-C: novel caprolactams from the endophytic fungus Pestalotiopsis sp.
Davis, Rohan A; Carroll, Anthony R; Andrews, Katherine T; Boyle, Glen M; Tran, Truc Linh; Healy, Peter C; Kalaitzis, John A; Shivas, Roger G
2010-04-21
Chemical investigations of a fermentation culture from the endophytic fungus Pestalotiopsis sp. yielded three novel caprolactams, pestalactams A-C (). The structures of were determined by analysis of 1D and 2D-NMR, UV, IR, and MS data. The structure of pestalactam A was confirmed following single crystal X-ray diffraction analysis. Pestalactams A-C are the first C-7 alkylated caprolactam natural products to be reported. Pestalactams A () and B () were tested against two different strains of the malaria parasite Plasmodium falciparum (3D7 and Dd2), and the mammalian cell lines, MCF-7 and NFF, and showed modest in vitro activity in all assays.
Spectral, coordination and thermal properties of 5-arylidene thiobarbituric acids
NASA Astrophysics Data System (ADS)
Masoud, Mamdouh S.; El-Marghany, Adel; Orabi, Adel; Ali, Alaa E.; Sayed, Reham
2013-04-01
Synthesis of 5-arylidine thiobarbituric acids containing different functional groups with variable electronic characters were described and their Co2+, Ni2+ and Cu2+ complexes. The stereochemistry and mode of bonding of 5-(substituted benzylidine)-2-TBA complexes were achieved based on elemental analysis, spectral (UV-VIS, IR, 1H NMR, MS), magnetic susceptibility and conductivity measurements. The ligands were of bidentate and tridentate bonding through S, N and O of pyrimidine nucleolus. All complexes were of octahedral configuration. The thermal data of the complexes pointed to their stability. The mechanism of the thermal decomposition is discussed. The thermodynamic parameters of the dissociation steps were evaluated and discussed.
[Phenanthrene constituents from rhizome of Arundina graminifolia].
Liu, Mei-feng; Ding, Yi; Zhang, Dong-ming
2005-03-01
To isolate and elucidate the constituents from rhizome of Arundina graminifolia. Theconstituents were extracted with 95% alcohol and isolated by chromatography on silica gel, Sephedax LH-20. The structures were determined by UV, IR, NMR and MS spectral analysis. Five phenanthrene constituents were identified as 7-hydroxy-2, 4-dimethoxy-9, 10-dihydrophenanthrene( I ), 4, 7-dihydroxy-2-methoxy-9, 10-dihydrophenanthrene ( II ), 2, 7-dihydroxy-4-methoxy-9, 10-dihydrophenanthrene ( III ), 7-hydroxy-2-methoxyphenanthrene-1,4-dione ( IV ), 7-hydroxy-2-methoxy-9, 10-dihydrophenanthrene-1,4-dione (V), respectively. All compounds were isolated from rhizome of A. graminifolia for the first time.
Trujillo, Verónica; Durando, Patricia E; Suárez, Marta M
2016-01-01
Early-life adversity can lead to long-term consequence persisting into adulthood. Here, we assess the implications of an adverse early environment on vulnerability to stress during adulthood. We hypothesized that the interplay between early and late stress would result in a differential phenotype regarding the number of neurons immunoreactive for glucocorticoid receptor (GR-ir) and neuronal activity as assessed by Fos immunoreactivity (Fos-ir) in brain areas related to stress responses and anxiety-like behavior. We also expected that the antidepressant tianeptine could correct some of the alterations induced in our model. Male Wistar rats were subjected to daily maternal separation (MS) for 4.5 h during the first 3 weeks of life. As adults, the rats were exposed to chronic stress for 24 d and they were treated daily with tianeptine (10 mg/kg intraperitoneal) or vehicle (isotonic saline). Fos-ir was increased by MS in all structures analyzed. Chronic stress reduced Fos-ir in the hippocampus, but increased it in the paraventricular nucleus. Furthermore, chronic stress increased GR-ir in hippocampus (CA1) and amygdala in control non-MS rats. By contrast, when MS and chronic stress were combined, GR-ir was decreased in these structures. Additionally, whereas tianeptine did not affect Fos-ir, it regulated GR-ir in a region-dependent manner, in hippocampus and amygdala opposing in some cases the stress or MS effects. Furthermore, tianeptine reversed the MS- or stress-induced anxious behavior. The interplay between MS and chronic stress observed indicates that MS rats have a modified phenotype, which is expressed when they are challenged by stress in later life.
NASA Astrophysics Data System (ADS)
Yuan, Fang-Ting; Argudo-Fernández, María; Shen, Shiyin; Hao, Lei; Jiang, Chunyan; Yin, Jun; Boquien, Médéric; Lin, Lihwai
2018-05-01
We investigate the star formation history and the dust attenuation in the galaxy merger Mrk 848. Thanks to the multiwavelength photometry from the ultraviolet (UV) to the infrared (IR), and MaNGA's integral field spectroscopy, we are able to study this merger in a detailed way. We divide the whole merger into the core and tail regions, and fit both the optical spectrum and the multi-band spectral energy distribution (SED) to models to obtain the star formation properties for each region respectively. We find that the color excess of stars in the galaxy E(B-V)sSED measured with the multi-band SED fitting is consistent with that estimated both from the infrared excess (the ratio of IR to UV flux) and from the slope of the UV continuum. Furthermore, the reliability of the E(B-V)sSED is examined with a set of mock SEDs, showing that the dust attenuation of the stars can be well constrained by the UV-to-IR broadband SED fitting. The dust attenuation obtained from optical continuum E(B-V)sspec is only about half of E(B-V)sSED. The ratio of the E(B-V)sspec to the E(B-V)g obtained from the Balmer decrement is consistent with the local value (around 0.5). The difference between the results from the UV-to-IR data and the optical data is consistent with the picture that younger stellar populations are attenuated by an extra dust component from the birth clouds compared to older stellar populations which are only attenuated by the diffuse dust. Both with the UV-to-IR SED fitting and the spectral fitting, we find that there is a starburst younger than 100 Myr in one of the two core regions, consistent with the scenario that the interaction-induced gas inflow can enhance the star formation in the center of galaxies.
Zong, Shuai; Li, Lan; Li, Jinglei; Shaikh, Farnaz; Yang, Liu; Ye, Ming
2017-06-01
In the present study, an intracellular melanin, named LIM205, was separated from Lachnum YM205 mycelia and was purified on a Sephadex G-15 column. The molecular weight of LIM205 was determined as 522 Da, and its molecular formula was speculated as C 28 H 14 N 2 O 7 S. The possible chemical structure of LIM205 was determined according to the results of Fourier transform infrared (FT-IR), 1 H NMR, 13 C NMR, and pyrolysis/GC-MS analysis. With the aim to increase its water solubility, its carboxymethylated derivative, named CLIM205, was formed by the substitution of hydrogen atoms in LIM205 with one, two, and three carboxymethylate groups. FT-IR, UV, and ESI-MS analysis demonstrated that the carboxymethylate groups were conjugated onto LIM205. The lead detoxification activities of LIM205 and CLIM205 had also been investigated. In vivo test showed that both LIM205 and CLIM205 reduced the tissue lead concentration, enhanced lead excretion, and reversed lead-induced alterations in superoxide dismutase (SOD), glutathione peroxidase (GSH-Px), and malondialdehyde (MDA) concentrations in mice, with CLIM205 showed better efficacy. The study indicates that LIM205 and CLIM205 have significant lead detoxification effect which will contribute to solve related problems.
Electrochemistry and spectroelectrochemistry of bioactive hydroxyquinolines: a mechanistic study.
Sokolová, Romana; Nycz, Jacek E; Ramešová, Šárka; Fiedler, Jan; Degano, Ilaria; Szala, Marcin; Kolivoška, Viliam; Gál, Miroslav
2015-05-21
The oxidation mechanism of selected hydroxyquinoline carboxylic acids such as 8-hydroxyquinoline-7-carboxylic acid (1), the two positional isomers 2-methyl-8-hydroxyquinoline-7-carboxylic acid (3) and 2-methyl-5-hydroxyquinoline-6-carboxylic acid (4), as well as other hydroxyquinolines were studied in aprotic environment using cyclic voltammetry, controlled potential electrolysis, in situ UV-vis and IR spectroelectrochemistry, and HPLC-MS/MS techniques. IR spectroelectrochemistry showed that oxidation unexpectedly proceeds together with protonation of the starting compound. We proved that the nitrogen atom in the heterocycle of hydroxyquinolines is protonated during the apparent 0.7 electron oxidation process. This was rationalized by the autodeprotonation reaction by another two starting molecules of hydroxyquinoline, so that the overall oxidation mechanism involves two electrons and three starting molecules. Both the electrochemical and spectroelectrochemical results showed that the oxidation mechanism is not influenced by the presence of the carboxylic group in the chemical structure of hydroxyquinolines, as results from oxidation of 2,7-dimethyl-5-hydroxyquinoline (6). In the presence of a strong proton acceptor such as pyridine, the oxidation ECEC process involves two electrons and two protons per one molecule of the hydroxyquinoline derivative. The electron transfer efficiency of hydroxyquinolines in biosystems may be related to protonation of biocompounds containing nitrogen bases. Molecular orbital calculations support the experimental findings.
Properties of infrared extrapolations in a harmonic oscillator basis
Coon, Sidney A.; Kruse, Michael K. G.
2016-02-22
Here, the success and utility of effective field theory (EFT) in explaining the structure and reactions of few-nucleon systems has prompted the initiation of EFT-inspired extrapolations to larger model spaces in ab initio methods such as the no-core shell model (NCSM). In this contribution, we review and continue our studies of infrared (ir) and ultraviolet (uv) regulators of NCSM calculations in which the input is phenomenological NN and NNN interactions fitted to data. We extend our previous findings that an extrapolation in the ir cutoff with the uv cutoff above the intrinsic uv scale of the interaction is quite successful,more » not only for the eigenstates of the Hamiltonian but also for expectation values of operators, such as r 2, considered long range. The latter results are obtained with Hamiltonians transformed by the similarity renormalization group (SRG) evolution. On the other hand, a possible extrapolation of ground state energies in the uv cutoff when the ir cutoff is below the intrinsic ir scale is not robust and does not agree with the ir extrapolation of the same data or with independent calculations using other methods.« less
Characterization and comparison of Fumonisin B(1)-protein conjugates by six methods.
Wang, Ying; He, Cheng-Hua; Zheng, Hao; Zhang, Hai-Bin
2012-01-01
In order to generate an antibody against a small hapten molecule, the hapten is cross-linked with carrier protein to make it immunogenic. In this study, the hapten (Fumonisin B(1), FB(1)) was coupled to ovalbumin (OVA) and bovine serum albumin (BSA), respectively by a short cross-linker reagent (glutaraldehyde, GA). To develop a technique for detecting the conjugation, the hapten-protein conjugates (FB(1)-OVA and FB(1)-BSA) were characterized thoroughly by ultraviolet (UV) spectroscopy, Fourier transform infrared (FT-IR) spectroscopy, gel electrophoresis and matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), respectively. The molecular weights of FB(1)-BSA and FB(1)-OVA were 74,355.301 Da and 48,009.212 Da, respectively determined by the method of MALDI-TOF-MS. The molecular coupling ratios were 11 and 5 in FB(1)-BSA and FB(1)-OVA, respectively. In this experiment, MALDI-TOF-MS was selected as the most efficient method to evaluate the cross-linking effect and calculate the molecular coupling ratio.
White organic light-emitting diodes utilized by near UV-deep blue emitter and exciplex emission.
Park, Young Wook; Kim, Young Min; Choi, Jin Hwan; Park, Tae Hyun; Choi, Hyun Ju; Yu, Hong Jung; Cho, Min Ju; Choi, Dong Hoon; Kim, Sung Hyun; Ju, Byeong Kwon
2011-02-01
Numerous investigations have been made into the development of wide color gamut displays for deep-blue OLEDs, including the RGB sub pixels, and white OLEDs (WOLEDs). One of the well known deep-blue emissive dopants, tris(phenyl-methyl-benzimidazolyl)iridium(III) [Ir(pmb)3], successfully introduced its fascinating color coordinate of Commission Internationale de l'Eclairage (CIE) 1931 (0.17, 0.06), however there have been no reports utilizing its accomplishments as WOLEDs. In this report, using only one phosphorescent dopant, the near UV-deep blue emissive Ir(pmb)3, the WOLEDs having the CIE 1931 coordinate of (0.33, 0.38) at 100 cd/m2 with a color rendering index of 85 are demonstrated. The white emission of the fabricated OLEDs are oriented from the near UV-deep blue emission of Ir(pmb)3 and the successfully controlled exciplex emission, between the Ir(pmb)3-host, and the Ir(pmb)3-interfaced material.
2013-01-01
Objective The aim of this study is to assess the association between the degree of insulin resistance and the different components of the metabolic syndrome among Chinese children and adolescents. Moreover, to determine the cut-off values for homeostasis model assessment of insulin resistance (HOMA-IR) at MS risk. Methods 3203 Chinese children aged 6 to 18 years were recruited. Anthropometric and biochemical parameters were measured. Metabolic syndrome (MS) was identified by a modified Adult Treatment Panel III (ATP III) definition. HOMA-IR index was calculated and the normal reference ranges were defined from the healthy participants. Receiver operating characteristic (ROC) analysis was used to find the optimal cutoff of HOMA-IR for diagnosis of MS. Results With the increase of insulin resistance (quintile of HOMA-IR value), the ORs of suffering MS or its related components were significantly increased. Participants in the highest quintile of HOMA-IR were about 60 times more likely to be classified with metabolic syndrome than those in the lowest quintile group. Similarly, the mean values of insulin and HOMA-IR increased with the number of MS components. The present HOMA-IR cutoff point corresponding to the 95th percentile of our healthy reference children was 3.0 for whole participants, 2.6 for children in prepubertal stage and 3.2 in pubertal period, respectively. The optimal point for diagnosis of MS was 2.3 in total participants, 1.7 in prepubertal children and 2.6 in pubertal adolescents, respectively, by ROC curve, which yielded high sensitivity and moderate specificity for a screening test. According to HOMA-IR > 3.0, the prevalence of insulin resistance in obese or MS children were 44.3% and 61.6% respectively. Conclusions Our data indicates insulin resistance is common among Chinese obese children and adolescents, and is strongly related to MS risk, therefore requiring consideration early in life. As a reliable measure of insulin resistance and assessment of MS risk, the optimal HOMA-IR cut-off points in this cohort were developed with variation regarding puberty. HOMA-IR may be useful for early evaluating insulin resistance in children and teenagers and could have a long-term benefit of preventive and diagnostic therapeutic intervention. PMID:24228769
Yin, Jinhua; Li, Ming; Xu, Lu; Wang, Ying; Cheng, Hong; Zhao, Xiaoyuan; Mi, Jie
2013-11-15
The aim of this study is to assess the association between the degree of insulin resistance and the different components of the metabolic syndrome among Chinese children and adolescents. Moreover, to determine the cut-off values for homeostasis model assessment of insulin resistance (HOMA-IR) at MS risk. 3203 Chinese children aged 6 to 18 years were recruited. Anthropometric and biochemical parameters were measured. Metabolic syndrome (MS) was identified by a modified Adult Treatment Panel III (ATP III) definition. HOMA-IR index was calculated and the normal reference ranges were defined from the healthy participants. Receiver operating characteristic (ROC) analysis was used to find the optimal cutoff of HOMA-IR for diagnosis of MS. With the increase of insulin resistance (quintile of HOMA-IR value), the ORs of suffering MS or its related components were significantly increased. Participants in the highest quintile of HOMA-IR were about 60 times more likely to be classified with metabolic syndrome than those in the lowest quintile group. Similarly, the mean values of insulin and HOMA-IR increased with the number of MS components. The present HOMA-IR cutoff point corresponding to the 95th percentile of our healthy reference children was 3.0 for whole participants, 2.6 for children in prepubertal stage and 3.2 in pubertal period, respectively. The optimal point for diagnosis of MS was 2.3 in total participants, 1.7 in prepubertal children and 2.6 in pubertal adolescents, respectively, by ROC curve, which yielded high sensitivity and moderate specificity for a screening test. According to HOMA-IR > 3.0, the prevalence of insulin resistance in obese or MS children were 44.3% and 61.6% respectively. Our data indicates insulin resistance is common among Chinese obese children and adolescents, and is strongly related to MS risk, therefore requiring consideration early in life. As a reliable measure of insulin resistance and assessment of MS risk, the optimal HOMA-IR cut-off points in this cohort were developed with variation regarding puberty. HOMA-IR may be useful for early evaluating insulin resistance in children and teenagers and could have a long-term benefit of preventive and diagnostic therapeutic intervention.
NASA Astrophysics Data System (ADS)
Barry, Jeremy A.; Robichaud, Guillaume; Bokhart, Mark T.; Thompson, Corbin; Sykes, Craig; Kashuba, Angela D. M.; Muddiman, David C.
2014-12-01
This work describes the coupling of the IR-MALDESI imaging source with the Q Exactive mass spectrometer. IR-MALDESI MSI was used to elucidate the spatial distribution of several HIV drugs in cervical tissues that had been incubated in either a low or high concentration. Serial sections of those analyzed by IR-MALDESI MSI were homogenized and analyzed by LC-MS/MS to quantify the amount of each drug present in the tissue. By comparing the two techniques, an agreement between the average intensities from the imaging experiment and the absolute quantities for each drug was observed. This correlation between these two techniques serves as a prerequisite to quantitative IR-MALDESI MSI. In addition, a targeted MS2 imaging experiment was also conducted to demonstrate the capabilities of the Q Exactive and to highlight the added selectivity that can be obtained with SRM or MRM imaging experiments.
NASA Astrophysics Data System (ADS)
Thissen, R.; Somogyi, A.; Vuitton, V.; Bégué, D.; Lemaire, J.; Steinmetz, V.
2011-10-01
The complex organic material that is found on the surface and within the haze layer of Titan is attributed to chemistry occurring in its thick N2/CH4 atmosphere. Although several groups are producing in various laboratory setting the socalled tholins which have been investigated by using analytical methods including UV/Vis, fluorescence, IR, and MS1-5, these very complex organic mixtures still hold many unanswered questions, especially related to the potentiality for their prebiotic chemistry. In addition to tholins characterization and analysis, we recently investigated quantitatively the hydrolysis kinetics of tholins in pure and NH3 containing water at different temperatures.7-8 Our groups at UJF (Grenoble) and at U of Arizona (Tucson) have been collaborating on mass spectral analyses of tholins samples for several years.9 Here, we report our most recent results on the structural characterization of tholins by infrared multiphoton dissociation (IRMPD) action spectroscopy10 and ultrahigh resolution MS. IRMPD action spectroscopy is a recently developed technique that uses IR photons of variable wavelengths to activate ions trapped inside an ion trap. When photons are absorbed at a given wavelength, the selected ion fragments and this fragmentation is monitored as a function of wavelength, analog to an absorption spectrum (impossible to record otherwise because of the much reduced density). This technique can, therefore, be used to determine IR spectra of ions in the gas phase, and provides with very acute structural information. IRMPD action spectroscopy is often used to distinguish between structural isomers of isobaric ions. The drawback is that it requests for high power lasers. Only two Free Electron Lasers (FEL) are available in the world and allow to record spectra with reasonable resolution (20-25 cm-1). IRMPD action spectra of selected ions from tholins will be presented and discussed together with observed fragmentation processes that reveal structural features of the ions. We have studied ions in the mass range from 60 to 160 u, corresponding to particularly interesting species already characterized by other (e.g. tandem MS/MS) methods.
Maisuls, Iván; Wolcan, Ezequiel; Piro, Oscar E; Etcheverría, Gustavo A; Petroselli, Gabriela; Erra-Ballsels, Rosa; Cabrerizo, Franco M; Ruiz, Gustavo T
2015-10-21
Two novel Re(i) complexes with the general formula fac-[Re(CO)3(L)(nHo)]CF3SO3, where L = 2,2'-bipyridine (bpy) or 1,10 phenanthroline (phen) and nHo (9H-pyrido[3,4-b]indole; norharmane) have been synthesized. The Re(i)-nHo complexes were characterized by structural X-ray diffraction, (1)H and (13)C NMR, UV-vis absorption and FT-IR spectroscopy, and by a combination of two mass spectrometry techniques, namely ESI-MS and UV-MALDI-MS. All characterizations showed that nHo is coordinated to the metal atom by the pyridine nitrogen of the molecule. X-ray structural analysis revealed that the crystal lattices for both complexes are further stabilized by a strong >N-HO bond between the pyrrole NH group of the pyridoindole ligand and one oxygen atom of the trifluoromethanesulfonate counter-ion. Ground state geometry optimization by DFT calculations showed that in fluid solution the nHo ligand may rotate freely. The nature of the electronic transitions of Re(CO)3(bpy)(nHo)(+) were established by TD-DFT calculations. The set of the most important electronic transitions present in this complex are comprised of π→π* electronic transitions centered on bpy and nHo moieties, LLCTnHo→COs, MLLCTRe(CO)3→bpy and LLCTnHo→bpy transitions. Additionally, TD-DFT calculations predict the existence of another two intense MLLCTRe(CO)3→nHo electronic transitions. Calculated UV-vis absorption spectra are in good agreement with the corresponding experimental data for the bpy-containing complex.
Into the Darkness: Interstellar Extinction Near the Cepheus OB3 Molecular Cloud
NASA Astrophysics Data System (ADS)
Fitzpatrick, Edward L.; Jacklin, S.; Massa, D.
2014-01-01
We present the results of a followup investigation to a study performed by Massa and Savage (1984, ApJ, 279, 310) of the properties of UV interstellar extinction in the region of the Cepheus OB3 molecular cloud. That study was performed using UV photometry and spectro-photometry from the ANS and IUE satellites. We have extended this study into the IR, utilizing the uniform database of IR photometry available from the 2MASS project. This is a part of a larger program whose goal is to study the properties of extinction in localized regions, where we hope to find clues to dust grain growth and destruction processes through spatial correlations of extinction with distinct environmental properties. Similarly to Massa and Savage’s UV results, we find that the IR extinction properties on the Cepheus OB3 region vary systematically with the apparent proximity of the target stars to the molecular cloud. We also find that the UV extinction and the IR extinction are crudely correlated. The methodology leading to these results and their implications are discussed.
NASA Astrophysics Data System (ADS)
Vignesh, K.; Suganthi, A.; Rajarajan, M.; Sakthivadivel, R.
2012-03-01
Hesperidin a flavanoid, modified TiO2 nanoparticles (Hes-TiO2) was synthesized to improve the visible light driven photocatalytic performance of TiO2. The synthesized nanoparticles were characterized by UV-visible diffuse reflectance spectroscopy (UV-vis-DRS), FT-IR, powder X-ray diffraction (XRD) and scanning electron microscopy (SEM). The photocatalytic activity of Hes-TiO2 was investigated based on the decolorization of eosin-Y under visible light irradiation. Hes-TiO2 showed high efficiency for the decolorization of eosin-Y. The influences of various reaction parameters like effect of pH, catalyst dosage and initial dye concentration on the photocatalytic efficiency were investigated. The adsorption of eosin-Y on Hes-TiO2 was found favorable by the Langmuir approach. The removal percentage of chemical oxygen demand (COD) was determined to evaluate the mineralization of eosin-Y during photodecolorization. Based on the intermediates obtained in the GC-MS spectroscopic technique, a probable degradation mechanism has been proposed.
Self-assembly of chiral molecular polygons.
Jiang, Hua; Lin, Wenbin
2003-07-09
Treatment of 2,2'-diacetyl-1,1'-binaphthyl-6,6'-bis(ethyne), L-H2, with 1 equiv of trans-Pt(PEt3)2Cl2 led to a mixture of different sizes of chiral metallocycles [trans-(PEt3)2Pt(L)]n (n = 3-8, 1-6). Each of the chiral molecular polygons 1-6 was purified by silica gel column chromatography and characterized by 1H, 13C{1H}, and 31P{1H} NMR spectroscopy, MS, IR, UV-vis, and circular dichroism spectroscopies, and microanalysis. The presence of tunable cavities (1.4-4.3 nm) and chiral functionalities in these molecular polygons promises to make them excellent receptors for a variety of guests.
[Spectroscopic study of photocatalytic mechanism of methanol and CO2].
Hai, Feng; Zhang, Qian-cheng; Bai, Feng-rong; Wang, A-nan; Wang, Zhi-wei; Jian, Li
2011-12-01
Ni-Ti-O/SiO2 catalyst was prepared by impregnation method, and its photocatalytic performance for carbonylation of methanol with CO2 was investigated under UV light. The in-situ IR, XPS and MS were carried out to analyze the possible photocatalytic reaction mechanism. Results indicated that the Ni-Ti-O/SiO2 exhibited good photocatalytic performance for carbonylation of methanol with CO2, the methanol conversion reached up to 24.9%, and the selectivity for the carbonylated products was more than 60% within 180 min reaction time. The catalyst characterization results showed that the O==C .--O- and CH3OC(O)* might be important intermediate in the carbonylation of methanol with CO2.
Antibacterial activity of Pd(II) complexes with salicylaldehyde-amino acids Schiff bases ligands.
Rîmbu, Cristina; Danac, Ramona; Pui, Aurel
2014-01-01
Palladium(II) complexes with Schiff bases ligands derived from salicylaldehyde and amino acids (Ala, Gly, Met, Ser, Val) have been synthesized and characterized by Fourier transform (FT)-IR, UV-Vis and (1)H-NMR spectroscopy. The electrospray mass spectrometry (ES-MS) spectrometry confirms the formation of palladium(II) complexes in 1/2 (M/L) molar ratio. All the Pd(II) complexes 1, [Pd(SalAla)2]Cl2; 2, [Pd(SalGly)2]Cl2; 3, [Pd(SalMet)2]Cl2; 4, [Pd(SalSer)2]Cl2; 5, [Pd(SalVal)2]Cl2; have shown antibacterial activity against Gram-positive bacteria Staphylococcus aureus and Gram-negative bacteria Escherichia coli.
New benzophenone and quercetin galloyl glycosides from Psidium guajava L.
Matsuzaki, Keiichi; Ishii, Rie; Kobiyama, Kaori; Kitanaka, Susumu
2010-07-01
New benzophenone and flavonol galloyl glycosides were isolated from an 80% MeOH extract of Psidium guajava L. (Myrtaceae) together with five known quercetin glycosides. The structures of the novel glycosides were elucidated to be 2,4,6-trihydroxybenzophenone 4-O-(6''-O-galloyl)-beta-D: -glucopyranoside (1, guavinoside A), 2,4,6-trihydroxy-3,5-dimethylbenzophenone 4-O-(6''-O-galloyl)-beta-D: -glucopyranoside (2, guavinoside B), and quercetin 3-O-(5''-O-galloyl)-alpha-L: -arabinofuranoside (3, guavinoside C) by NMR, MS, UV, and IR spectroscopies. Isolated phenolic glycosides showed significant inhibitory activities against histamine release from rat peritoneal mast cells, and nitric oxide production from a murine macrophage-like cell line, RAW 264.7.
NASA Technical Reports Server (NTRS)
Menzies, R. T.
1986-01-01
A comparison is made of four prominent Doppler lidar systems, ranging in wavelength from the near UV to the middle IR, which are presently being studied for their potential in an earth-orbiting global tropospheric wind field measurement application. The comparison is restricted to relative photon efficiencies, i.e., the required number of transmitted photons per pulse is calculated for each system for midtropospheric velocity estimate uncertainties ranging from + or - 1 to + or - 4 m/s. The results are converted to laser transmitter pulse energy and power requirements. The analysis indicates that a coherent CO2 Doppler lidar operating at 9.11-micron wavelength is the most efficient.
IR-safe and UV-safe integrands in the EFTofLSS with exact time dependence
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lewandowski, Matthew; Senatore, Leonardo, E-mail: matthew.lewandowski@ipht.fr, E-mail: senatore@stanford.edu
Because large-scale structure surveys may very well be the next leading sources of cosmological information, it is important to have a precise understanding of the cosmological observables; for this reason, the Effective Field Theory of Large-Scale Structure (EFTofLSS) was developed. So far, most results in the EFTofLSS have used the so-called Einstein-de Sitter approximation, an approximation of the time dependence which is known to be accurate to better than one percent. However, in order to reach even higher accuracy, the full time dependence must be used. The computation with exact time dependence is sensitive to both infrared (IR) and ultravioletmore » (UV) effects in the loop integrands, and while these effects must cancel because of diffeomorphism invariance, they make numerical computation much less efficient. We provide a formulation of the one-loop, equal-time exact-time-dependence power spectrum of density perturbations which is manifestly free of these spurious IR and UV divergences at the level of the integrand. We extend our results to the total matter mode with clustering quintessence, show that IR and UV divergences cancel, and provide the associated IR- and UV-safe integrand. This also establishes that the consistency conditions are satisfied in this system. We then use our one-loop result to do an improved precision comparison of the two-loop dark-matter power spectrum with the Dark Sky N -body simulation.« less
IR-safe and UV-safe integrands in the EFTofLSS with exact time dependence
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lewandowski, Matthew; Senatore, Leonardo
Because large-scale structure surveys may very well be the next leading sources of cosmological information, it is important to have a precise understanding of the cosmological observables; for this reason, the Effective Field Theory of Large-Scale Structure (EFTofLSS) was developed. So far, most results in the EFTofLSS have used the so-called Einstein-de Sitter approximation, an approximation of the time dependence which is known to be accurate to better than one percent. However, in order to reach even higher accuracy, the full time dependence must be used. The computation with exact time dependence is sensitive to both infrared (IR) and ultravioletmore » (UV) effects in the loop integrands, and while these effects must cancel because of diffeomorphism invariance, they make numerical computation much less efficient. We provide a formulation of the one-loop, equal-time exact-time-dependence power spectrum of density perturbations which is manifestly free of these spurious IR and UV divergences at the level of the integrand. We extend our results to the total matter mode with clustering quintessence, show that IR and UV divergences cancel, and provide the associated IR- and UV-safe integrand. This also establishes that the consistency conditions are satisfied in this system. In conclusion, we then use our one-loop result to do an improved precision comparison of the two-loop dark-matter power spectrum with the Dark Sky N-body simulation.« less
IR-safe and UV-safe integrands in the EFTofLSS with exact time dependence
Lewandowski, Matthew; Senatore, Leonardo
2017-08-31
Because large-scale structure surveys may very well be the next leading sources of cosmological information, it is important to have a precise understanding of the cosmological observables; for this reason, the Effective Field Theory of Large-Scale Structure (EFTofLSS) was developed. So far, most results in the EFTofLSS have used the so-called Einstein-de Sitter approximation, an approximation of the time dependence which is known to be accurate to better than one percent. However, in order to reach even higher accuracy, the full time dependence must be used. The computation with exact time dependence is sensitive to both infrared (IR) and ultravioletmore » (UV) effects in the loop integrands, and while these effects must cancel because of diffeomorphism invariance, they make numerical computation much less efficient. We provide a formulation of the one-loop, equal-time exact-time-dependence power spectrum of density perturbations which is manifestly free of these spurious IR and UV divergences at the level of the integrand. We extend our results to the total matter mode with clustering quintessence, show that IR and UV divergences cancel, and provide the associated IR- and UV-safe integrand. This also establishes that the consistency conditions are satisfied in this system. In conclusion, we then use our one-loop result to do an improved precision comparison of the two-loop dark-matter power spectrum with the Dark Sky N-body simulation.« less
Wako, Hiromichi; Ishiuchi, Shun-Ichi; Kato, Daichi; Féraud, Géraldine; Dedonder-Lardeux, Claude; Jouvet, Christophe; Fujii, Masaaki
2017-05-03
The conformer-selected ultraviolet (UV) and infrared (IR) spectra of protonated noradrenaline were measured using an electrospray/cryogenic ion trap technique combined with photo-dissociation spectroscopy. By comparing the UV photo dissociation (UVPD) spectra with the UV-UV hole burning (HB) spectra, it was found that five conformers coexist under ultra-cold conditions. Based on the spectral features of the IR dip spectra of each conformer, two different conformations on the amine side chain were identified. Three conformers (group I) were assigned to folded and others (group II) to extended structures by comparing the observed IR spectra with the calculated ones. Observation of the significantly less-stable extended conformers strongly suggests that the extended structures are dominant in solution and are detected in the gas phase by kinetic trapping. The conformers in each group are assignable to rotamers of OH orientations in the catechol ring. By comparing the UV-UV HB spectra and the calculated Franck-Condon spectra obtained by harmonic vibrational analysis of the S 1 state, with the aid of relative stabilization energies of each conformer in the S 0 state, the absolute orientations of catechol OHs of the observed five conformers were successfully determined. It was found that the 0-0 transition of one folded conformer is red-shifted by about 1000 cm -1 from the others. The significant red-shift was explained by a large contribution of the πσ* state to S 1 in the conformer in which an oxygen atom of the meta-OH group is close to the ammonium group.
Stellar Populations of Highly Magnified Lensed Galaxies: Young Starbursts at Z approximately 2
NASA Technical Reports Server (NTRS)
Wuyts, Eva; Rigby, Jane R.; Gladders, Michael D.; Gilbank, David G.; Sharon, Keren; Gralla, Megan B.; Bayliss, Matthew B.
2012-01-01
We present a comprehensive analysis of the rest-frame UV to near-IR spectral energy distributions (SEDs) and rest-frame optical spectra of four of the brightest gravitationally lensed galaxies in the literature: RCSGA 032727-132609 at z = 1.70, MS1512-cB58 at z = 2.73, SGAS J152745.1+065219 at z = 2.76, and SGAS J122651.3+215220 at z = 2.92. This includes new Spitzer imaging for RCSGA0327 as well as new spectra, near-IR imaging and Spitzer imaging for SGAS1527 and SGAS1226. Lensing magnifications of 3-4 mag allow a detailed study of the stellar populations and physical conditions. We compare star formation rates (SFRs) as measured from the SED fit, the Ha and [O II] ?3727 emission lines, and the UV+IR bolometric luminosity where 24 micron photometry is available. The SFR estimate from the SED fit is consistently higher than the other indicators, which suggests that the Calzetti dust extinction law used in the SED fitting is too flat for young star-forming galaxies at z 2. Our analysis finds similar stellar population parameters for all four lensed galaxies: stellar masses (3-7) ? 10(exp 9)Solar M young ages approx 100 Myr, little dust content E(B - V) = 0.10-0.25, and SFRs around 20-100 solar M/ yr. Compared to typical values for the galaxy population at z approx. 2, this suggests we are looking at newly formed, starbursting systems that have only recently started the buildup of stellar mass. These results constitute the first detailed, uniform analysis of a sample of the growing number of strongly lensed galaxies known at z approx 2.
Stellar Populations of Highly Magnified Lensed Galaxies Young Starburst at Z to Approximately 2
NASA Technical Reports Server (NTRS)
Wuyts, Eva; Rigby, Jane R.; Gladders, Michael D.; Gilbank, David G.; Sharon, Keren; Gralla, Megan B.; Bayliss, Matthew B.
2011-01-01
We present a comprehensive analysis of the rest-frame UV to near-IR spectral energy distributions and rest-frame optical spectra of four of the brightest gravitationally lensed galaxies in the literature: RCSGA 032727-132609 at z = 170, MS1512-cB58 at z = 2.73, SGAS J152745.1+065219 at z = 2.76 and SGAS J12265L3+215220 at z = 2.92. This includes new Spitzer imaging for RCSGA0327 as well as new spectra, near-IR imaging and Spitzer imaging for SGAS1527 and SGAS1226. Lensing magnifications of 3-4 magnitudes allow a detailed study of the stellar populations and physical conditions. We compare star formation rates as measured from the SED fit, the Ha and [O II] .(lambda)3727 emission lines, and the UV+IR bolometric luminosity where 24micron photometry is available. The SFR estimate from the SED fit is consistently higher than the other indicators, which suggests that the Calzetti dust extinction law used in the SED fitting is too flat for young star-forming galaxies at z approx. 2. Our analysis finds similar stellar population parameters for all four lensed galaxies: stellar masses 3 - 7 x 10(exp 9) Stellar mass, young ages approx. 100 Myr, little dust content E(B - V)=0.10-0.25, and star formation rates around 20- 100 Stellar mass/y. Compared to typical values for the galaxy population at z approx. 2, this suggests we are looking at newly formed, starbursting systems that have only recently started the build-up of stellar mass. These results constitute the first detailed, uniform analysis of a sample of the growing number of strongly lensed galaxies known at z approx. 2. Subject headings: galaxies: high-redshift, strong gravitational lensing, infrared: galaxies
Liang, Jianfeng; Fu, Junfen; Jiang, Youyun; Dong, Guanping; Wang, Xiumin; Wu, Wei
2015-09-28
Metabolic Syndrome (MS) is prevalant in China, especially according to the pediatric obesity group. Based on the MS-CHN2012 definition for Chinese children and adolescents the need to explore and establish a convienent MS screening become imminent. This study aims to investigate the optimal cut-off values, compare the accuracy for the (TriGlycerides (TG) to High-Density Lipoprotein Cholesterol (HDL-C)) (TG/HDL-C) ratio and Homeostasis Model Assessment Insulin Resistance (HOMA-IR) indexs to identify Metabolic Syndrome in obese pediatric population in China. A total sample of 976 children (female 286 male 690, BMI > = 95 percentile) aged from 6-16 years underwent a medical assessment including a physical examination and investigations of total cholesterol, high-density lipoprotein, low-density lipoprotein, triglycerides, insulin, glucose, and oral glucose tolerance test to identify the components of Metabolic Syndrome. The validity and accuracy between TG/HDL-C ratio and HOMA-IR were compared by Receiver Operating Characteristics analysis (ROC). TG/HDL-C ratio achieved a larger ROC Area under Curve (AUC = 0.843) than HOMA-IR indexes (0.640, 0.625 for HOMA1-IR, HOMA2-IR respectively) to screen for Metabolic Syndrome. The cut-off values for MS were: TG/HDL-C ratio > 1.25 (sensitivity: 80%; specificity: 75%), HOMA1-IR > 4.59 (sensitivity: 58.7%; specificity: 65.5%) and HOMA2-IR > 2.76 (sensitivity: 53.2%; specificity: 69.5%). The results kept robust after stratified by gender, age group and pubertal stage. TG/HDL-C ratio was a better indicator than the HOMA-IR to screen for a positive diagnosis for MS. Furthermore, the TG/HDL-C ratio was superior to the HOMA-IR indexes even after the control of possible confusions from the gender, age group and puberty stage. TG/HDL-C ratio proved a better index than HOMA-IR in screening for MS in obese children and adolescents. TG/HDL-C ratio has a discriminatory power in detecting potential MS in the Chinese obese pediatric population.
Li, C C; Chen, Y T; Lin, Y T; Sie, S F; Chen-Yang, Y W
2014-03-01
In the present study, about 45 and 34 wt% of benzophenone-3 (BP-3), an organic UV filter, was adsorbed on a high surface area mesoporous silica (MS) drug carrier to prepare BP-3-bearing MS (MSBP) sunscreen materials MSBP-1 and MSBP-2, respectively. The effect of the adsorption of BP-3 by MS on the UV protection ability of MSBP was demonstrated and a synergistic UV protection effect was observed in the as-prepared MSBP UV filters. Compared with free BP-3, adsorbed BP-3 had greatly reduced crystallinity and the dispersion of MSBP was significantly improved in the sunscreen. The in vitro sun protection factor (SPF) and in vitro UV-A values of the MSBP-2-based sunscreen was about 17.3% and 17.0% higher than that of free BP-3-based sunscreen, respectively, indicating that the ability of the sunscreen to protect against UV-B and UV-A improved because of the BP-3 content of the MS matrix. In addition, the decrease in SPF and UV-A values over time was significantly less in the MSBP-based sunscreens than in free BP-3-based sunscreen. Results of this study reveal that MS is a promising organic sunscreen carrier as well as a potential carrier for other topical drugs. Copyright © 2013 Elsevier B.V. All rights reserved.
Plume characteristics and dynamics of UV and IR laser-desorbed oligonucleotides.
Merrigan, Tony L; Timson, David J; Hunniford, C Adam; Catney, Martin; McCullough, Robert W
2012-05-01
Laser desorption of dye-tagged oligonucleotides was studied using laser-induced fluorescence imaging. Desorption with ultra violet (UV) and infra-red (IR) lasers resulted in forward directed plumes of molecules. In the case of UV desorption, the initial shot desorbed approximately seven-fold more material than subsequent shots. In contrast, the initial shot in IR desorption resulted in the ejection of less material compared to subsequent shots and these plumes had a component directed along the path of the laser. Thermal equilibrium of the molecules in the plume was achieved after approximately 25 μs with a spread in molecular temperature which was described by a modified Maxwell-Boltzmann equation. Copyright © 2012 Elsevier B.V. All rights reserved.
CO2 Enhancement of Growth and Photosynthesis in Rice (Oryza sativa) 1
Ziska, Lewis H.; Teramura, Alan H.
1992-01-01
Two cultivars of rice (Oryza sativa L.) IR-36 and Fujiyama-5 were grown at ambient (360 microbars) and elevated CO2 (660 microbars) from germination through reproduction in unshaded greenhouses at the Duke University Phytotron. Growth at elevated CO2 resulted in significant decreases in nighttime respiration and increases in photosynthesis, total biomass, and yield for both cultivars. However, in plants exposed to simultaneous increases in CO2 and ultraviolet-B (UV-B) radiation, CO2 enhancement effects on respiration, photosynthesis, and biomass were eliminated in IR-36 and significantly reduced in Fujiyama-5. UV-B radiation simulated a 25% depletion in stratospheric ozone at Durham, North Carolina. Analysis of the response of CO2 uptake to internal CO2 concentration at light saturation suggested that, for IR-36, the predominant limitation to photosynthesis with increased UV-B radiation was the capacity for regeneration of ribulose bisphosphate (RuBP), whereas for Fujiyama-5 the primary photosynthetic decrease appeared to be related to a decline in apparent carboxylation efficiency. Changes in the RuBP regeneration limitation in IR-36 were consistent with damage to the photochemical efficiency of photosystem II as estimated from the ratio of variable to maximum chlorophyll fluorescence. Little change in RuBP regeneration and photochemistry was evident in cultivar Fujiyama-5, however. The degree of sensitivity of photochemical reactions with increased UV-B radiation appeared to be related to leaf production of UV-B-absorbing compounds. Fujiyama-5 had a higher concentration of these compounds than IR-36 in all environments, and the production of these compounds in Fujiyama-5 was stimulated by UV-B fluence. Results from this study suggest that in rice alterations in growth or photosynthesis as a result of enhanced CO2 may be eliminated or reduced if UV-B radiation continues to increase. PMID:16668910
Sholtes, Kari A; Lowe, Kincaid; Walters, Glenn W; Sobsey, Mark D; Linden, Karl G; Casanova, Lisa M
2016-09-01
Ultraviolet (UV) light-emitting diodes (LEDs) emitting at 260 nm were evaluated to determine the inactivation kinetics of bacteria, viruses, and spores compared to low-pressure (LP) UV irradiation. Test microbes were Escherichia coli B, a non-enveloped virus (MS-2), and a bacterial spore (Bacillus atrophaeus). For LP UV, 4-log10 reduction doses were: E. coli B, 6.5 mJ/cm(2); MS-2, 59.3 mJ/cm(2); and B. atrophaeus, 30.0 mJ/cm(2). For UV LEDs, the 4-log10 reduction doses were E. coli B, 6.2 mJ/cm(2); MS-2, 58 mJ/cm(2); and B. atrophaeus, 18.7 mJ/cm(2). Microbial inactivation kinetics of the two UV technologies were not significantly different for E. coli B and MS-2, but were different for B. atrophaeus spores. UV LEDs at 260 nm are at least as effective for inactivating microbes in water as conventional LP UV sources and should undergo further development in treatment systems to disinfect drinking water.
Radical protection by differently composed creams in the UV/VIS and IR spectral ranges.
Meinke, Martina C; Syring, Felicia; Schanzer, Sabine; Haag, Stefan F; Graf, Rüdiger; Loch, Manuela; Gersonde, Ingo; Groth, Norbert; Pflücker, Frank; Lademann, Jürgen
2013-01-01
Modern sunscreens are well suited to provide sufficient protection in the UV range because the filter substances absorb or scatter UV radiation. Although up to 50% of radicals are formed in the visible and infrared spectral range during solar radiation protection strategies are not provided in this range. Previous investigations of commercially available products have shown that in addition to physical filters, antioxidants (AO) are necessary to provide protective effects in the infrared range by neutralizing already formed radicals. In this study, the efficacy of filter substances and AO to reduce radical formation in both spectral ranges was investigated after UV/VIS or IR irradiation. Optical properties and radical protection were determined for the investigated creams. It was found that organic UV filters lower radical formation in the UV/VIS range to 35% compared to untreated skin, independent of the presence of AO. Further reduction to 14% was reached by addition of 2% physical filters, whereas physical filters alone were ineffective in the UV/VIS range due to the low concentration. In contrast, this filter type reduced radical formation in the IR range significantly to 65%; similar effects were aroused after application of AO. Sunscreens which contain organic UV filters, physical filters and AO ensure protection in the complete solar spectrum. © 2013 The American Society of Photobiology.
Anti-diabetic activity of Holothuria thomasi saponin.
El Barky, Amira R; Hussein, Samy A; Alm-Eldeen, Abeer A; Hafez, Yehia A; Mohamed, Tarek M
2016-12-01
Diabetes mellitus represents a global health problem. It characterized by hyperglycemia that induces oxidative stress leading to a generation of free radicals. A wide variety of natural products in plants and other marine animals represent antioxidant activity and other health benefits like those of sea cucumber. Therefore, this study aimed to investigate the antidiabetic activity of glycosidic compound - saponin - derived from the Egyptian sea cucumber, Holothuria thomasi. Saponin has been extracted from the Egyptian sea cucumber and confirmed by hemolysis, Salkowski tests, FT/IR, UV and GC-MS analysis. Eighty white female albino rats were divided into four equal groups. The first two groups of rats; control normal and control normal saponin-treated groups. The last two groups which were made diabetic by intraperitoneal injection of streptozotocin had one diabetic control and the other diabetic group that got 300mg/kg B.wt. of saponin extract after Thirty-five days after diabetes induction and lasted for six weeks. The functional group of saponin extract which established with FT/IR spectroscopy demonstrated the presence of saponin in the extracted materials as shown in the peak of the functional group in relevance to the standard one. The UV spectra revealed that λ max of saponin extract was 282nm which in accordance to the standard saponin. Also, GC-MS analysis indicated that the aglycone part of saponin was methyl esters of octadecanoic acid. Saponin extract significantly decreased serum glucose, α-amylase activity, adiponectin, IL-6, TNF-α concentrations and liver L-MDA. However, serum insulin and liver glycogen levels were significantly increased as compared with the diabetic non-treated groups. The histopathological results supported that saponin extract markedly reduced the degenerative change in β-cells. This study, therefore, depicts that the Egyptian Holothuria thomasi, sea cucumber saponin as a hypoglycemic agent with the potential to normalize aberrant biochemical parameters and preserved the normal histological architecture of the islets cells of pancreatic tissues. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Green grasses as light harvesters in dye sensitized solar cells
NASA Astrophysics Data System (ADS)
Shanmugam, Vinoth; Manoharan, Subbaiah; Sharafali, A.; Anandan, Sambandam; Murugan, Ramaswamy
2015-01-01
Chlorophylls, the major pigments presented in plants are responsible for the process of photosynthesis. The working principle of dye sensitized solar cell (DSSC) is analogous to natural photosynthesis in light-harvesting and charge separation. In a similar way, natural dyes extracted from three types of grasses viz. Hierochloe Odorata (HO), Torulinium Odoratum (TO) and Dactyloctenium Aegyptium (DA) were used as light harvesters in dye sensitized solar cells (DSSCs). The UV-Vis absorption spectroscopy, Fourier transform infrared (FT-IR), and liquid chromatography-mass spectrometry (LC-MS) were used to characterize the dyes. The electron transport mechanism and internal resistance of the DSSCs were investigated by the electrochemical impedance spectroscopy (EIS). The performance of the cells fabricated with the grass extract shows comparable efficiencies with the reported natural dyes. Among the three types of grasses, the DSSC fabricated with the dye extracted from Hierochloe Odorata (HO) exhibited the maximum efficiency. LC-MS investigations indicated that the dominant pigment present in HO dye was pheophytin a (Pheo a).
Pereira, Regina M S; Andrades, Norma E D; Paulino, Niraldo; Sawaya, Alexandra C H F; Eberlin, Marcos N; Marcucci, Maria C; Favero, Giovani Marino; Novak, Estela Maria; Bydlowski, Sérgio Paulo
2007-07-09
The antioxidant activity of flavonoids is believed to increase when they are coordinated with transition metal ions. However, the literature on this subject is contradictory and the outcome seems to largely depend on the experimental conditions. In order to understand the contribution of the metal coordination and the type of interaction between a flavonoid and the metal ion, in this study a new metal complex of Cu (II) with naringin was synthesized and characterized by FT-IR, UV-VIS, mass spectrometry (ESI-MS/MS), elemental analysis and 1H-NMR. The results of these analyses indicate that the complex has a Cu (II) ion coordinated via positions 4 and 5 of the flavonoid. The antioxidant, anti-inflammatory and antimicrobial activities of this complex were studied and compared with the activity of free naringin. The Naringin-Cu (II) complex 1 showed higher antioxidant, anti-inflammatory and tumor cell cytotoxicity activities than free naringin without reducing cell viability.
Forensic practice in the field of protection of cultural heritage
NASA Astrophysics Data System (ADS)
Kotrlý, Marek; Turková, Ivana
2012-06-01
Microscopic methods play a key role in issues covering analyses of objects of art that are used on the one hand as screening ones, on the other hand they can lead to obtaining data relevant for completion of expertise. Analyses of artworks, gemmological objects and other highly valuable commodities usually do not rank among routine ones, but every analysis is specific, be it e.g. material investigation of artworks, historical textile materials and other antiques (coins, etc.), identification of fragments (from transporters, storage places, etc.), period statues, sculptures compared to originals, analyses of gems and jewellery, etc. A number of analytical techniques may be employed: optical microscopy in transmitted and reflected light, polarization and fluorescence in visible, UV and IR radiation; image analysis, quantitative microspectrophotometry; SEM/EDS/WDS; FTIR and Raman spectroscopy; XRF and microXRF, including mobile one; XRD and microXRD; x-ray backlight or LA-ICP-MS, SIMS, PIXE; further methods of organic analysis are also utilised - GS-MS, MALDI-TOF, etc.
Invisible ink mark detection in the visible spectrum using absorption difference.
Lee, Joong; Kong, Seong G; Kang, Tae-Yi; Kim, Byounghyun; Jeon, Oc-Yeub
2014-03-01
One of popular techniques in gambling fraud involves the use of invisible ink marks printed on the back surface of playing cards. Such covert patterns are transparent in the visible spectrum and therefore invisible to unaided human eyes. Invisible patterns can be made visible with ultraviolet (UV) illumination or a CCD camera installed with an infrared (IR) filter depending on the type of ink materials used. Cheating gamers often wear contact lenses or eyeglasses made of IR or UV filters to recognize the secret marks on the playing cards. This paper presents an image processing technique to reveal invisible ink patterns in the visible spectrum without the aid of special equipment such as UV lighting or IR filters. A printed invisible ink pattern leaves a thin coating on the surface with different refractive index for different wavelengths of light, which results in color dispersion or absorption difference. The proposed method finds the differences of color components caused by absorption difference to detect invisible ink patterns on the surface. Experiment results show that the proposed scheme is effective for both UV-active and IR-active invisible ink materials. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Deguin, Vincent; Mascetti, Joëlle; Simon, Aude; Ben Amor, Nadia; Aupetit, Christian; Latournerie, Sandra; Noble, Jennifer A
2018-01-18
The photochemistry of Fe:H 2 O adducts is of interest in fields as diverse as catalysis and astrochemistry. Industrially, iron can be used as a catalyst to convert H 2 O to H 2 , whereas in the interstellar medium it may be an important component of dust grains, influencing the chemistry on their icy surfaces. This study consisted of the deposition and spectral characterization of binary systems of atomic iron with H 2 O in cryogenic argon matrixes. In this way, we were able to obtain information about the interaction of the two species; we observed the formation of adducts of iron monomers and dimers with water molecules in the mid-IR and UV-visible spectral domains. Upon irradiation with a UV radiation source, the iron species were inserted into the water molecules to form HFeOH and HFe 2 OH, leading in some cases to the formation of FeO possibly accompanied by the production of H 2 . DFT and correlated multireference wave function calculations confirmed our attributions. This combination of IR and UV-visible spectroscopy with theoretical calculations allowed us to determine, for the first time, the spectral characteristics of iron adducts and their photoproducts in the UV-visible and in the OH stretching region of the mid-IR domain.
Georgieva, Ivelina; Danchova, Nina; Gutzov, Stoyan; Trendafilova, Natasha
2012-06-01
Theoretical and spectroscopic studies of a series of monomeric and dimeric complexes formed through the modification of a zirconium butoxide precursor with acetylacetone and subsequent hydrolysis and/or condensation have been performed by applying DFT/B3LYP/6-31++G(d) and highly accurate RI-ADC(2) methods as well as IR and UV-Vis transmittance and diffuse reflectance spectroscopies. Based on DFT model calculations and simulated and experimental UV-Vis and IR spectra of all the studied structures, the most probable building units of the Zr(IV)-AcAc gel were predicted: the dimeric double hydroxo-bridged complex Zr(2)(AcAc)(2)(OH)(4)(OH)(2br) 9 and the monooxo-bridged complex Zr(2)(AcAc)(2)(OH)(4)O(br)·2H(2)O 12. In both structures, the two AcAc ligands are coordinated to one Zr atom. It was shown that building units 9 and 12 determine the photophysical and vibrational properties of the gel material. The observed UV-Vis and IR spectra of Zr(IV)-AcAc gel were interpreted and a relation between the spectroscopic and structural data was derived. The observed UV-Vis bands at 315 nm and 298/288 nm were assigned to partial ligand-metal transitions and to intra-/inter-AcAc ligand transitions, respectively.
NASA Astrophysics Data System (ADS)
Wang, L.; Norberg, P.; Gunawardhana, M. L. P.; Heinis, S.; Baldry, I. K.; Bland-Hawthorn, J.; Bourne, N.; Brough, S.; Brown, M. J. I.; Cluver, M. E.; Cooray, A.; da Cunha, E.; Driver, S. P.; Dunne, L.; Dye, S.; Eales, S.; Grootes, M. W.; Holwerda, B. W.; Hopkins, A. M.; Ibar, E.; Ivison, R.; Lacey, C.; Lara-Lopez, M. A.; Loveday, J.; Maddox, S. J.; Michałowski, M. J.; Oteo, I.; Owers, M. S.; Popescu, C. C.; Smith, D. J. B.; Taylor, E. N.; Tuffs, R. J.; van der Werf, P.
2016-09-01
We compare common star formation rate (SFR) indicators in the local Universe in the Galaxy and Mass Assembly (GAMA) equatorial fields (˜160 deg2), using ultraviolet (UV) photometry from GALEX, far-infrared and sub-millimetre (sub-mm) photometry from Herschel Astrophysical Terahertz Large Area Survey, and Hα spectroscopy from the GAMA survey. With a high-quality sample of 745 galaxies (median redshift
Ultraviolet reflectance properties of asteroids
NASA Astrophysics Data System (ADS)
Butterworth, P. S.; Meadows, A. J.
1985-05-01
An analysis of the UV spectra of 28 asteroids obtained with the Internal Ultraviolet Explorer (IUE) satellite is presented. The spectra lie within the range 2100-3200 A. The results are examined in terms of both asteroid classification and of current ideas concerning the surface mineralogy of asteroids. For all the asteroids examined, UV reflectivity declines approximately linearly toward shorter wavelengths. In general, the same taxonomic groups are seen in the UV as in the visible and IR, although there is some evidence for asteroids with anomalous UV properties and for UV subclasses within the S class. No mineral absorption features are reported of strength similar to the strongest features in the visible and IR regions, but a number of shallow absorptions do occur and may provide valuable information on the surface composition of many asteroids.
Metabolic syndrome, insulin resistance, and chronic allograft dysfunction.
Porrini, Esteban; Delgado, Patricia; Torres, Armando
2010-12-01
Metabolic syndrome (MS) is a cluster of cardiovascular (CV) risk factors (hypertension, dyslipidemia, obesity, and glucose homeostasis alterations), and insulin resistance (IR) is suggested to be a common pathogenic background. In the general population, MS and IR have been proven to be risk factors for diabetes, CV disease, and chronic kidney disease. In the renal transplant setting, few studies have analyzed the relevance of MS and IR. According to the few data available, the prevalence of MS in renal transplant patients has been described as 22.6% at 12 months, 37.7% at 36 months, and 64% at 6 years after transplantation. Importantly, MS has been shown to be an independent risk factor for chronic allograft dysfunction (CAD), graft failure, new-onset diabetes, and CV disease. Also, persistent hyperinsulinemia during the first posttransplant year has been related to an increase in glomerular filtration rate, probably reflecting glomerular hyperfiltration as observed in prediabetes and early type 2 diabetes. Importantly, prediabetes (impaired fasting glucose and impaired glucose tolerance), a state hallmarked by IR, proved to be highly frequent among stable renal transplant recipients (30%), which is nearly three times its incidence in the general population. Posttransplant IR has been associated with subclinical atheromatosis as assessed by carotid intima-media thickness, and with chronic subclinical inflammation. In conclusion, MS and IR are important modifiable risk factors in renal transplant recipients, and prompt interventions to avoid its deleterious effects at the metabolic, CV, and graft function levels are needed.
Ultraviolet (UV) filters, also known as sunscreen agents, are chemicals widely used in cosmetics, sunscreens, and plastics to block UV radiation from the sun. There have been studies that show some sunscreen agents demonstrate estrogenicity and multiple hormonal activities in vi...
Blue emitting undecaplatinum clusters
NASA Astrophysics Data System (ADS)
Chakraborty, Indranath; Bhuin, Radha Gobinda; Bhat, Shridevi; Pradeep, T.
2014-07-01
A blue luminescent 11-atom platinum cluster showing step-like optical features and the absence of plasmon absorption was synthesized. The cluster was purified using high performance liquid chromatography (HPLC). Electrospray ionization (ESI) and matrix assisted laser desorption ionization (MALDI) mass spectrometry (MS) suggest a composition, Pt11(BBS)8, which was confirmed by a range of other experimental tools. The cluster is highly stable and compatible with many organic solvents.A blue luminescent 11-atom platinum cluster showing step-like optical features and the absence of plasmon absorption was synthesized. The cluster was purified using high performance liquid chromatography (HPLC). Electrospray ionization (ESI) and matrix assisted laser desorption ionization (MALDI) mass spectrometry (MS) suggest a composition, Pt11(BBS)8, which was confirmed by a range of other experimental tools. The cluster is highly stable and compatible with many organic solvents. Electronic supplementary information (ESI) available: Details of experimental procedures, instrumentation, chromatogram of the crude cluster; SEM/EDAX, DLS, PXRD, TEM, FT-IR, and XPS of the isolated Pt11 cluster; UV/Vis, MALDI MS and SEM/EDAX of isolated 2 and 3; and 195Pt NMR of the K2PtCl6 standard. See DOI: 10.1039/c4nr02778g
Deol, Suprit; Weerasuriya, Nisala
2015-01-01
This article describes the synthesis of water-soluble dendron–conjugated gold nanoparticles (Den–AuNPs) with various average core sizes and the evaluation of stability, cytotoxicity, cell permeability and uptake of these materials. The characterization of Den–AuNPs using various techniques including transmission electron microscopy (TEM), matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF-MS), 1H NMR, FT-IR, and UV-vis spectroscopy confirms the dendron conjugation to the glutathione-capped gold nanoparticles (AuNPs). The stability of AuNPs and Den–AuNPs in solutions of different pH and salt concentration is determined by monitoring the changes in surface plasmon bands of gold using UV-vis spectroscopy. The stability of Den–AuNPs at different pH remained about the same compared to that of AuNPs. In comparison, the Den–AuNPs are found to be more stable than the precursor AuNPs maintaining their solubility in the aqueous solution with the salt concentration of up to 100 mM. The improved stability of Den–AuNPs suggests that the post-functionalization of thiol-capped gold nanoparticle surfaces with dendrons can further improve the physiological stability and biocompatibility of gold nanoparticle-based materials. Cytotoxicity studies of AuNPs and Den–AuNPs with and without fluorophores are also performed by examining cell viability for 3T3 fibroblasts using a MTT cell proliferation assay. The conjugation of dendrons to the AuNPs with a fluorophore is able to decrease the cytotoxicity brought about by the fluorophore. The successful uptake of Den–AuNPs in mouse fibroblast 3T3 cells shows the physiological viability of the hybrid materials. PMID:26366289
Structural properties of dissolved organic carbon in deep horizons of an arable soil.
NASA Astrophysics Data System (ADS)
Lavaud, A.; Croué, Jp; Berwick, L.; Steffens, M.; Chabbi, A.
2010-05-01
The objective of this work is to quantity the DOC that percolates in deep horizons of an arable soil, and to characterize the structural properties of the main fractions. The study was conducted on the long term observatory for environmental research- biogeochemical cycles and biodiversity Lusignan site-France. DOC collected using lysimeter plates inserted to a depth of 105 cm was fractionated into 3 fractions using the two column array of XAD-8 and XAD-4 resins. The HPO (hydrophobic) fraction (i.e. humic substances) isolated from the XAD-8 resin, the TPH (Transphilic) fraction from the XAD-4 resin and the HPI (hydrophilic) fraction which corresponds to the DOC that does not adsorbed onto the two resins under the acid condition used (pH 2). DOM adsorbed onto the resins is recovered with a 75%/25% acetonitrile/water mixture and lyophilized. The hydrophilic fraction is purified according the protocol proposed by Aiken and Leenheer (1993). The isolated fractions were subjected to several characterization tools: UV/Vis, fluorescence EEM, HPSEC/UV/DOC, 13C NMR, 14C dating, FT-IR, pyrolysis, thermochemolysis and MSSV GC/MS. The DOC content ranged from 1 to 2.5 mg / L between winter and the middle of spring and then to 4-5 mg / L in summer time. For all isolated fractions HPSEC analyses indicated the predominance of low molecular structures with a low aromatic character. Fluorescence EEM confirmed the non-humic character of the DOM. 13C-NMR spectra showed that the aromatic character decreased from HPO to TPH, and HPI character. Molecular size follows the same trend. HPI DOM was found to be strongly enriched in carboxyl groups. The 14C concentration of the HPO fraction corresponds to an apparent calibrated age around AD 1500. For the same fraction isolated from the 0 - 30 cm horizon, the measured 14C concentration 131.9 pMC corresponds to that in the atmosphere around AD 1978. Significant input of terpenoid derived organic matter was confirmed in the HPO fraction of DOC, results supported by the data of 13C NMR, FT-IR and Micro Scale Sealed Vessel / pyrolysis GC / MS. Flash pyrolysis GC / MS chromatogram highlight the presence of phenol and alkyl phenols, generally attributed to structures polyhydroxyaromatic structures. Acetamide, a pyrolysis product of amino sugars constituents of microbial cell wall is also significantly present. The thermochimiolysis (TMAH)/GC/ MS confirmed the presence of hydroxy aromatic structures in the extracts; however, their precise origin (lignin, tannins ...) remains uncertain.
Weng, ShihChi; Dunkin, Nathan; Schwab, Kellogg J; McQuarrie, James; Bell, Kati; Jacangelo, Joseph G
2018-09-01
Peracetic acid (PAA) is a strong oxidant/bactericide that has been applied in various industries (e.g., food processing, pharmaceuticals, medical device sterilization, etc.) as a disinfectant. There is increasing interest in using PAA for wastewater disinfection because it does not form halogenated byproducts, and no post-treatment quenching is required. Previous studies have demonstrated good efficiency in controlling bacteria in wastewater, but limited information is available for viruses, especially those hosted by mammals (e.g., norovirus). Therefore, a study on the infectivity reduction of murine norovirus (MNV) was undertaken to evaluate the disinfection efficacy of PAA or UV alone and in combination with UV irradiation in undisinfected secondary effluent from a municipal wastewater reclamation facility (MWW) and phosphate buffer solution (PBS) at pH 7. Experiments employing MS2 bacteriophage were also performed in parallel for comparison purposes. MS2 infectivity reduction was found to be lower than MNV infectivity reduction for each condition studied - PAA, PAA + UV, and UV disinfection. These data suggest that MS2 may not be an appropriate surrogate to accurately predict the reduction of MNV infectivity. UV irradiation, in a dose range of 5-250 mJ/cm 2 , provided linear log inactivation (-log (N/N 0 )) with a regression slope (cm 2 mJ -1 ) of 0.031-0.034 and 0.165-0.202 for MS2 and MNV, respectively. UV irradiation provided similar inactivation for MS2 and MNV in both suspensions (PBS or MWW). Low infectivity reduction of MS2 was observed when PAA was used alone at a practical dose of 1.5 mg/L and below. A greater reduction of both MNV and MS2 was observed in PAA disinfection experiments using PBS as the microbial suspension medium, than in secondary effluent. Similar results were observed in PAA + UV experiments, in which greater synergistic effects were found in PBS than in MWW. Results of OH radical formation experiments suggest the presence of radical scavengers in MWW, which resulted in less opportunity for MNV and MS2 to encounter OHradicals. This study also demonstrated that the type of water can have a substantial impact on wastewater disinfection when employing PAA or PAA + UV treatment due to the matrix effect and the presence of radical scavengers, respectively. The results from this study could be employed to aid in the conceptual design of PAA and UV disinfection facilities, especially when norovirus is the organism of concern. Copyright © 2018. Published by Elsevier Ltd.
Experimental and theoretical studies of a pyrazole-thiazolidin-2,4-di-one hybrid
NASA Astrophysics Data System (ADS)
Mushtaque, Md.; Avecilla, Fernando; Haque, Ashanul; Perwez, Ahmad; Khan, Md. Shahzad; Rizvi, M. Moshahid Alam
2017-08-01
The present work describes synthesis, characterization and biological evaluations of a hybrid compound 10 composed of two intriguing scaffolds pyrazole and thiazolidin-2,4-di-one. The title compound was obtained via multi-step reaction and characterized by a number of techniques (viz. IR, UV-Visible, 1H-NMR, 13C-NMR and MS) including X-ray crystallography. The structural and photophysical data of compound 10 were well supported by theoretical calculations performed at density functional (DFT) level. In-vitro anticancer studies on different human cancer cell lines indicated moderate to low activity of the compounds. The molecular target of the compound was predicted through in-silico studies. Finding of the studies are presented herein.
Subban, Kamalraj; Subramani, Ramesh; Johnpaul, Muthumary
2013-01-01
A novel phenolic compound, 4-(2,4,7-trioxa-bicyclo[4.1.0]heptan-3-yl) phenol (1), was isolated from Pestalotiopsis mangiferae, an endophytic fungus associated with Mangifera indica Linn. The structure of the compound was elucidated on the basis of comprehensive spectral analysis (UV, IR, ¹H-, ¹³C- and 2D-NMR, as well as HRESI-MS). Compound (1) shows potent antibacterial and antifungal activity against Bacillus subtilis, Klebsiella pneumoniae, Escherichia coli, Micrococcus luteus, Pseudomonas aeruginosa and Candida albicans. The transmission electron microscope study for the mode of inhibition of compound (1) on bacterial pathogens revealed the destruction of bacterial cells by cytoplasm agglutination with the formation of pores in cell wall membranes.
NASA Astrophysics Data System (ADS)
Almodarresiyeh, H. A.; Shahab, S. N.; Zelenkovsky, V. M.; Ariko, N. G.; Filippovich, L. N.; Agabekov, V. E.
2014-03-01
The new substance diethyl 2,2'-[(1,1'-biphenyl)-4,4'-diylbis(azanediyl)]diacetate (M13) was modeled using the Hartree-Fock and density functional theory methods and then synthesized. The electronic absorption spectrum of M13 in dimethylformamide solution was calculated. The UV, IR, and NMR spectra of M13 were presented.
NASA Technical Reports Server (NTRS)
Kondo, Y.; Worrall, D. M.; Oke, J. B.; Yee, H. K. C.; Neugebauer, G.; Matthews, K.; Feldman, P. A.; Mushotzky, R. F.; Hackney, R. L.; Hackney, K. R. H.
1981-01-01
Observations in the X-ray, UV, visible, IR and radio regions of the BL Lac object Mrk 501 made over the course of two months are reported. The measurements were made with the A2 experiment on HEAO 1 (X-ray), the SWP and LWR cameras on IUE (UV), the 5-m Hale telescope (visible), the 2.5-m telescope at Mount Wilson (IR), the NRAO 92-m radio telescope at Green Bank (4750 MHz) and the 46-m radio telescope at the Algonquin Observatory (10275 and 10650 MHz). The quasi-simultaneously observed spectral slope is found to be positive and continuous from the X-ray to the UV, but to gradually flatten and possibly turn down from the mid-UV to the visible; the optical-radio emission cannot be accounted for by a single power law. The total spectrum is shown to be compatible with a synchrotron self-Compton emission mechanism, while the spectrum from the visible to the X-ray is consistent with synchrotron radiation or inverse-Compton scattering by a hot thermal electron cloud. The continuity of the spectrum from the UV to the X-ray is noted to imply a total luminosity greater than previous estimates by a factor of 3-4.
Total Defense + Repair: A Novel Concept in Solar Protection and Skin Rejuvenation.
McDaniel, David H; Hamzavi, Iltefat H; Zeichner, Joshua A; Fabi, Sabrina G; Bucay, Vivian W; Harper, Julie C; Comstock, Jody A; Makino, Elizabeth T; Mehta, Rahul C; Vega, Virginia L
2015-07-01
For more than a century, solar radiation has been known to contribute significantly to the extrinsic aging of skin. Until recently, this was almost exclusively attributed to the photodamage caused by ultraviolet (UV) light. However, a growing body of evidence now indicates that both infrared (IR) and visible light may also contribute to extrinsic skin aging. Infrared radiation, comprised of IR-A, IR-B, and IR-C, accounts for 54.3% of the total solar radiation reaching the skin. Studies have shown that IR radiation is also responsible for skin aging. Thus, IR-A radiation regulates hundreds of genes in skin, with roles in extracellular matrix (ECM) homeostasis regulation, apoptosis, cell growth, and stress responses. IR-B and IR-C radiation are primarily responsible for the increase in skin temperature associated with solar exposure, and are implicated in heat-related skin destruction of collagen and elastin, which is characterized by an increase in the expression of matrix metalloproteinases (MMPs). The contribution of visible light to photoaging is less well understood; however, some preliminary indication associates visible light with the upregulation of MMPs' expression, DNA damage, and keratinocyte proliferation. Interestingly, the common denominator that links skin damage to the different solar wavelengths is the enhanced production of reactive molecule species (RMS) and therewith increased oxidative stress. SkinMedica® Total Defense + Repair (TD+R; SkinMedica Inc., an Allergan company, Irvine, CA) is a "superscreen," which combines broad spectrum UV protection with a unique blend of antioxidants (SOL-IR Advanced Antioxidant Complex™) that provide protection from IR radiation while promoting skin repair. Preclinical studies have indicated that TD+R SPF34 prevents the formation of UV-induced sunburn cells and cyclobutane pyrimidine dimers while preserving or improving the expression of ECM genes. In addition, it prevents IR-A-triggered fragmentation of elastin fibers and expression of MMP-1. Initial clinical studies indicate that TDR+R SPF34 reduces the increase in surface temperature seen with IR radiation. A significant improvement in the appearance of lines and wrinkles was reported as early as week 2 in patients using TDR+R SPF34. In summary, we observed that the unique blend of antioxidants present in TD+R acts in harmony with SPF active ingredients, expanding solar protection beyond UV radiation and counterbalancing the deleterious effects of free radicals on skin cells by promoting endogenous repair.
Rahman, Mohammed M; Khan, Sher Bahadar; Marwani, Hadi M; Asiri, Abdullah M; Alamry, Khalid A; Al-Youbi, Abdulrahman O
2013-01-30
We have prepared calcined CuO microsheets (MSs) by a wet-chemical process using reducing agents in alkaline medium and characterized by UV/vis., fourier transform infrared (FT-IR) spectroscopy, powder X-ray diffraction (XRD), and field-emission scanning electron microscopy (FESEM) etc. The detailed structural, compositional, and optical characterizations of the MSs were evaluated by XRD pattern, FT-IR, X-ray photoelectron spectroscopy (XPS), and UV-vis spectroscopy, respectively which confirmed that the obtained MSs are well-crystalline CuO and possessed good optical properties. The CuO MSs morphology was investigated by FESEM, which confirmed that the calcined nanomaterials were sheet-shaped and grown in large-quantity. Here, the efficiency of the CuO MS was applied for a selective adsorption of gold(III) ion prior to its detection by inductively coupled plasma-optical emission spectrometry (ICP-OES). The selectivity of CuO MSs towards various metal ions, including Au(III), Cd(II), Co(II), Cr(III), Fe(III), Pd(II), and Zn(II) was analyzed. Based on the adsorption isotherm study, it was confirmed that the selectivity of MSs phase was mostly towards Au(III) ion. The static adsorption capacity for Au(III) was calculated to be 57.0 mg g(-1). From Langmuir adsorption isotherm, it was confirmed that the adsorption process was mainly monolayer-adsorption onto a surface containing a finite number of adsorption sites. Copyright © 2012 Elsevier B.V. All rights reserved.
Saenz, Gustavo A; Karapetrov, Goran; Curtis, James; Kaul, Anupama B
2018-01-19
The design, fabrication, and characterization of ultra-high responsivity photodetectors based on mesoscopic multilayer MoS 2 is presented, which is a less explored system compared to direct band gap monolayer MoS 2 that has received increasing attention in recent years. The device architecture is comprised of a metal-semiconductor-metal (MSM) photodetector, where Mo was used as the contact metal to suspended MoS 2 membranes. The photoresponsivity [Formula: see text] was measured to be ~1.4 × 10 4 A/W, which is > 10 4 times higher compared to prior reports, while the detectivity D* was computed to be ~2.3 × 10 11 Jones at 300 K at an optical power P of ~14.5 pW and wavelength λ of ~700 nm. In addition, the dominant photocurrent mechanism was determined to be the photoconductive effect (PCE), while a contribution from the photogating effect was also noted from trap-states that yielded a wide spectral photoresponse from UV-to-IR (400 nm to 1100 nm) with an external quantum efficiency (EQE) ~10 4 . From time-resolved photocurrent measurements, a decay time τ d ~ 2.5 ms at 300 K was measured from the falling edge of the photogenerated waveform after irradiating the device with a stream of incoming ON/OFF white light pulses.
Feng, Zhe; Lu, Ruiqing; Yuan, Baoling; Zhou, Zhenming; Wu, Qingqing; Nguyen, Thanh H
2016-12-01
MS2 inactivation by UV irradiance was investigated with the focus on how the disinfection efficacy is influenced by bacteriophage MS2 aggregation and adsorption to particles in solutions with different compositions. Kaolinite and Microcystis aeruginosa were used as model inorganic and organic particles, respectively. In the absence of model particles, MS2 aggregates formed in either 1mM NaCl at pH=3 or 50-200mM ionic strength CaCl 2 solutions at pH=7 led to a decrease in the MS2 inactivation efficacy because the virions located inside the aggregate were protected from the UV irradiation. In the presence of kaolinite and Microcystis aeruginosa, MS2 adsorbed onto the particles in either 1mM NaCl at pH=3 or 50-200mM CaCl 2 solutions at pH=7. In contrast to MS2 aggregates formed without the presence of particles, more MS2 virions adsorbed on these particles were exposed to UV irradiation to allow an increase in MS2 inactivation. In either 1mM NaCl at pH from 4 to 8 or 2-200mM NaCl solutions at pH=7, the absence of MS2 aggregation and adsorption onto the model particles explained why MS2 inactivation was not influenced by pH, ionic strength, and the presence of model particles in these conditions. The influence of virus adsorption and aggregation on the UV disinfection efficiency found in this research suggests the necessity of accounting for particles and cation composition in virus inactivation for drinking water. Copyright © 2016 Elsevier B.V. All rights reserved.
Sun exposure over the life course and associations with multiple sclerosis.
Tremlett, Helen; Zhu, Feng; Ascherio, Alberto; Munger, Kassandra L
2018-04-03
To examine sun exposure and multiple sclerosis (MS) over the life course (ages 5-15 and 16-20 years, every 10 years thereafter). Cases with MS (n = 151) and age-matched controls (n = 235) from the Nurses' Health Study cohorts completed summer, winter, and lifetime sun exposure history questionnaires. Cumulative ambient ultraviolet (UV)-B (based on latitude, altitude, cloud cover) exposure before MS onset was expressed as tertiles. Seasonal sun exposure was defined as low vs high hours per week (summer [≤9 vs >10 h/wk]; winter [≤3 vs >4 h/wk]). Relative risks (RRs) and 95% confidence intervals (CIs) were estimated via conditional logistic regression with adjustment for body mass index, ancestry, smoking, and vitamin D supplementation. Most participants were white (98%); the mean age at MS onset was 39.5 years. Living in high (vs low) UV-B areas before MS onset was associated with a 45% lower MS risk (adjusted RR 0.55, 95% CI 0.42-0.73). Similar reduced risks (51%-52%) for medium or high exposure were observed at ages 5 to 15 years and at 5 to 15 years before MS onset (adjusted p < 0.05). At age 5 to 15 years, living in a high (vs low) UV-B area and having high (vs low) summer sun exposure were associated with a lower MS risk (RR 0.45, 95% CI 0.21-0.96). Living in high ambient UV-B areas during childhood and the years leading up to MS onset was associated with a lower MS risk. High summer sun exposure in high ambient UV-B areas was also associated with a reduced risk. © 2018 American Academy of Neurology.
Yang, Hui; Meng, Guoyun; Zhou, Yayun; Tang, Huaijun; Zhao, Jishou; Wang, Zhengliang
2015-09-14
Three cationic iridium(III) complexes [Ir(ppy)₂(phen)][PF₆] (C1), [Ir(ppy)₂(phen)]₂SiF₆ (C2) and [Ir(ppy)₂(phen)]₂TiF₆ (C3) (ppy: 2-phenylpyridine, phen: 1, 10-phenanthroline) using different anions were synthesized and characterized by ¹H Nuclear magnetic resonance (¹HNMR), mass spectra (MS), Fourier transform infrared (FTIR) spectra and element analysis (EA). After the ultraviolet visible (UV-vis) absorption spectra, photoluminescent (PL) properties and thermal properties of the complexes were investigated, complex C1 and C3 with good optical properties and high thermal stability were used in white light-emitting diodes (WLEDs) as luminescence conversion materials by incorporation with 460 nm-emitting blue GaN chips. The integrative performances of the WLEDs fabricated with complex C1 and C3 are better than those fabricated with the widely used yellow phosphor Y₃Al₅O 12 :Ce 3+ (YAG). The color rendering indexes of the WLEDs with C1 and C3 are 82.0 and 82.6, the color temperatures of them are 5912 K and 3717 K, and the maximum power efficiencies of them are 10.61 Lm·W -1 and 11.41 Lm·W -1 , respectively.
Shandilya, Bhavesh K; Sen, Shrabani; Sahoo, Tapas; Talukder, Srijeeta; Chaudhury, Pinaki; Adhikari, Satrajit
2013-07-21
The selective control of O-H/O-D bond dissociation in reduced dimensionality model of HOD molecule has been explored through IR+UV femtosecond pulses. The IR pulse has been optimized using simulated annealing stochastic approach to maximize population of a desired low quanta vibrational state. Since those vibrational wavefunctions of the ground electronic states are preferentially localized either along the O-H or O-D mode, the femtosecond UV pulse is used only to transfer vibrationally excited molecule to the repulsive upper surface to cleave specific bond, O-H or O-D. While transferring from the ground electronic state to the repulsive one, the optimization of the UV pulse is not necessarily required except specific case. The results so obtained are analyzed with respect to time integrated flux along with contours of time evolution of probability density on excited potential energy surface. After preferential excitation from [line]0, 0> ([line]m, n> stands for the state having m and n quanta of excitations in O-H and O-D mode, respectively) vibrational level of the ground electronic state to its specific low quanta vibrational state ([line]1, 0> or [line]0, 1> or [line]2, 0> or [line]0, 2>) by using optimized IR pulse, the dissociation of O-D or O-H bond through the excited potential energy surface by UV laser pulse appears quite high namely, 88% (O-H ; [line]1, 0>) or 58% (O-D ; [line]0, 1>) or 85% (O-H ; [line]2, 0>) or 59% (O-D ; [line]0, 2>). Such selectivity of the bond breaking by UV pulse (if required, optimized) together with optimized IR one is encouraging compared to the normal pulses.
NASA Astrophysics Data System (ADS)
Pagaran, J.; Weber, M.; Burrows, J.
2009-08-01
The change of spectral decomposition of the total radiative output on various timescales of solar magnetic activity is of large interest to terrestrial and solar-stellar atmosphere studies. Starting in 2002, SCIAMACHY was the first satellite instrument to observe daily solar spectral irradiance (SSI) continuously from 230 nm (UV) to 1750 nm (near-infrared; near-IR). In order to address the question of how much UV, visible (vis), and IR spectral regions change on 27 day and 11 year timescales, we parameterize short-term SSI variations in terms of faculae brightening (Mg II index) and sunspot darkening (photometric sunspot index) proxies. Although spectral variations above 300 nm are below 1% and, therefore, well below the accuracy of absolute radiometric calibration, relative accuracy for short-term changes is shown to be in the per mill range. This enables us to derive short-term spectral irradiance variations from the UV to the near-IR. During Halloween solar storm in 2003 with a record high sunspot area, we observe a reduction of 0.3% in the near-IR to 0.5% in the vis and near-UV. This is consistent with a 0.4% reduction in total solar irradiance (TSI). Over an entire 11 year solar cycle, SSI variability covering simultaneously the UV, vis, and IR spectral regions have not been directly observed so far. Using variations of solar proxies over solar cycle 23, solar cycle spectral variations have been estimated using scaling factors that best matched short-term variations of SCIAMACHY. In the 300-400 nm region, which strongly contributes to TSI solar cycle change, a contribution of 34% is derived from SCIAMACHY observations, which is lower than the reported values from SUSIM satellite data and the empirical SATIRE model. The total UV contribution (below 400 nm) to TSI solar cycle variations is estimated to be 55%.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pagaran, J.; Weber, M.; Burrows, J.
2009-08-01
The change of spectral decomposition of the total radiative output on various timescales of solar magnetic activity is of large interest to terrestrial and solar-stellar atmosphere studies. Starting in 2002, SCIAMACHY was the first satellite instrument to observe daily solar spectral irradiance (SSI) continuously from 230 nm (UV) to 1750 nm (near-infrared; near-IR). In order to address the question of how much UV, visible (vis), and IR spectral regions change on 27 day and 11 year timescales, we parameterize short-term SSI variations in terms of faculae brightening (Mg II index) and sunspot darkening (photometric sunspot index) proxies. Although spectral variationsmore » above 300 nm are below 1% and, therefore, well below the accuracy of absolute radiometric calibration, relative accuracy for short-term changes is shown to be in the per mill range. This enables us to derive short-term spectral irradiance variations from the UV to the near-IR. During Halloween solar storm in 2003 with a record high sunspot area, we observe a reduction of 0.3% in the near-IR to 0.5% in the vis and near-UV. This is consistent with a 0.4% reduction in total solar irradiance (TSI). Over an entire 11 year solar cycle, SSI variability covering simultaneously the UV, vis, and IR spectral regions have not been directly observed so far. Using variations of solar proxies over solar cycle 23, solar cycle spectral variations have been estimated using scaling factors that best matched short-term variations of SCIAMACHY. In the 300-400 nm region, which strongly contributes to TSI solar cycle change, a contribution of 34% is derived from SCIAMACHY observations, which is lower than the reported values from SUSIM satellite data and the empirical SATIRE model. The total UV contribution (below 400 nm) to TSI solar cycle variations is estimated to be 55%.« less
Ultraviolet (UV)-absorbing chemicals are widely used in cosmetics, sunscreens, and plastics to block UV radiation from the sun. Parabens are preservatives and are used extensively in cosmetics, pharmaceuticals, and foods to prevent microbial growth and preserve a product’s inte...
Variable extinction in HD 45677 and the evolution of dust grains in pre-main-sequence disks
NASA Technical Reports Server (NTRS)
Sitko, Michael L.; Halbedel, Elaine M.; Lawrence, Geoffrey F.; Smith, J. Allyn; Yanow, Ken
1994-01-01
Changes in the UV extinction and IR emission were sought in the Herbig Ae/Be star candidate HD 45677 (= FS CMa) by comparing UV, optical, and IR observations made approximately 10 yr apart. HD 45677 varied significantly, becoming more than 50% brighter in the UV and optical than it was a decade ago. A comparison of the observations between epochs indicates that if the variations are due to changes in dust obscuration, the dust acts as a gray absorber into the near-IR and must be depleted in grains smaller than 1 micron. This is similar to the results obtained on the circumstellar disks of stars like Vega and Beta Pic, and suggests that radiation pressure may be responsible for the small-grain depletion. In addition, the total IR flux seems to have declined, indicating a decrease in the total mass of the dust envelope that contributes to the IR emission in this part of the spectrum. Due to the anomalous nature of the extinction, the use of normal extinction curves to deredden the spectral energy distributions of stars with circumstellar dust may lead to significant errors and should be used with great caution.
Microbial UV fluence-response assessment using a novel UV-LED collimated beam system.
Bowker, Colleen; Sain, Amanda; Shatalov, Max; Ducoste, Joel
2011-02-01
A research study has been performed to determine the ultraviolet (UV) fluence-response of several target non-pathogenic microorganisms to UV light emitting diodes (UV-LEDs) by performing collimated beam tests. UV-LEDs do not contain toxic mercury, offer design flexibility due to their small size, and have a longer operational life than mercury lamps. Comsol Multiphysics was utilized to create an optimal UV-LED collimated beam design based on number and spacing of UV-LEDs and distance of the sample from the light source while minimizing the overall cost. The optimized UV-LED collimated beam apparatus and a low-pressure mercury lamp collimated beam apparatus were used to determine the UV fluence-response of three surrogate microorganisms (Escherichia coli, MS-2, T7) to 255 nm UV-LEDs, 275 nm UV-LEDs, and 254 nm low-pressure mercury lamps. Irradiation by low-pressure mercury lamps produced greater E. coli and MS-2 inactivation than 255 nm and 275 nm UV-LEDs and similar T7 inactivation to irradiation by 275 nm UV-LEDs. The 275 nm UV-LEDs produced more efficient T7 and E. coli inactivation than 255 nm UV-LEDs while both 255 nm and 275 nm UV-LEDs produced comparable microbial inactivation for MS-2. Differences may have been caused by a departure from the time-dose reciprocity law due to microbial repair mechanisms. Copyright © 2010 Elsevier Ltd. All rights reserved.
SO2 in the middle atmosphere of Venus: IR measurements from Venera 15 and comparison to UV
NASA Technical Reports Server (NTRS)
Zasova, L. V.; Moroz, V. I.; Esposito, L. W.; Na, C. Y.
1992-01-01
Two sets of measurements of SO2 bands in the Venus spectra are presented and compared: IR spectra obtained on the USSR Venera 15 orbiter and UV spectra from the American Pioneer Venus orbiter and sounding rockets. The 40-mbar level was chosen as a reference level for comparison. The UV data are referred to this level. There are three SO2 bands in the infrared spectrum: at 519, 1150, and 1360 cm(exp -1). The levels of their formation in the atmosphere may differ significantly, by more than 10 km.
1988-02-01
the optical behavior of the material in its preswitched, or A Perkin-Elmer Model 330 UV - Visible -IR double beam ,% spectrophotometer with a specular...S ~ * ." at.* U a * . a. *%~ ~9g 0 ~ --- a.. ’ a * ~ .r~vaa- *a,~ * ~ * ~****.,*a,* *** UV - Visible -IR Optical Behavior of Sputter Deposited Gee x...Films deposited in 0 to 60% Ar were nominally germania. However, transmission in the UV - visible , the strength of the 245nm defect center, the optical
NASA Astrophysics Data System (ADS)
Mironov, Gleb G.; Logie, Jennifer; Okhonin, Victor; Renaud, Justin B.; Mayer, Paul M.; Berezovski, Maxim V.
2012-07-01
We present affinity capillary electrophoresis and mass spectrometry (ACE-MS) as a comprehensive separation technique for label-free solution-based affinity analysis. The application of ACE-MS for measuring affinity constants between eight small molecule drugs [ibuprofen, s-flurbiprofen, diclofenac, phenylbutazone, naproxen, folic acid, resveratrol, and 4,4'-(propane-1,3-diyl) dibenzoic acid] and β-cyclodextrin is described. We couple on-line ACE with MS to combine the separation and kinetic capability of ACE together with the molecular weight and structural elucidation of MS in one system. To understand the full potential of ACE-MS, we compare it with two other methods: Direct infusion mass spectrometry (DIMS) and ACE with UV detection (ACE-UV). After the evaluation, DIMS provides less reliable equilibrium dissociation constants than separation-based ACE-UV and ACE-MS, and cannot be used solely for the study of noncovalent interactions. ACE-MS determines apparent dissociation constants for all reacting small molecules in a mixture, even in cases when drugs overlap with each other during separation. The ability of ACE-MS to interact, separate, and rapidly scan through m/z can facilitate the simultaneous affinity analysis of multiple interacting pairs, potentially leading to the high-throughput screening of drug candidates.
Improved sensing using simultaneous deep-UV Raman and fluorescence detection-II
NASA Astrophysics Data System (ADS)
Hug, W. F.; Bhartia, R.; Sijapati, K.; Beegle, L. W.; Reid, R. D.
2014-05-01
Photon Systems in collaboration with JPL is continuing development of a new technology robot-mounted or hand-held sensor for reagentless, short-range, standoff detection and identification of trace levels chemical, biological, and explosive (CBE) materials on surfaces. This deep ultraviolet CBE sensor is the result of Army STTR and DTRA programs. The evolving 10 to 15 lb, 20 W, sensor can discriminate CBE from background clutter materials using a fusion of deep UV excited resonance Raman (RR) and laser induced native fluorescence (LINF) emissions collected is less than 1 ms. RR is a method that provides information about molecular bonds, while LINF spectroscopy is a much more sensitive method that provides information regarding the electronic configuration of target molecules. Standoff excitation of suspicious packages, vehicles, persons, and other objects that may contain hazardous materials is accomplished using excitation in the deep UV where there are four main advantages compared to near-UV, visible or near-IR counterparts. 1) Excited between 220 and 250 nm, Raman emission occur within a fluorescence-free region of the spectrum, eliminating obscuration of weak Raman signals by fluorescence from target or surrounding materials. 2) Because Raman and fluorescence occupy separate spectral regions, detection can be done simultaneously, providing an orthogonal set of information to improve both sensitivity and lower false alarm rates. 3) Rayleigh law and resonance effects increase Raman signal strength and sensitivity of detection. 4) Penetration depth into target in the deep UV is short, providing spatial/spectral separation of a target material from its background or substrate. 5) Detection in the deep UV eliminates ambient light background and enable daylight detection.
NASA Technical Reports Server (NTRS)
Getty, Stephanie; Brickerhoff, William; Cornish, Timothy; Ecelberger, Scott; Floyd, Melissa
2012-01-01
RATIONALE A miniature time-of-flight mass spectrometer has been adapted to demonstrate two-step laser desorption-ionization (LOI) in a compact instrument package for enhanced organics detection. Two-step LDI decouples the desorption and ionization processes, relative to traditional laser ionization-desorption, in order to produce low-fragmentation conditions for complex organic analytes. Tuning UV ionization laser energy allowed control ofthe degree of fragmentation, which may enable better identification of constituent species. METHODS A reflectron time-of-flight mass spectrometer prototype measuring 20 cm in length was adapted to a two-laser configuration, with IR (1064 nm) desorption followed by UV (266 nm) postionization. A relatively low ion extraction voltage of 5 kV was applied at the sample inlet. Instrument capabilities and performance were demonstrated with analysis of a model polycyclic aromatic hydrocarbon, representing a class of compounds important to the fields of Earth and planetary science. RESULTS L2MS analysis of a model PAH standard, pyrene, has been demonstrated, including parent mass identification and the onset o(tunable fragmentation as a function of ionizing laser energy. Mass resolution m/llm = 380 at full width at half-maximum was achieved which is notable for gas-phase ionization of desorbed neutrals in a highly-compact mass analyzer. CONCLUSIONS Achieving two-step laser mass spectrometry (L2MS) in a highly-miniature instrument enables a powerful approach to the detection and characterization of aromatic organics in remote terrestrial and planetary applications. Tunable detection of parent and fragment ions with high mass resolution, diagnostic of molecular structure, is possible on such a compact L2MS instrument. Selectivity of L2MS against low-mass inorganic salt interferences is a key advantage when working with unprocessed, natural samples, and a mechanism for the observed selectivity is presented.
Large-scale exact diagonalizations reveal low-momentum scales of nuclei
NASA Astrophysics Data System (ADS)
Forssén, C.; Carlsson, B. D.; Johansson, H. T.; Sääf, D.; Bansal, A.; Hagen, G.; Papenbrock, T.
2018-03-01
Ab initio methods aim to solve the nuclear many-body problem with controlled approximations. Virtually exact numerical solutions for realistic interactions can only be obtained for certain special cases such as few-nucleon systems. Here we extend the reach of exact diagonalization methods to handle model spaces with dimension exceeding 1010 on a single compute node. This allows us to perform no-core shell model (NCSM) calculations for 6Li in model spaces up to Nmax=22 and to reveal the 4He+d halo structure of this nucleus. Still, the use of a finite harmonic-oscillator basis implies truncations in both infrared (IR) and ultraviolet (UV) length scales. These truncations impose finite-size corrections on observables computed in this basis. We perform IR extrapolations of energies and radii computed in the NCSM and with the coupled-cluster method at several fixed UV cutoffs. It is shown that this strategy enables information gain also from data that is not fully UV converged. IR extrapolations improve the accuracy of relevant bound-state observables for a range of UV cutoffs, thus making them profitable tools. We relate the momentum scale that governs the exponential IR convergence to the threshold energy for the first open decay channel. Using large-scale NCSM calculations we numerically verify this small-momentum scale of finite nuclei.
Polak, Piotr; Sołtyszewski, Ireneusz; Niemcunowicz-Janica, Anna; Siwińska-Ziółkowska, Agnieszka; Widecka-Deptuch, Emilia; Lukasik, Marcin; Janica, Jerzy
2007-01-01
The paper presents a case of medical malpractice during the test for phenylketonuria. The authors analyzed all documents collected in the course of the investigation of infant poisoning due to accidental administration of ninhydrin. The medical assessment was based on an extensive review of the case history, as well as on spectroscopy (FT-IR), chromatography and chemical analysis findings that allowed for confirming the presence of the toxic substance in the evidence material collected during the initial investigation. The obtained results confirmed the presence of ninhydrin in the tea cup and in the teaspoon, which were used to prepare the diagnostic medium. No ninhydrin was found in other investigated materials. The employment of routine research methods, including GC-MS, FT-IR and UV-VIS, allowed for detection and identification of the pure chemical form of ninhydrin, as well as its color complex with amino acids. The detailed case analysis, as well as the variability of extensive evidence material collected during the investigation allowed for determining the identity of persons responsible for accidental administration of the poisoning substance to the infant.
Ali, Imran; Wani, Waseem A; Khan, Amber; Haque, Ashanul; Ahmad, Aijaz; Saleem, Kishwar; Manzoor, Nikhat
2012-08-01
A pyrazoline based ligand; (5-(4-chlorophenyl)-3-phenyl-4, 5-dihydro-1H-pyrazole-1-carbothioamide) has been synthesized by Claisen-Schmidt condensation of acetophenone with p-chlorobenzaldehyde, followed by sodium hydroxide assisted cyclization of the resulting chalcone with thiosemicarbazide. Metal ion complexes of the synthesized ligand were prepared with Cu(II) and Ni(II) metal ions, separately and respectively. Ligand and the metal complexes were characterized by elemental analysis, FT-IR, UV-Vis, (1)HNMR, ESI-MS and (13)CNMR spectroscopic techniques. Molar conductance measurements in DMSO suggested non-electrolytic nature of the complexes. Tetragonally distorted octahedral geometry for copper and octahedral geometry for the nickel complexes was proposed on the basis of UV-Vis spectroscopic studies and magnetic moment measurements. The complexes were investigated for their ability to kill human fungal pathogen Candida by determining MICs (Minimum inhibitory concentrations), inhibition in solid media and ability to produce a possible synergism with conventional most clinically practiced antifungals by disc diffusion assay and FICI (fractional inhibitory concentration index). Copyright © 2012 Elsevier Ltd. All rights reserved.
Facile synthesis, structural elucidation and spectral analysis of pyrrole 4-imidazole derivatives
NASA Astrophysics Data System (ADS)
Singh, R. N.; Rawat, Poonam; Baboo, Vikas
2015-12-01
In this work pyrrole 4-imidazole derivatives (3A-3D): benzimidazoles and pyrrole 4-imidazoline have been synthesized by condensation, cyclization and oxidation of ethyl 4-formyl-3,5-dimethyl-1H-pyrrole carboxylate and phenylene diamine derivatives/ethylene diamine. The structure of these biheterocyclic compounds have been derived by elemental and spectroscopic - IR, UV, MS, 1H and 13C NMR analysis as well as theoretical study. The static first hyperpolarizability, β0 values for pyrrole 4-imidazole derivatives, (3A-3D) have been calculated as 10.901 × 10-31, 19.607 × 10-31, 40.323 × 10-31, 5.686 × 10-31 esu, respectively. The gradual increase in β0 value of synthesized pyrrole-benzimidazole derivatives from 3A to 3C is due to addition of acceptors -Cl atom in 3B to -NO2 group in 3C on benzimidazole side. The experimental absorption spectra found to be in UV region and the high β0 values show that the synthesized pyrrole-imidazoles are suitable as non-linear optical (NLO) materials.
NASA Astrophysics Data System (ADS)
Hosny, Nasser Mohammed; Hussien, Mostafa A.; Radwan, Fatima M.; Nawar, Nagwa
2014-11-01
Four new metal complexes derived from the reaction of Cu(II), Co(II), Ni(II) and Zn(II) acetates with the Schiff-base ligand (H3L) resulted from the condensation of the amino acid 2-amino-3-hydroxyprobanoic acid (serine) and acetylacetone have been synthesized and characterized by, elemental analyses, ES-MS, IR, UV-Vis., 1H NMR, 13C NMR, ESR, thermal analyses (TGA and DTG) and magnetic measurements. The results showed that the Schiff-base ligand acts as bi-negative tridentate through the azomethine nitrogen, the deprotonated carboxylate oxygen and the enolic carbonyl oxygen. The optical band gaps measurements indicated the semi-conducting nature of these complexes. Molecular docking was used to predict the binding between the Schiff base ligand with the receptor of prostate cancer mutant H874Y. The interactions between the Cu(II) complex and calf thymus DNA (CT-DNA) have been studied by UV spectra. The results confirm that the Cu(II) complex binds to CT-DNA in an intercalative mode.
NASA Astrophysics Data System (ADS)
Esakkirajan, M.; Prabhu, N. M.; Manikandan, R.; Beulaja, M.; Prabhu, D.; Govindaraju, K.; Thiagarajan, R.; Arulvasu, C.; Dhanasekaran, G.; Dinesh, D.; Babu, G.
2014-06-01
A compound was isolated from Cassia auriculata leaves and characterized by high-performance liquid chromatography (HPLC), liquid chromatography mass spectrometry (LC-MS), UV-vis spectroscopy (UV-vis), Fourier transform infrared spectroscopy (FT-IR) and nuclear magnetic resonance spectroscopy (NMR). The in vitro anticancer effect of the compound isolated from C. auriculata was evaluated in human colon cancer cells HCT 15 by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay, cytotoxicity, nuclear morphology analysis and measurement of lactate dehydrogenase. The isolated compound 4-(2,5 dichlorobenzyl)-2,3,4,5,6,7 hexahydro7(4 methoxyphenyl)benzo[h][1,4,7] triazecin8(1H)-one showed 50% inhibition of HCT 15 cells when tested at 20 μg/ml after 24 h incubation. Cytotoxicity, nuclear morphology and lactate dehydrogenase assays clearly show potent anticancer activity of the isolated compound against colon cancer. Thus, the in vitro findings suggest that the compound isolated from C. auriculata leaves have potent anti-cancer properties with possible clinical applications.
Solar photocatalytic degradation of isoproturon over TiO2/H-MOR composite systems.
Sharma, Mangalampalli V Phanikrishna; Durgakumari, Valluri; Subrahmanyam, Machiraju
2008-12-30
The photocatalytic degradation and mineralization of isoproturon herbicide was investigated in aqueous solution containing TiO2 over H-mordenite (H-MOR) photocatalysts under solar light. The catalysts are characterized by X-ray diffraction (XRD), UV-Vis diffused reflectance spectra (UV-Vis DRS), Fourier transform-infra red spectra (FT-IR) and scanning electron microscopy (SEM) techniques. The effect of TiO2, H-MOR support and different wt% of TiO2 over the support on the photocatalytic degradation and influence of parameters such as TiO2 loading, catalyst amount, pH and initial concentration of isoproturon on degradation are evaluated. 15wt% TiO2/H-MOR composite is found to be optimum. The degradation reaction follows pseudo-first order kinetics and is discussed in terms of Langmuir-Hinshelwood (L-H) kinetic model. The extent of isoproturon mineralization studied with chemical oxygen demand (COD) and total organic carbon (TOC) measurements and approximately 80% mineralization occurred in 5h. A plausible mechanism is proposed based on the intermediates identified by liquid chromatography-mass spectroscopy (LC-MS).
NASA Astrophysics Data System (ADS)
Ullah, Azeem; Shah, Faheem; Khan, Imran; Anwar, Muhammad; Shah, Kiramat; Muhammad, Munira Taj; Ahmad, Farid
2018-03-01
In this work, synthesis of novel symmetrical 4-(2-bromo-4-(5-bromo-1H-benzo[d] imidazol-2-yl) phenoxy) tetra substituted zinc phthalocyanine has been reported. The novel benzimidazole zinc phthlocynine compound (3) has been characterized by MALDI-TOF MS, FT-IR, UV-vis, and 1H NMR spectroscopy. This new compound 3 displayed excellent selectivity towards Bi3 + ion in the presence of other competitive ions including Ca2 +, Cd2 +, Co2 + Cu2 +, Fe3 +, Hg2 +, Sn2 +, Mg2 +, Na+, Ni2 + and Pb2 + respectively. Upon addition of Bi3 + into the solution of compound 3 in DMSO, dramatic change was observed in the Q- and the B-bands in UV-visible spectra as a result of donor acceptor interactions. Reactive oxygen species (ROS) were also studied using 2,7-dichlorofluorescin diacetate (DCFH-DA) a fluorescent probe which is converted to highly fluorescent dichlorofluorescein (DCF) in the presence of ROS. This property of non-aggregating zinc phthalocyanine is promising as a photosensitizer in photodynamic therapy of cancer.
NASA Astrophysics Data System (ADS)
West, Raymond E.; Findsen, Eric W.; Isailovic, Dragan
2013-10-01
We report the development of a new AP visible-wavelength MALDI-ion trap-MS instrument with significantly improved performance over our previously reported system ( Int. J. Mass Spectrom. 315, 66-73 (2012)). A Nd:YAG pulsed laser emitting light at 532 nm was used to desorb and ionize oligosaccharides and peptides in transmission geometry through a glass slide. Limits of detection (LODs) achieved in MS mode correspond to picomole quantities of oligosaccharides and femtomole quantities of peptides. Tandem MS (MS/MS) experiments enabled identification of enzymatically digested proteins and oligosaccharides by comparison of MS/MS spectra with data found in protein and glycan databases. Moreover, the softness of ionization, LODs, and fragmentation spectra of biomolecules by AP visible-wavelength MALDI-MS were compared to those obtained by AP UV MALDI-MS using a Nd:YAG laser emitting light at 355 nm. AP visible-wavelength MALDI appears to be a softer ionization technique then AP UV MALDI for the analysis of sulfated peptides, while visible-wavelength MALDI-MS, MS/MS, and MS/MS/MS spectra of other biomolecules analyzed were mostly similar to those obtained by AP UV MALDI-MS. Therefore, the methodology presented will be useful for MS and MSn analyses of biomolecules at atmospheric pressure. Additionally, the AP visible-wavelength MALDI developed can be readily used for soft ionization of analytes on various mass spectrometers.
NASA Astrophysics Data System (ADS)
Faisst, Andreas L.; Capak, Peter L.; Yan, Lin; Pavesi, Riccardo; Riechers, Dominik A.; Barišić, Ivana; Cooke, Kevin C.; Kartaltepe, Jeyhan S.; Masters, Daniel C.
2017-09-01
Recent studies have found a significant evolution and scatter in the relationship between the UV spectral slope (β UV) and the infrared excess (IRX; L IR/L UV) at z > 4, suggesting different dust properties of these galaxies. The total far-infrared (FIR) luminosity is key for this analysis, but it is poorly constrained in normal (main-sequence) star-forming z > 5 galaxies, where often only one single FIR point is available. To better inform estimates of the FIR luminosity, we construct a sample of local galaxies and three low-redshift analogues of z > 5 systems. The trends in this sample suggest that normal high-redshift galaxies have a warmer infrared (IR) spectral energy distribution (SED) compared to average z < 4 galaxies that are used as priors in these studies. The blueshifted peak and mid-IR excess emission could be explained by a combination of a larger fraction of metal-poor interstellar medium being optically thin to ultraviolet (UV) light and a stronger UV radiation field due to high star formation densities. Assuming a maximally warm IR SED suggests a 0.6 dex increase in total FIR luminosities, which removes some tension between the dust attenuation models and observations of the IRX-β relation at z > 5. Despite this, some galaxies still fall below the minimum IRX-β relation derived with standard dust cloud models. We propose that radiation pressure in these highly star-forming galaxies causes a spatial offset between dust clouds and young star-forming regions within the lifetime of O/B stars. These offsets change the radiation balance and create viewing-angle effects that can change UV colors at fixed IRX. We provide a modified model that can explain the location of these galaxies on the IRX-β diagram.
Ultraviolet Satellite Measurements of Volcanic Ash. Chapter 12
NASA Technical Reports Server (NTRS)
Carn, S. A.; Krotkov, N. A.
2016-01-01
Ultraviolet (UV) remote sensing of volcanic ash and other absorbing aerosols from space began with the launch of the first Total Ozone Mapping Spectrometer (TOMS) instrument in 1978. Subsequent UV satellite missions (TOMS, GOME, SCIAMACHY, OMI, GOME-2, OMPS) have extended UV ash measurements to the present, generating a unique multidecadal record. A UV Aerosol Index (UVAI) based on two near-UV wavelengths, equally applicable to multispectral (TOMS, DSCOVR) or hyperspectral (GOME, SCIAMACHY, OMI, GOME-2, OMPS) instruments, has been used to derive a unique absorbing aerosol climatology across multiple UV satellite missions. Advantages of UV ash measurements relative to infrared (IR) techniques include the ability to detect ash at any altitude (assuming no clouds), above clouds, and over bright surfaces, where visible and IR techniques may fail. Disadvantages include the daytime-only restriction and nonspecificity to silicate ash, since UV measurements are sensitive to any UV-absorbing aerosol, including smoke, desert dust, and pollution. However, simultaneous retrieval of sulfur dioxide (SO2) abundance and UVAI provides robust discrimination of volcanic clouds. Although the UVAI is only semiquantitative, it has proved successful at detecting and tracking volcanic ash clouds from many volcanic eruptions since 1978. NASA A-Train measurements since 2006 (eg, CALIOP) have provided much improved constraints on volcanic ash altitude, and also permit identification of aerosol type through sensor synergy. Quantitative UV retrievals of ash optical depth, effective particle size, and ash column mass are possible and require assumptions of ash refractive index, particle size distribution, and ash layer altitude. The lack of extensive ash refractive index data in the UV-visible and the effects of ash particle shape on retrievals introduce significant uncertainty in the retrieved parameters, although limited validation against IR ash retrievals has been successful. In this contribution, we review UV ash detection and retrieval techniques and provide examples of volcanic eruptions detected in the approx. 37 year data record.
UV photostability of insect repellents evaluated through Raman spectroscopy
NASA Astrophysics Data System (ADS)
Bório, Viviane G.; Fernandes, Adjaci U.; Silveira, Landulfo
2016-02-01
The use of insect repellents either indoors or at places with incidence of solar radiation has been common due to dengue epidemics in Brazil. The lack of studies on the photostability of these substances has motivated this study, where the main goal was to verify the photostability and photodegradation of some of the commercially insect repellents available under the simulated ultraviolet (UV) radiation, by evaluating the molecular changes using dispersive Raman spectroscopy (830 nm excitation). A laboratory-made chamber was used for irradiating the repellents, where UV-A + UV-B radiations (UV-A: 5.5 mW/cm2 and UV-B 1.5 mW/cm2) can be obtained. The chamber internal temperature did not exceed 31 °C during experiments. The compounds n,n-diethyl-m-toluamide (DEET), IR-3535, andiroba and citronella oils, used as active ingredients in insect repellents, and commercial formula containing DEET (14.5% in ethanol and isopropyl myristate) and IR-3535 (16% in carbopol) were continuously irradiated for 8 h. The Raman spectrum of each sample was obtained before and after UV exposure. The compounds and the commercial formula containing IR-3535 showed photo-stability when irradiated, since no changes in the peaks were found. The commercial formula containing DEET showed spectral decrease at 524, 690, 1003 and 1606 cm-1, assigned to the DEET, and increase at 884 cm-1, assigned to the ethanol. These results indicate that the excipient could influence the photostability of the active ingredient. The Raman spectroscopy can be suitable to monitor the photodegradation under UV irradiation rapidly and reliably.
Evaluating UV-C LED disinfection performance and investigating potential dual-wavelength synergy.
Beck, Sara E; Ryu, Hodon; Boczek, Laura A; Cashdollar, Jennifer L; Jeanis, Kaitlyn M; Rosenblum, James S; Lawal, Oliver R; Linden, Karl G
2017-02-01
A dual-wavelength UV-C LED unit, emitting at peaks of 260 nm, 280 nm, and the combination of 260|280 nm together was evaluated for its inactivation efficacy and energy efficiency at disinfecting Escherichia coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores, compared to conventional low-pressure and medium-pressure UV mercury vapor lamps. The dual-wavelength unit was also used to measure potential synergistic effects of multiple wavelengths on bacterial and viral inactivation and DNA and RNA damage. All five UV sources demonstrated similar inactivation of E. coli. For MS2, the 260 nm LED was most effective. For HAdV2 and B. pumilus, the MP UV lamp was most effective. When measuring electrical energy per order of reduction, the LP UV lamp was most efficient for inactivating E. coli and MS2; the LP UV and MP UV mercury lamps were equally efficient for HAdV2 and B. pumilus spores. Among the UV-C LEDs, there was no statistical difference in electrical efficiency for inactivating MS2, HAdV2, and B. pumilus spores. The 260 nm and 260|280 nm LEDs had a statistical energy advantage for E. coli inactivation. For UV-C LEDs to match the electrical efficiency per order of log reduction of conventional LP UV sources, they must reach efficiencies of 25-39% or be improved on by smart reactor design. No dual wavelength synergies were detected for bacterial and viral inactivation nor for DNA and RNA damage. Copyright © 2016 Elsevier Ltd. All rights reserved.
A natural little hierarchy for RS from accidental SUSY
NASA Astrophysics Data System (ADS)
Gherghetta, Tony; von Harling, Benedict; Setzer, Nicholas
2011-07-01
We use supersymmetry to address the little hierarchy problem in Randall-Sundrum models by naturally generating a hierarchy between the IR scale and the electroweak scale. Supersymmetry is broken on the UV brane which triggers the stabilization of the warped extra dimension at an IR scale of order 10 TeV. The Higgs and top quark live near the IR brane whereas light fermion generations are localized towards the UV brane. Supersymmetry breaking causes the first two sparticle generations to decouple, thereby avoiding the supersymmetric flavour and CP problems, while an accidental R-symmetry protects the gaugino mass. The resulting low-energy sparticle spectrum consists of stops, gauginos and Higgsinos which are sufficient to stabilize the little hierarchy between the IR scale and the electroweak scale. Finally, the supersymmetric little hierarchy problem is ameliorated by introducing a singlet Higgs field on the IR brane.
Langer, Nico; Lindigkeit, Rainer; Schiebel, Hans-Martin; Papke, Uli; Ernst, Ludger; Beuerle, Till
2016-12-01
In February 2016, nine "spice-like" products from German language internet shops were analyzed. In total, eight different synthetic cannabinoids were identified by gas chromatography-mass spectrometry (GC-MS), namely THJ-018, THJ-2201, MAB-CHMINACA, 5F-ADB, 5Cl-AKB48 (syn.: 5C-AKB48), 4-pentenyl-AKB48, MDMB-CHMICA and 5F-AB-PINACA. For the majority of products only one synthetic cannabinoid was identified as the active ingredient, while two products contained 2 and 5 compounds, respectively. For some of the identified cannabinoids (MAB-CHMINACA, 5Cl-AKB48 and 4-pentenyl-AKB48) no or only insufficient physico-chemical data were available in literature. To our knowledge 5Cl-AKB48 and 4-pentenyl-AKB48 were found for the first time in commercially available products, hence an in-depth characterization of these compounds by NMR, EI-MS, ESI-MS/MS, IR- and UV spectroscopy was conducted. In addition, all synthetic cannabinoids were quantified by a GC-MS method using JWH-018 as internal standard and the corresponding response factors to calculate the total amount of all synthetic cannabinoids in the commercial smoking mixtures. The content of synthetic cannabinoids in the investigated products ranged from 23 to 120mg/g (average: 57mg/g), while individual compounds ranged from 1 to 120mg/g. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Correlation between UV and IR cutoffs in quantum field theory and large extra dimensions
NASA Astrophysics Data System (ADS)
Cortés, J. L.
1999-04-01
A recently conjectured relationship between UV and IR cutoffs in an effective field theory without quantum gravity is generalized in the presence of large extra dimensions. Estimates for the corrections to the usual calculation of observables within quantum field theory are used to put very stringent limits, in some cases, on the characteristic scale of the additional compactified dimensions. Implications for the cosmological constant problem are also discussed.
The Path to a UV/optical/IR Flagship: ATLAST and Its Predecessors
NASA Technical Reports Server (NTRS)
Thronson, Harley; Bolcar, Matthew R.; Clampin, Mark; Crooke, Julie; Feinberg, Lee; Oegerle, William; Postman, Marc; Rioux, Norman; Stahl, H. Philip; Stapelfeldt, Karl
2016-01-01
The recently completed study for the Advanced Technology Large-Aperture Telescope (ATLAST) was the culmination of three years of work that built upon earlier engineering designs, science objectives, and sustained recommendations for technology investments. Since the mid-1980s, multiple teams of astronomers, technologists, and engineers have developed concepts for a large-aperture UV/optical/IR space observatory to follow the Hubble Space Telescope (HST). Especially over the past decade, technology advances and exciting scientific results has led to growing support for development in the 2020s of a large UVOIR space observatory. Here we summarize the history of major mission designs, scientific goals, key technology recommendations, community workshops and conferences, and recommendations to NASA for a major UV/optical/IR observatory to follow HST. We conclude with a capsule summary of the ATLAST reference design developed over the past three years.
Effective holographic models for QCD: Glueball spectrum and trace anomaly
NASA Astrophysics Data System (ADS)
Ballon-Bayona, Alfonso; Boschi-Filho, Henrique; Mamani, Luis A. H.; Miranda, Alex S.; Zanchin, Vilson T.
2018-02-01
We investigate effective holographic models for QCD arising from five-dimensional dilaton gravity. The models are characterized by a dilaton with a mass term in the UV, dual to a CFT deformation by a relevant operator, and quadratic in the IR. The UV constraint leads to the explicit breaking of conformal symmetry, whereas the IR constraint guarantees linear confinement. We propose semianalytic interpolations between the UV and the IR and obtain a spectrum for scalar and tensor glueballs consistent with lattice QCD data. We use the glueball spectrum as a physical constraint to find the evolution of the model parameters as the mass term goes to 0. Finally, we reproduce the universal result for the trace anomaly of deformed CFTs and propose a dictionary between this result and the QCD trace anomaly. A nontrivial consequence of this dictionary is the emergence of a β function similar to the two-loop perturbative QCD result.
NASA Astrophysics Data System (ADS)
Kobayashi, K.; Suzuki, N.; Taniuchi, T.; Kaneko, T.; Yoshida, S.
A wide variety of organic compounds have been detected in such extraterrestrial bodies as meteorites and comets Amino acids were identified in the extracts from Murchison meteorite and other carbonaceous chondrites It is hypothesized that these compounds are originally formed in ice mantles of interstellar dusts ISDs in molecular clouds by cosmic rays and ultraviolet light UV Formation of amino acid precursors by high energy protons or UV irradiation of simulated ISDs was reported by several groups The amino acid precursors were however not well-characterized We irradiated a frozen mixture of methanol ammonia and water with heavy ions to study possible organic compounds abiotically formed in molecular clouds by cosmic rays A mixture of methanol ammonia and water was irradiated with carbon beams 290 MeV u from a heavy ion accelerator HIMAC of National Institute of Radiological Sciences Japan Irradiation was performed either at room temperature liquid phase or at 77 K solid phase The products were characterized by gel filtration chromatography GFC FT-IR pyrolysis PY -GC MS etc Amino acids were analyzed by HPLC and GC MS after acid hydrolysis or the products Amino acids such as glycine and alanine were identified in the products in both the cases of liquid phase and solid phase irradiation Energy yields G-values of glycine were 0 014 liquid phase and 0 007 solid phase respectively Average molecular weights of the products were estimated as to 2300 in both the case Aromatic hydrocarbons N-containing heterocyclic
High Energy, Single-Mode, All-Solid-State and Tunable UV Laser Transmitter
NASA Technical Reports Server (NTRS)
Prasad, Narasimha S.; Singh, Upendra N.; Hovis, FLoyd
2007-01-01
A high energy, single mode, all solid-state Nd:YAG laser primarily for pumping an UV converter is developed. Greater than 1 J/pulse at 50 HZ PRF and pulse widths around 22 ns have been demonstrated. Higher energy, greater efficiency may be possible. Refinements are known and practical to implement. Technology Demonstration of a highly efficient, high-pulse-energy, single mode UV wavelength generation using flash lamp pumped laser has been achieved. Greater than 90% pump depletion is observed. 190 mJ extra-cavity SFG; IR to UV efficiency > 21% (> 27% for 1 mJ seed). 160 mJ intra-cavity SFG; IR to UV efficiency up to 24% Fluence < 1 J/sq cm for most beams. The pump beam quality of the Nd:YAG pump laser is being refined to match or exceed the above UV converter results. Currently the Nd:YAG pump laser development is a technology demonstration. System can be engineered for compact packaging.
All-Solid-State UV Transmitter Development for Ozone Sensing Applications
NASA Technical Reports Server (NTRS)
Prasad, Narasimha S.; Singh, Upendra N.; Armstrong, Darrell Jr.
2009-01-01
In this paper, recent progress made in the development of an all-solid-state UV transmitter suitable for ozone sensing applications from space based platforms is discussed. A nonlinear optics based UV setup based on Rotated Image Singly Resonant Twisted Rectangle (RISTRA) optical parametric oscillator (OPO) module was effectively coupled to a diode pumped, single longitudinal mode, conductively cooled, short-pulsed, high-energy Nd:YAG laser operating at 1064 nm with 50 Hz PRF. An estimated 10 mJ/pulse with 10% conversion efficiency at 320 nm has been demonstrated limited only by the pump pulse spatial profile. The current arrangement has the potential for obtaining greater than 200 mJ/pulse. Previously, using a flash-lamp pumped Nd:YAG laser with round, top-hat profile, up to 24% IR-UV conversion efficiency was achieved with the same UV module. Efforts are underway to increase the IR-UV conversion efficiency of the all solid-state setup by modifying the pump laser spatial profile along with incorporating improved OPO crystals.
Meng, X; Ma, Q; Bai, H; Wang, Z; Han, C; Wang, C
2017-08-01
A comprehensive methodology for the simultaneous determination of 15 multiclass organic UV filters in sunscreen cosmetics was developed using high-performance liquid chromatography coupled with electrospray ionization tandem mass spectrometry (HPLC-ESI-MS/MS). Sunscreen cosmetics of various matrices, such as toning lotion, emulsion, cream and lipstick, were analysed. Ultrasound-assisted extraction (UAE) was utilized as the extraction technique for sample preparation. The 15 UV filters were chromatographically separated by two groups of mobile phase system on an XBridge C 18 analytical column (150 × 2.1 mm I.D., 3.5 μm particle size) and quantified using HPLC-ESI-MS/MS. The quantitation was performed using the external calibration method. The established method was validated in terms of linearity, sensitivity, specificity, accuracy, stability, intraday and interday precisions, recovery and matrix effect. The method was also applied for the determination of UV filters in commercial sunscreen cosmetics. The experimental results demonstrated that the developed method was accurate, rapid and sensitive and can be used for the analytical control of sunscreen cosmetics. © 2016 Society of Cosmetic Scientists and the Société Française de Cosmétologie.
Bittencourt, J C; Elias, C F
1998-09-14
The projection pathways of neurons containing melanin-concentrating hormone (MCH) and neuropeptide EI (NEI), two peptides colocalized in the lateral hypothalamic area (LHA) of the rat, were mapped using the retrogradely transported fluorescent dyes, true blue (TB) and diamidino yellow (DY). TB and DY were injected into the medial septum/diagonal band complex (MS/DBC) and the thoracic level of the spinal cord (SpCd), respectively. Brains from rats receiving only one or both tracer injections were immunohistochemically stained for MCH in the spinal cord and NEI in the forebrain. In the MS/DBC, NEI-immunoreactive (-ir) fibers are concentrated in the MS and in the vertical and horizontal limbs of the DBC. In the SpCd, MCH-ir fibers are concentrated primarily in lamina X. Of the diencephalic NEI-ir neurons, 37.15% project to the MS/DBC and reside in the rostromedial zona incerta (ZIm), in the LHAt and LHAp, and in the perifornical region. Of the diencephalic MCH-ir neurons, 20.2% project to the SpCd and reside in the LHAt and LHAp. In addition, 2. 2% of the MCH-ir cells and 8.7% of the NEI-ir cells in the hypothalamus were labeled with both retrograde tracers and thus project to both the MS/DBC and SpCd. These dual projection neurons are located mainly in the LHAt and LHAp. Anterograde injections of the tracer Phaseolus vulgaris leucoagglutinin into the LHAt and ZIm corroborated our findings in the retrograde studies. Potential autonomic and behavioral roles of the NEI and MCH systems in the MS/DBC and the SpCd are discussed. Copyright 1998 Elsevier Science B. V.
NASA Technical Reports Server (NTRS)
Materese, Christopher K.; Cruikshank, Dale P.; Sanford, Scott A.; Imanaka, Hiroshi
2014-01-01
Much of Pluto's surface consists of N2 ice with smaller amounts of CH4 and CO ices. Despite the low temperature (approximately 45K), chemistry can be driven in the surface ices by radiation processing such as cosmic ray bombardment. When cosmic rays strike the surface, much of their energy is dispersed in the form of secondary electrons, which in turn drive much of the resulting chemical reactions. Laboratory experiments designed to simulate the conditions on these icy bodies may provide insight into this chemistry. Significant progress has been made in the laboratory toward understanding the smaller, simple compounds produced in the solid phase by radiation processing of (N2, CH4, CO) ices (Bohn et al. 1994; Moore & Hudson 2003; Hodyss et al. 2011; Kim and Kaiser 2012). Recently Materese et al. (2014) used a variety of techniques to better characterize the refractory materials produced from the UV photo-irradiation of N2:CH4:CO ices. However, because Pluto's atmosphere is optically thick to Lyman-alpha UV radiation it is important to re-examine the results using an alternate radiation source. Our latest work has consisted of the analysis of refractory materials produced from the electron bombardment of low temperature N2(-), CH4(-), and CO(-)containing ices (100:1:1). The ice mixture was chosen to be analogous to the known surface ices on Pluto and the radiation source was chosen to mimic the secondary electrons produced by cosmic rays bombardment. The residues were studied using multiple chemical techniques including, infrared (IR) spectroscopy, X-ray absorption near-edge structure (XANES) spectroscopy, and gas chromatography coupled with mass spectrometry (GC-MS). The organic residues produced in these experiments can be seen as an analog for the refractory component of the surface of Pluto, and are compared with the residues previously obtained from UV photo-irradiation. UV and near- IR spectroscopy of the surfaces of Pluto and Charon during the encounter with NASA's New Horizons spacecraft in 2015, will give the first close-up measurements of ices and their photoproducts. Laboratory measurements and experiments will provide a better context for the data returned by the spacecraft.
Twilight zone sponges from Guam yield theonellin isocyanate and psammaplysins I and J.
Wright, Anthony D; Schupp, Peter J; Schrör, Jan-Philipp; Engemann, Anna; Rohde, Sven; Kelman, Dovi; de Voogd, Nicole; Carroll, Anthony; Motti, Cherie A
2012-03-23
From the organic extracts of two Guam sponges, Rhaphoxya sp. and Suberea sp., determined to have cytotoxic and chemopreventive activities, three new compounds, theonellin isocyanate (1) and psammaplysins I and J (5, 6), and six previously reported compounds (2-4, 7-9) were isolated and characterized spectroscopically ((1)H and (13)C NMR, MS, IR, UV, [α](D)). The two new metabolites (5 and 6) isolated from the Suberea sp. sponge are rare examples of compounds containing a bromotyramine moiety rather than the more usual dibromo analogue. For the compounds isolated from the Rhaphoxya sp., this is the first report of the known compounds 2-4 being found in a single sponge. For previously reported compounds 2-4 complete unambiguous (1)H and (13)C NMR data are provided.
Wang, Xiao-Bing; Yang, Chang-Shui; Luo, Jian-Guang; Zhang, Chao; Luo, Jun; Yang, Ming-Hua; Kong, Ling-Yi
2017-06-01
Six novel calyxins, named calyxin T-W, ent-calyxin T and ent-calyxin U were isolated from the seeds of Alpinia katsumadai Hayata. Their relative configurations were elucidated by means of detailed UV, IR, NMR and MS spectroscopic data. Their absolute configurations were assigned by collaborative studies on single crystal X-ray diffraction analysis, Mosher's method, electronic circular dichroism (ECD), optical rotation and theoretical calculations. These compounds are Friedel-Cranft alkylation adducts composed of coexisted diarylheptanoids and flavanone from the seeds of Alpinia katsumadai. The antiproliferative activity of the six compounds against NCI-H460, HeLa, SMMC-7721 and HCT-116 cell lines was also reported, and most of them showed moderate to strong activities. Copyright © 2017. Published by Elsevier B.V.
Ginkgolides and bilobalide: their physical, chromatographic and spectroscopic properties.
van Beek, Teris A
2005-09-01
Ginkgolides A, B, C, J, K, L and M and bilobalide are rare terpene trilactones that have been isolated from leaves and root bark of the Chinese tree Ginkgo biloba. The structures of the highly oxidized ginkgolides were independently elucidated in the 1960s by the groups of Nakanishi and Sakabe. Later these compounds were found to be potent and selective antagonists of platelet activating factor, which fact triggered much new research. During the past 40 years, much physical, chromatographic and spectroscopic data have been published on these compounds in various, sometimes inaccessible, sources. The published melting points, solubility in different solvents, ionization constants, chromatographic behaviour, specific optical rotations, UV, IR, MS and NMR data, and X-ray studies are summarized and, where necessary, discussed. The literature until April 2005 has been reviewed.
Sesquiterpenoids and lignans from the roots of Valeriana officinalis L.
Wang, Peng-Cheng; Ran, Xin-Hui; Chen, Rui; Luo, Huai-Rong; Ma, Qing-Yun; Liu, Yu-Qing; Hu, Jiang-Miao; Huang, Sheng-Zhuo; Jiang, He-Zhong; Chen, Zhong-Quan; Zhou, Jun; Zhao, You-Xing
2011-10-01
Two new guaiane-type sesquiterpenoids, valerol A (1) and kessyl 3-acetate (2), together with nine known compounds, valeracetate (3), anismol A (4), orientalol C (5), spatulenol (6), 4α,10α-epoxyaromadendrane (7), (+)-8-hydroxypinoresinol (8), pinorespiol (9), pinoresinol 4-O-β-D-glucopyranoside (10), and 8-hydroxypinoresinol 4'-O-β-D-glucopyranoside (11) were isolated from the roots of Valeriana officinalis. The structures and relative configurations of 1 and 2 were elucidated on the basis of spectroscopic methods (1D- and 2D-NMR, MS, UV, and IR). These compounds were evaluated for inhibitory activity on acetylcholinesterase (AChE) and enhancing activity on nerve growth factor (NGF)-mediated neurite outgrowth in PC12 cells. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.
Entanglement of heavy quark impurities and generalized gravitational entropy
NASA Astrophysics Data System (ADS)
Kumar, S. Prem; Silvani, Dorian
2018-01-01
We calculate the contribution from non-conformal heavy quark sources to the entanglement entropy (EE) of a spherical region in N=4 SUSY Yang-Mills theory. We apply the generalized gravitational entropy method to non-conformal probe D-brane embeddings in AdS5×S5, dual to pointlike impurities exhibiting flows between quarks in large-rank tensor representations and the fundamental representation. For the D5-brane embedding which describes the screening of fundamental quarks in the UV to the antisymmetric tensor representation in the IR, the EE excess decreases non-monotonically towards its IR asymptotic value, tracking the qualitative behaviour of the one-point function of static fields sourced by the impurity. We also examine two classes of D3-brane embeddings, one which connects a symmetric representation source in the UV to fundamental quarks in the IR, and a second category which yields the symmetric representation source on the Coulomb branch. The EE excess for the former increases from the UV to the IR, whilst decreasing and becoming negative for the latter. In all cases, the probe free energy on hyperbolic space with β = 2 π increases monotonically towards the IR, supporting its interpretation as a relative entropy. We identify universal corrections, depending logarithmically on the VEV, for the symmetric representation on the Coulomb branch.
Evaluating UV-C LED disinfection performance and ...
This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research included an evaluation of genomic damage. Inactivation by the LEDs was compared with the efficacy of conventional UV sources, the low-pressure (LP) and medium-pressure (MP) mercury vapor lamps. The work also calculated the electrical energy per order of reduction of the microorganisms by the five UV sources.For E. coli, all five UV sources yielded similar inactivation rates. For MS2 coliphage, the 260 nm LED was most effective. For HAdV2 and B. pumilus, the MP UV lamp was significantly more effective than the LP UV and UVC LED sources. When considering electrical energy per order of reduction, the LP UV lamp was the most efficient for E. coli and MS2, and the MPUV and LPUV were equally efficient for HAdV2 and B. pumilus spores. Among the UVC LEDs, the 280 nm LED unit required the least energy per log reduction of E. coli and HAdV2. The 280 nm and 260|280 nm LED units were equally efficient per log reduction of B. pumilus spores, and the 260 nm LED unit required the lowest energy per order of reduction of MS2 coliphage. The combination of the 260 nm and 280 nm UV LED wavelengths was also evaluated for potential synergistic effects. No dual-wavelength synergy was detected for inactivation of
Świsłocka, Renata
2013-01-01
The effect of some metals on the electronic system of benzoic and nicotinic acids has recently been investigated by IR, Raman and UV spectroscopy [1-3]. Benzoic and nicotinic acids are regarded model systems representing a wide group of aromatic ligands which are incorporated into enzymes. In this work the FT-IR (in solid state and in solution), FT-Raman, UV absorption and (1)H and (13)C NMR spectra of caffeic acid (3,4-dihydroxycinnamic acid) and its salts with lithium, sodium, potassium, rubidium and caesium were registered, assigned and analyzed. The effect of alkali metals on the electronic system of ligands was discussed. Studies of differences in the number and position of bands from the IR, Raman, UV absorption spectra and chemical shifts from NMR spectra allowed to conclude on the distribution of electronic charge in the molecules, the delocalization energy of π electrons and the reactivity of ligands in metal complexes. Optimized geometrical structures of studied compounds were calculated by B3LYP method using 6-311++G** basis set. Bond lengths, angles and dipole moments for the optimized structures of caffeic acid and lithium, sodium, potassium caffeinates were also calculated. The theoretical wavenumbers and intensities of IR spectra were obtained. The calculated parameters were compared to the experimental characteristics of investigated compounds. Microbial activity of studied compounds was tested against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus and Proteus vulgaris. Copyright © 2012 Elsevier B.V. All rights reserved.
Moore, M H; Hudson, R L; Gerakines, P A
2001-03-15
Infrared (IR) studies of laboratory ices can provide information on the evolution of cosmic-type ices as a function of different simulated space environments involving thermal, ultraviolet (UV), or ion processing. Laboratory radiation experiments can lead to the formation of complex organic molecules. However, because of our lack of knowledge about UV photon and ion fluxes, and exposure lifetimes, it is not certain how well our simulations represent space conditions. Appropriate laboratory experiments are also limited by the absence of knowledge about the composition, density, and temperature of ices in different regions of space. Our current understanding of expected doses due to UV photons and cosmic rays is summarized here, along with an inventory of condensed-phase molecules identified on outer solar system surfaces, comets and interstellar grains. Far-IR spectra of thermally cycled H2O are discussed since these results reflect the dramatic difference between the amorphous and crystalline phases of H2O ice, the most dominant condensed-phase molecule in cosmic ices. A comparison of mid-IR spectra of products in proton-irradiated and UV-photolyzed ices shows that few differences are observed for these two forms of processing for the simple binary mixtures studied to date. IR identification of radiation products and experiments to determine production rates of new molecules in ices during processing are discussed. A new technique for measuring intrinsic IR band strengths of several unstable molecules is presented. An example of our laboratory results applied to Europa observations is included.
NASA Astrophysics Data System (ADS)
Geetha, Thangiah; Langlais, Paul; Luo, Moulun; Mapes, Rebekka; Lefort, Natalie; Chen, Shu-Chuan; Mandarino, Lawrence J.; Yi, Zhengping
2011-03-01
Protein-protein interactions are key to most cellular processes. Tandem mass spectrometry (MS/MS)-based proteomics combined with co-immunoprecipitation (CO-IP) has emerged as a powerful approach for studying protein complexes. However, a majority of systematic proteomics studies on protein-protein interactions involve the use of protein overexpression and/or epitope-tagged bait proteins, which might affect binding stoichiometry and lead to higher false positives. Here, we report an application of a straightforward, label-free CO-IP-MS/MS method, without the use of protein overexpression or protein tags, to the investigation of changes in the abundance of endogenous proteins associated with a bait protein, which is in this case insulin receptor substrate-1 (IRS-1), under basal and insulin stimulated conditions. IRS-1 plays a central role in the insulin signaling cascade. Defects in the protein-protein interactions involving IRS-1 may lead to the development of insulin resistance and type 2 diabetes. HPLC-ESI-MS/MS analyses identified eleven novel endogenous insulin-stimulated IRS-1 interaction partners in L6 myotubes reproducibly, including proteins play an important role in protein dephosphorylation [protein phosphatase 1 regulatory subunit 12A, (PPP1R12A)], muscle contraction and actin cytoskeleton rearrangement, endoplasmic reticulum stress, and protein folding, as well as protein synthesis. This novel application of label-free CO-IP-MS/MS quantification to assess endogenous interaction partners of a specific protein will prove useful for understanding how various cell stimuli regulate insulin signal transduction.
Gilmartin, Gregory; Gingrich, Diane
2018-04-15
The determination and speciation of arsenic in natural resources such as drinking water and agricultural soils has been a growing concern in recent years due to its many toxicological effects [1-3]. To speciate and quantitate concentrations of <1 ppm of arsenic, typically an ion chromatograph (IC) interfaced to an inductively coupled plasma mass spectrometer (ICP-MS) is employed [4-9]. This methodology may be very robust and sensitive, but it is expensive and not as ubiquitous as high performance liquid chromatography (HPLC) with ultraviolet (UV) absorbance detection or electrospray ionization mass spectrometry (ESI-MS). Anion exchange chromatography is a well-documented means of speciating arsenite (As(III), As 2 O 3 ) and arsenate (As(V), AsO 4 ) using UV [10], conductivity [11], or ESI-MS detection [12,13]. This paper demonstrates the utilization of common liquid chromatographic instrumentation to speciate and determines inorganic Arsenic compounds using UV or MS via selected ion recording (SIR) or multiple reaction monitoring (MRM) detection. This paper describes the analysis of arsenite and arsenate samples prepared using both deionized and ground water. The limit of quantitation for the techniques described in this paper for samples spiked in ground water were 454 ppb (As(III)) and 562 ppb (As(V)) for UV detection, 45.4 ppb (As(III)) and 56.2 ppb (As(V)) for SIR detection, and 4.54 ppb (As(III)) and 5.62 ppb (As(V)) for MRM detection. Copyright © 2018 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Yao, Sen; Li, Tao; Li, JieQing; Liu, HongGao; Wang, YuanZhong
2018-06-01
Boletus griseus and Boletus edulis are two well-known wild-grown edible mushrooms which have high nutrition, delicious flavor and high economic value distributing in Yunnan Province. In this study, a rapid method using Fourier transform infrared (FT-IR) and ultraviolet (UV) spectroscopies coupled with data fusion was established for the discrimination of Boletus mushrooms from seven different geographical origins with pattern recognition method. Initially, the spectra of 332 mushroom samples obtained from the two spectroscopic techniques were analyzed individually and then the classification performance based on data fusion strategy was investigated. Meanwhile, the latent variables (LVs) of FT-IR and UV spectra were extracted by partial least square discriminant analysis (PLS-DA) and two datasets were concatenated into a new matrix for data fusion. Then, the fusion matrix was further analyzed by support vector machine (SVM). Compared with single spectroscopic technique, data fusion strategy can improve the classification performance effectively. In particular, the accuracy of correct classification of SVM model in training and test sets were 99.10% and 100.00%, respectively. The results demonstrated that data fusion of FT-IR and UV spectra can provide higher synergic effect for the discrimination of different geographical origins of Boletus mushrooms, which may be benefit for further authentication and quality assessment of edible mushrooms.
Yao, Sen; Li, Tao; Li, JieQing; Liu, HongGao; Wang, YuanZhong
2018-06-05
Boletus griseus and Boletus edulis are two well-known wild-grown edible mushrooms which have high nutrition, delicious flavor and high economic value distributing in Yunnan Province. In this study, a rapid method using Fourier transform infrared (FT-IR) and ultraviolet (UV) spectroscopies coupled with data fusion was established for the discrimination of Boletus mushrooms from seven different geographical origins with pattern recognition method. Initially, the spectra of 332 mushroom samples obtained from the two spectroscopic techniques were analyzed individually and then the classification performance based on data fusion strategy was investigated. Meanwhile, the latent variables (LVs) of FT-IR and UV spectra were extracted by partial least square discriminant analysis (PLS-DA) and two datasets were concatenated into a new matrix for data fusion. Then, the fusion matrix was further analyzed by support vector machine (SVM). Compared with single spectroscopic technique, data fusion strategy can improve the classification performance effectively. In particular, the accuracy of correct classification of SVM model in training and test sets were 99.10% and 100.00%, respectively. The results demonstrated that data fusion of FT-IR and UV spectra can provide higher synergic effect for the discrimination of different geographical origins of Boletus mushrooms, which may be benefit for further authentication and quality assessment of edible mushrooms. Copyright © 2018 Elsevier B.V. All rights reserved.
Ding, Xuelu; Gerbig, Stefanie; Spengler, Bernhard; Schulz, Sabine
2018-02-01
Organic UV filters in personal care products (PCPs) have been persistently reported as a potential threat to human health. In order to guarantee consumers ' safety, the dose of these compounds in PCPs needs to be monitored. Here, a methodology based on reactive low temperature plasma ionization (LTP) mass spectrometry (MS) has been developed for the determination of common organic UV filters in PCPs including benzophenone-3, ethylhexyl dimethyl p-aminobenzoic acid, ethylhexyl methoxycinnamate, 4-methylbenzylidene camphor, octocrylene, and ethylhexyl salicylate. The experiments were carried out in transmission geometry where the LTP ion source, samples loaded on a stainless steel mesh, and the MS inlet were aligned coaxially. Four chemicals, ammonia, ammonium formate, aniline, and methylamine were considered as reactive additives allowing reactions with the UV filters through different mechanisms. Methylamine-induced reactive LTP-MS showed the most prominent improvement on the detection of UV filter compounds. Compared to direct LTP-MS, the developed method improved the detection limits of UV filters more than 10 fold. Moreover, the method enabled fast semi-quantitative screening of UV filters in authentic PCPs. Concentrations of active ingredients in eight authentic PCPs as determined with reactive LTP-MS were found comparable to values offered by the cosmetic companies and corresponding HPLC data. The methodology provides high throughput analysis (70s per sample) and sensitive identification of organic UV filters. Lowest detectable concentrations ranged from 0.13µg/g for 4-methylbenzylidene camphor to 7.67µg/g for octocrylene in spiked cream. In addition, it shows the potential to be used as a screening tool for legal authentications of these chemicals in the future due to its semi-quantitative determination of UV filters in PCPs without tedious sample preparation and time-consuming chromatographic separation. Copyright © 2017 Elsevier B.V. All rights reserved.
Green grasses as light harvesters in dye sensitized solar cells.
Shanmugam, Vinoth; Manoharan, Subbaiah; Sharafali, A; Anandan, Sambandam; Murugan, Ramaswamy
2015-01-25
Chlorophylls, the major pigments presented in plants are responsible for the process of photosynthesis. The working principle of dye sensitized solar cell (DSSC) is analogous to natural photosynthesis in light-harvesting and charge separation. In a similar way, natural dyes extracted from three types of grasses viz. Hierochloe Odorata (HO), Torulinium Odoratum (TO) and Dactyloctenium Aegyptium (DA) were used as light harvesters in dye sensitized solar cells (DSSCs). The UV-Vis absorption spectroscopy, Fourier transform infrared (FT-IR), and liquid chromatography-mass spectrometry (LC-MS) were used to characterize the dyes. The electron transport mechanism and internal resistance of the DSSCs were investigated by the electrochemical impedance spectroscopy (EIS). The performance of the cells fabricated with the grass extract shows comparable efficiencies with the reported natural dyes. Among the three types of grasses, the DSSC fabricated with the dye extracted from Hierochloe Odorata (HO) exhibited the maximum efficiency. LC-MS investigations indicated that the dominant pigment present in HO dye was pheophytin a (Pheo a). Copyright © 2014 Elsevier B.V. All rights reserved.
Chen, Xinxia; Zhang, Liyan; Wan, Jinzhi; Liang, Bin; Xie, Yu
2010-08-01
To isolate and purify gallic acid and brevifolincarboxylic acid simultaneously by high-speed counter-current chromatography (HSCCC) from a crude extract of Polygonum capitatum. The biphasic solvent system composed of ethyl acetate-n-butanol-0.44% acetic acid (3:1:5) was used at a flow rate of 2.0 mL x min(-1), while the aqueous phase was selected as the mobile phase and the apparatus was rotated at 860 r x min(-1). The effluent was detected at 272 nm. 51.5 mg of gallic acid and 5.9 mg of brevifolincarboxylic acid were separated from 1.07 g of the crude extract with the purities of 99.7% and 97.5%, respectively, while brevifolincarboxylic acid was obtained firstly from the genus Polygonum. The structures of the compounds were identified by ultraviolet spectrometry (UV), infra-red spectrometry (IR), liquid chromatography/mass spectrometry (LC/MS), time-of-flight mass spectrometry( TOF-MS), 1H-nuclear magnetic resonance (NMR) and 13C-NMR. This method is feasible and rapid for isolation and purification of gallice acid and brevifolincarboxylil acid.
Autonomous long-range open area fire detection and reporting
NASA Astrophysics Data System (ADS)
Engelhaupt, Darell E.; Reardon, Patrick J.; Blackwell, Lisa; Warden, Lance; Ramsey, Brian D.
2005-03-01
Approximately 5 billion dollars in US revenue was lost in 2003 due to open area fires. In addition many lives are lost annually. Early detection of open area fires is typically performed by manned observatories, random reporting and aerial surveillance. Optical IR flame detectors have been developed previously. They typically have experienced high false alarms and low flame detection sensitivity due to interference from solar and other causes. Recently a combination of IR detectors has been used in a two or three color mode to reduce false alarms from solar, or background sources. A combination of ultra-violet C (UVC) and near infra-red (NIR) detectors has also been developed recently for flame discrimination. Relatively solar-blind basic detectors are now available but typically detect at only a few tens of meters at ~ 1 square meter fuel flame. We quantify the range and solar issues for IR and visible detectors and qualitatively define UV sensor requirements in terms of the mode of operation, collection area issues and flame signal output by combustion photochemistry. We describe innovative flame signal collection optics for multiple wavelengths using UV and IR as low false alarm detection of open area fires at long range (8-10 km/m2) in daylight (or darkness). A circular array detector and UV-IR reflective and refractive devices including cylindrical or toroidal lens elements for the IR are described. The dispersion in a refractive cylindrical IR lens characterizes the fire and allows a stationary line or circle generator to locate the direction and different flame IR "colors" from a wide FOV. The line generator will produce spots along the line corresponding to the fire which can be discriminated with a linear detector. We demonstrate prototype autonomous sensors with RF digital reporting from various sites.
Simultaneous determination of some artificial sweeteners in ternary formulations by FT-IR and EI-MS
NASA Astrophysics Data System (ADS)
Tosa, Nicoleta; Moldovan, Zaharie; Bratu, Ioan
2012-02-01
Artificial sweeteners are widely used in food, beverage and pharmaceutical industries all over the world. In this study some non-nutritive sweeteners such as aspartame, acesulfame-K, sodium cyclamate and sodium saccharin were simultaneously determined in ternary mixtures using FT-IR and EI-MS measurements. FT-IR method is based on direct measurements of the peak height values and area centered on 1736 cm-1, 836 cm-1, 2854 cm-1 and 1050 cm-1 for aspartame, acesulfame-K, sodium cyclamate and sodium saccharin, respectively. Mass spectrometry determinations show the characteristic peaks at m/z 91 and 262 for aspartame,m/z 43 and 163 acesulfame-K,m/z 83 and 97 for sodium cyclamate andm/z 104 and 183 for sodium saccharin. The results obtained by EI-MS in different formulations are in agreement with the FT-IR ones and provide also essential data concerning the purity grade of the components. It is concluded that FT-IR and EI-MS procedures developed in this work represent a fast, sensitive and low cost alternative in the quality control of such sweeteners in different ternary formulations.
ERIC Educational Resources Information Center
Stynes, Helen Cleary; Layo, Araceli; Smith, Richard W.
2004-01-01
The protein species of apomyoglobin (apoMb) and heme are freed and segregated from the aqueous protein solution of metmyoglobin by liquid chromatography, and are distinguished by UV-Vis absorption or electrospray ionization mass spectrometry (ESI-MS). This is an ingenious and effective approach to characterize apomyoglobin and heme, while students…
Nascimento, Henrique; Catarino, Cristina; Mendonça, Denisa; Oliveira, Pedro; Alves, Ana Inês; Medeiros, Ana Filipa; Pereira, Petronila Rocha; Rêgo, Carla; Mansilha, Helena Ferreira; Aires, Luísa; Mota, Jorge; Quintanilha, Alexandre; Santos-Silva, Alice; Belo, Luís
2015-01-01
Growth-curves are an important tool for evaluating the anthropometric development in pediatrics. The different growth-curves available are based in different populations, what leads to different cut-offs. Pediatric obesity tracks into adulthood and is associated with increased cardiovascular risk. The accurate assessment of a child nutritional status using growth-curves can indicate individuals that are either obese or in risk of becoming obese, allowing an early intervention. Moreover, the association between the data obtained from growth-curves with specific metabolic risk factors further highlights the importance of these charts. This study aimed to evaluate the associations between body mass index z-score (BMIzsc), determined using the growth-curves from the Centre for Disease Control and Prevention (CDC) and from the World Health Organization (WHO), with cardiovascular risk factors, represented here by metabolic syndrome (MS) and insulin resistance (IR) related parameters. The study involved 246 obese adolescents (10-18 years, 122 females). MS was defined according to the International Diabetes Federation. IR was considered for HOMA-IR greater than 2.5. No difference between both BMIzsc in identifying MS was noticeable by a ROC analysis. For both indexes the area-under-the-curve increased for older groups, particularly for males. CDC-BMIzsc was the best predictor of MS by logistic regression when all population was considered, however MS was better predicted by WHO-BMIzsc for females and by CDC-BMIzsc for males. Younger girls and older boys were in increased risk for MS. Similar results were obtained for IR. A significant difference between the two BMIzsc regarding their association with MS and IR was not clear, being these associations weaker in younger individuals.
Corneal tissue interactions of a new 345 nm ultraviolet femtosecond laser.
Hammer, Christian M; Petsch, Corinna; Klenke, Jörg; Skerl, Katrin; Paulsen, Friedrich; Kruse, Friedrich E; Seiler, Theo; Menzel-Severing, Johannes
2015-06-01
To assess the suitability of a new 345 nm ultraviolet (UV) femtosecond laser for refractive surgery. Department of Ophthalmology, University of Erlangen-Nürnberg, Erlangen, Germany. Experimental study. Twenty-five porcine corneas were used for stromal flap or lamellar bed creation (stromal depth, 150 μm) and 15 rabbit corneas for lamellar bed creation near the endothelium. Ultraviolet femtosecond laser cutting-line morphology, gas formation, and keratocyte death rate were evaluated using light and electron microscopy and compared with a standard infrared (IR) femtosecond laser. Endothelial cell survival was examined after application of a laser cut near the endothelium. Flaps created by the UV laser were lifted easily. Gas formation was reduced 4.2-fold compared with the IR laser (P = .001). The keratocyte death rate near the interface was almost doubled; however, the death zone was confined to a region within 38 μm ± 10 (SD) along the cutting line. Histologically and ultrastructurally, a distinct and continuous cutting line was not found after UV femtosecond laser application if flap lifting was omitted and standard energy parameters were used. Instead, a regular pattern of vertical striations, presumably representing self-focusing induced regions of optical tissue breakdown, were identified. Lamellar bed creation with standard energy parameters 50 μm from the endothelium rendered the endothelial cells intact and viable. The new 345 nm femtosecond laser is a candidate for pending in vivo trials and future high-precision flap creation, intrastromal lenticule extraction, and ultrathin Descemet-stripping endothelial keratoplasty. Mr. Klenke and Ms. Skerl were paid employees of Wavelight GmbH when the study was performed. Dr. Seiler is a scientific consultant to Wavelight GmbH. No other author has a financial or proprietary interest in any material or method mentioned. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.
NASA Astrophysics Data System (ADS)
Mangaiyarkarasi, K.; Ravichandran, A. T.; Anitha, K.; Manivel, A.
2018-03-01
The titled compound, L-Phenylalaninium methanesulfonate (LPA-MS) was synthesized and grown into single crystals by slow solvent evaporation solution growth technique in aqueous solution containing equimolar concentrations of L-phenylalanine and methanesulfonic acid at room temperature. The grown crystals were subjected to single crystal X-ray diffraction studies. It crystallizes in the monoclinic crystal structure with P21 space group and the unit cell parameters are a = 5.312 (10) Å, b = 8.883 (2) Å and c = 25.830 (7) Å. The functional groups of the LPA-MS crystal were confirmed with FT-IR and FT-Raman analysis. The carbon-hydrogen skeleton was confirmed with 1H NMR and 13C NMR analysis. TG-DTG and DSC studies were carried out to determine the thermal stability of the crystals. The optical transparency ranges were studied through UV-vis-spectroscopy and the crystal was found to be transparent in the visible region. The second Harmonic generation (SHG) efficiency of the grown LPA-MS crystal was measured by the Kurtz-Perry powder technique. The dipolar nature of the L-phenylalaninium methanesulfonate and the presence of the intermolecular hydrogen bonding between the molecules are the vital factors responsible for the existence of SHG activity in the crystal.
NASA Astrophysics Data System (ADS)
Sennappan, M.; Murali Krishna, P.; Hosamani, Amar A.; Hari Krishna, R.
2018-07-01
An environmental benign and efficient reaction was carried out via amine exchange and condensation reaction in water and methanol mixture (3:1) and absence of catalyst between 1-[3-(2-hydroxy benzylidene)amine)phenyl]ethanone and benzhydrazide yields methaniminium hydrazone Schiff base in high yield. The prepared ligand was structurally characterized by using single crystal XRD, elemental analysis and spectroscopy (UV-Vis, FT-IR, LC-MS and NMR) techniques. The crystal data indicates the ligand crystallizes in orthorhombic system with Pna21 space group. Further, the ligand was used in synthesis of mononuclear Mn(II), Co(II), Ni(II), Cu(II), Zn(II) and Cd(II) complexes and were characterized by elemental analysis, magnetic moment and spectroscopy (UV-Vis, FT-IR and ESR) studies. The spectral data showed that ligand is coordinated to the metal ion through azomethine nitrogen and methaniminium nitrogen. The DNA binding absorption titrations reveals that, ligand, L and its metal complexes, 1-6 are avid binders to CT- DNA. The apparent binding constant values of compounds are in the order of 106 M-1. The nuclease activity of ligand, L and its metal complexes, 1-6 were investigated by gel electrophoresis method using pUC18 DNA. The photoluminescent properties of the methaniminium hydrazone ligand, L and its various metal complexes, 1-6 were investigated. The emission spectra of both ligand (L) and metal complexes (1-6) exhibits emission in the range of blue to red.
Farag, Mohamed A; Huhman, David V; Lei, Zhentian; Sumner, Lloyd W
2007-02-01
An integrated approach utilizing HPLC-UV-ESI-MS and GC-MS was used for the large-scale and systematic identification of polyphenols in Medicago truncatula root and cell culture. Under optimized conditions, we were able to simultaneously quantify and identify 35 polyphenols including 26 isoflavones, 3 flavones, 2 flavanones, 2 aurones and a chalcone. All identifications were based upon UV spectra, mass spectral characteristics of protonated molecules, tandem mass spectral data, mass measurements obtained using a quadrupole time-of-flight mass spectrometer (QtofMS), and confirmed through the co-characterization of authentic compounds. In specific instances where the stereochemistry of sugar conjugates was uncertain, subsequent enzymatic hydrolysis of the conjugate followed by GC-MS was used to assign the sugar stereochemical configuration. Comparative metabolic profiling of Medicago truncatula root and cell cultures was then performed and revealed significant differences in the isoflavonoid composition of these two tissues.
Nanostructure based EO/IR sensor development for homeland security applications
NASA Astrophysics Data System (ADS)
Sood, Ashok K.; Welser, Roger E.; Sood, Adam W.; Puri, Yash R.; Manzur, Tariq; Dhar, Nibir K.; Polla, Dennis L.; Wang, Zhong L.; Wijewarnasuriya, Priyalal S.; Anwar, A. F. M.
2011-06-01
Next Generation EO/IR focal plane arrays using nanostructure materials are being developed for a variety of Defense and Homeland Security Sensor Applications. Several different nanomaterials are being evaluated for these applications. These include ZnO nanowires, GaN Nanowires and II-VI nanowires, which have demonstrated large signal to noise ratio as a wide band gap nanostructure material in the UV band. Similarly, the work is under way using Carbon Nanotubes (CNT) for a high speed detector and focal plane array as two-dimensional array as bolometer for IR bands of interest, which can be implemented for the sensors for homeland security applications. In this paper, we will discuss the sensor design and model predicting performance of an EO/IR focal plane array and Sensor that can cover the UV to IR bands of interest. The model can provide a robust means for comparing performance of the EO/IR FPA's and Sensors that can operate in the UV, Visible-NIR (0.4- 1.8μ), SWIR (2.0-2.5μ), MWIR (3-5μ), and LWIR bands (8-14μ). This model can be used as a tool for predicting performance of nanostructure arrays under development. We will also discuss our results on growth and characterization of ZnO nanowires and CNT's for the next generation sensor applications. We also present several approaches for integrated energy harvesting using nanostructure based solar cells and Nanogenerators that can be used to supplement the energy required for nanostructure based sensors.
VERY LARGE INTERSTELLAR GRAINS AS EVIDENCED BY THE MID-INFRARED EXTINCTION
DOE Office of Scientific and Technical Information (OSTI.GOV)
Wang, Shu; Jiang, B. W.; Li, Aigen, E-mail: shuwang@mail.bnu.edu.cn, E-mail: bjiang@bnu.edu.cn, E-mail: wanshu@missouri.edu, E-mail: lia@missouri.edu
The sizes of interstellar grains are widely distributed, ranging from a few angstroms to a few micrometers. The ultraviolet (UV) and optical extinction constrains the dust in the size range of a couple hundredths of micrometers to several submicrometers. The near and mid infrared (IR) emission constrains the nanometer-sized grains and angstrom-sized very large molecules. However, the quantity and size distribution of micrometer-sized grains remain unknown because they are gray in the UV/optical extinction and they are too cold and emit too little in the IR to be detected by IRAS, Spitzer, or Herschel. In this work, we employ themore » ∼3–8 μm mid-IR extinction, which is flat in both diffuse and dense regions to constrain the quantity, size, and composition of the μm-sized grain component. We find that, together with nano- and submicron-sized silicate and graphite (as well as polycyclic aromatic hydrocarbons), μm-sized graphite grains with C/H ≈ 137 ppm and a mean size of ∼1.2 μm closely fit the observed interstellar extinction of the Galactic diffuse interstellar medium from the far-UV to the mid-IR, as well as the near-IR to millimeter thermal emission obtained by COBE/DIRBE, COBE/FIRAS, and Planck up to λ ≲ 1000 μm. The μm-sized graphite component accounts for ∼14.6% of the total dust mass and ∼2.5% of the total IR emission.« less
Peixoto, Maria Paula Garofo; Kaiser, Samuel; Verza, Simone Gasparin; de Resende, Pedro Ernesto; Treter, Janine; Pavei, Cabral; Borré, Gustavo Luís; Ortega, George González
2012-01-01
Ilex paraguariensis A. St. Hil. (mate) is known in several South American countries because of the use of its leaves in stimulant herbal beverages. High saponin contents were reported in mate leaves and unripe fruits that possess a dissimilar composition. Two LC-UV methods previously reported for mate saponins assay focused on mate leaves and the quantification of the less polar saponin fraction in mate fruits. To develop and validate a LC-UV method to assay the total content of saponins in unripe mate fruits and characterise the chemical structure of triterpenic saponins by UPLC/Q-TOF-MS. From unripe fruits of mate a crude ethanolic extract was prepared (EX40) and the mate saponin fraction (MSF) purified by solid phase extraction. The LC-UV method was validated using ilexoside II as external standard. UPLC/Q-TOF-MS was adjusted from the LC-UV method to obtain the fragmentation patterns of the main saponins present in unripe fruits. Both LC-UV and UPLC/Q-TOF-MS methods indicate a wide range of Ilex saponins polarity. The ilexoside II and total saponin content of EX40 were 8.20% (w/w) and 47.60% (w/w), respectively. The total saponin content in unripe fruits was 7.28% (w/w). The saponins present in MSF characterised by UPLC/Q-TOF-MS are derived mainly from ursolic/oleanolic, acetyl ursolic or pomolic acid. The validated LC-UV method was shown to be linear, precise, accurate and to cover several saponins previously isolated from Ilex species and could be applied for the quality control of unripe fruit saponins. Copyright © 2011 John Wiley & Sons, Ltd.
The Effects of Space Weathering at UV Wavelengths: S-Class Asteroids
NASA Technical Reports Server (NTRS)
Hendrix, Amanda R.; Vilas, Faith
2006-01-01
We present evidence that space weathering manifests itself at near-UV wavelengths as a bluing of the spectrum, in contrast with the spectral reddening that has been seen at visible-near-IR wavelengths. Furthermore, the effects of space weathering at UV wavelengths tend to appear with less weathering than do the longer wavelength effects, suggesting that the UV wavelength range is a more sensitive indicator of weathering, and thus age. We report results from analysis of existing near-UV (approx.220-350 nm) measurements of S-type asteroids from the International Ultraviolet Explorer and the Hubble Space Telescope and comparisons with laboratory measurements of meteorites to support this hypothesis. Composite spectra of S asteroids are produced by combining UV spacecraft data with ground-based longer wavelength data. At visible-near-IR wavelengths, S-type asteroids are generally spectrally redder (and darker) than ordinary chondrite meteorites, whereas the opposite is generally true at near-UV wavelengths. Similarly, laboratory measurements of lunar samples show that lunar soils (presumably more weathered) are spectrally redder at longer wavelengths, and spectrally bluer at near-UV wavelengths, than less weathered crushed lunar rocks. The UV spectral bluing may be a result of the addition of nanophase iron to the regolith through the weathering process. The UV bluing is most prominent in the 300-400 nm range, where the strong UV absorption edge is degraded with weathering.
Preparation and spectral properties of europium hydrogen squarate microcrystals
NASA Astrophysics Data System (ADS)
Kolev, T.; Danchova, N.; Shandurkov, D.; Gutzov, S.
2018-04-01
A simple scheme for preparation of europium hydrogen squarate octahydrate microcrystals, Eu(HSq)3·8H2O is demonstrated. The microcrystalline powders obtained have a potential application as non-centrosymmetric and UV radiation - protective hybrid optical material. The site-symmetry of the Eu - ion is C2V or lower, obtained from diffuse reflectance spectra. The formation of europium hydrogen squarate is supported by IR - spectroscopy, UV-vis spectroscopy, chemical analysis and X-ray diffraction. A detailed analysis of the UV-vis and IR spectra of the micropowders prepared is presented. The reaction between europium oxide and squaric acid leads to formation of microcrystalline plate-like crystals of europium hydrogen squarate Eu(HSq)3·8H2O, a non-centrosymmetric hybrid optical material with a potential application as UV radiation - protective coatings.
Objective for monitoring the corona discharge
NASA Astrophysics Data System (ADS)
Obrezkov, Andrey; Rodionov, Andrey Yu.; Pisarev, Viktor N.; Chivanov, Alexsey N.; Baranov, Yuri P.; Korotaev, Valery V.
2016-04-01
Remote optoelectronic probing is one of the most actual aspects of overhead electric line maintenances. By installing such systems on a helicopter (for example) it becomes possible to monitor overhead transmission line status and to search damaged parts of the lines. Thermal and UV-cameras are used for more effective diagnostic. UV-systems are fitted with filters, that attenuate visible spectrum, which is an undesired type of signal. Also these systems have a wide view angle for better view and proper diagnostics. For even more effectiveness, it is better to use several spectral channels: like UV and IR. Such spectral selection provides good noise reduction. Experimental results of spectral parameters of the wide view angle multispectral objective for such systems are provided in this report. There is also data on point spread function, UV and IR scattering index data and technical requirements for detectors.
The UV to Near-IR Optical Properties of PAHs: A Semi-Empirical Model
NASA Technical Reports Server (NTRS)
Mattioda, A. L.; Allamandola, L. J.; Hudgins, D. M.
2005-01-01
Interstellar Polycyclic Aromatic Hydrocarbon (PAH) infrared emission features represent an important and unique diagnostic tool of the chemical and physical conditions throughout the universe. However, one challenge facing the widely accepted PAH emission model has been the detection of infrared features in regions of low UV flux. Utilizing recently published laboratory Near Infrared VIR) PAH ion absorption data measured in our laboratory, we build upon previous models for PAH ion absorption in the UV-Vis to extrapolate a new model which incorporates PAH ion absorption in the NIR. This model provides a basis for comparing the relative energy absorption of PAH ions in the UV-Vis and NIR regions for a wide variety of stellar types. This model demonstrates that the radiation from late-type stars can pump the mid-IR PAH features.
UV/IR Filaments for High Resolution Novel Spectroscopic Interrogation of Plumes on Nuclear Materials
2016-06-01
Understanding the physics and properties of high power filaments propagating in air, which include: (a) Femtosecond IR (mJ) filaments (b) Nanosecond UV (J...space and wavelength can resolve this controversy. The results have been published in Journal of Physics B, special issue on filamentation [19]. Only a...Raman scattering? 3. What is the impact of filamentation on the ratio of backward to forward Raman? 4. What is the physical origin/content of the
Analysis of macamides in samples of Maca (Lepidium meyenii) by HPLC-UV-MS/MS.
McCollom, Megan M; Villinski, Jacquelyn R; McPhail, Kerry L; Craker, Lyle E; Gafner, Stefan
2005-01-01
The macamides are a distinct class of secondary metabolites that have so far been found only in Lepidium meyenii Walp. (Maca). Using HPLC-UV-MS/MS, the main macamides have been identified as n-benzylhexadecanamide, n-benzyl-(9Z)-octadecenamide, n-benzyl-(9Z, 12Z)-octadecadienamide, n-benzyl-(9Z, 12Z, 15Z)-octadecatrienamide and n-benzyloctadecanamide. The identities of n-benzyl-(9Z)-octadecenamide and n-benzyl-(9Z, 12Z)-octadecadienamide were confirmed by comparison of chromatographic and spectral properties with synthetic analogues. Total macamides have been quantified by HPLC-UV in plant material from different vendors using n-benzylhexadecanamide as an external standard. The amount of macamides in the dried plant material ranged from 0.0016 to 0.0123%.
Zhang, Kelly; Li, Yi; Tsang, Midco; Chetwyn, Nik P
2013-09-01
To overcome challenges in HPLC impurity analysis of pharmaceuticals, we developed an automated online multi-heartcutting 2D HPLC system with hyphenated UV-charged aerosol MS detection. The first dimension has a primary column and the second dimension has six orthogonal columns to enhance flexibility and selectivity. The two dimensions were interfaced by a pair of switching valves equipped with six trapping loops that allow multi-heartcutting of peaks of interest in the first dimension and also allow "peak parking." The hyphenated UV-charged aerosol MS detection provides comprehensive detection for compounds with and without UV chromophores, organics, and inorganics. It also provides structural information for impurity identification. A hidden degradation product that co-eluted with the drug main peak was revealed by RP × RP separation and thus enabled the stability-indicating method development. A poorly retained polar component with no UV chromophores was analyzed by RP × hydrophilic interaction liquid chromatography separation with charged aerosol detection. Furthermore, using this system, the structures of low-level impurities separated by a method using nonvolatile phosphate buffer were identified and tracked by MS in the second dimension. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
NASA Astrophysics Data System (ADS)
John, Rita; Merlin, Benita
2017-11-01
This study offers an analysis of optical properties of Graphene and its 2D analogues: Silicene, Germanene, and Stanene with the help of band structures based on Density Functional Theory. The complex dielectric function and complex refractive index are calculated in both parallel (||) and perpendicular (⊥) polarization directions of the electromagnetic field. From these calculated values, optical observables like absorption, reflection, optical conductivity, and electron loss function have been studied. The optical response of all materials is shifted from ultraviolet (UV) to infrared (IR) from graphene to stanene; Graphene is more into UV region and other materials in the IR and visible regions. The intensity of absorption is maximum for stanene. The real part of dielectric function reveals the existence of plasma frequency in the || polarization direction indicating the metal to dielectric transition except for graphene. Study on refractive index clearly displays the birefringence characteristics of all materials. Reflectivity is enhanced in the mid IR and visible regions when light is polarized in the || direction. The in-depth investigations arrive at fine results which would enable the prediction of their potential applications in the optical and optoelectronic industries.
NASA Astrophysics Data System (ADS)
Giovannoli, E.; Buat, V.
2013-03-01
We use the code CIGALE (Code Investigating Galaxies Emission: Burgarella et al. 2005; Noll et al. 2009) which provides physical information about galaxies by fitting their UV (ultraviolet)-to-IR (infrared) spectral energy distribuition (SED). CIGALE is based on the use of a UV-optical stellar SED plus a dust IR-emitting component. We study a sample of 136 Luminous Infrared Galaxies (LIRGs) at z˜0.7 in the ECDF-S previously studied in Giovannoli et al. (2011). We focus on the way the empirical Dale & Helou (2002) templates reproduce the observed SEDs of the LIRGs. Fig. 1 shows the total infrared luminosity (L IR ) provided by CIGALE using the 64 templates (x axis) and using 2 templates (y axis) representative of the whole sample. Despite the larger dispersion when only 1 or 2 Herschel data are available, the agreement between both values is good with Δ log L IR = 0.0013 ± 0.045 dex. We conclude that 2 IR SEDs can be used alone to determine the L IR of LIRGs at z˜0.7 in an SED-fitting procedure.
NASA Astrophysics Data System (ADS)
Kozub, John Andrew
1995-01-01
Photocrosslinking of protein-nucleic acid complexes with low intensity UV has frequently been used to study biological systems. We have investigated the photochemistry of protein-nucleic acid systems using nanosecond UV pulses from a Nd:YAG-pumped dye laser system, low-intensity continuous UV from a typical germicidal lamp, and high-intensity mid -IR pulses from the Vanderbilt Free Electron Laser. Quantum yields for UV-induced nucleic acid damage from laser pulses and the germicidal lamp were found to be nearly equivalent. We have demonstrated the general applicability of the laser to this technique by successfully crosslinking hnRNP protein to RNA, yeast TATA-binding protein to dsDNA, and gene 32 protein to ssDNA with UV laser pulses. Our results indicate that UV-crosslinking has an intrinsic specificity for nucleic acid sites containing thymidine (or uridine), forcing a distinction between preferred binding sites and favorable crosslinking sites. We have found in each system that protein and nucleic acid photodamage competes with crosslinking, limits the yield, and may interfere with subsequent analysis. The distribution of photoproducts in the gene 32 protein-ssDNA system was investigated as a function of the total dose of UV radiation and the intensity of UV laser pulses. It was found that laser pulses providing up to 50 photons per nucleic acid base induce a linear response from the system; the absolute and relative yields of photoproducts depend only on the total dose of UV and not on the rate of delivery. At higher intensities, the yield of crosslinks per incident photon was reduced. A single pulse at the optimum intensity (about 100-200 photons per nucleic acid base) induced roughly 80% of the maximum attainable yield of crosslinks in this system. The early results of our search for photochemistry induced by Free Electron Laser pulses indicate the potential to induce a unique photoreaction in the gene 32 protein -ssDNA system. The yield is apparently enhanced by simultaneous exposure to UV pulses. Future experiments will test the potential of IR and UV irradiations to increase the specificity for photocrosslinks.
Coronal Magnetism: Hanle Effect in UV and IR Spectral Lines
NASA Astrophysics Data System (ADS)
Raouafi, N. E.; Riley, P.
2014-12-01
The plasma thermodynamics in the solar upper atmosphere, particularly in the corona, are dominated by the magnetic field, which controls the flow and dissipation of energy. The relative lack of knowledge of the coronal vector magnetic field is a major handicap for the progress in coronal physics. This makes the development of measurement methods of coronal magnetic fields a high priority in solar physics. The Hanle effect in the UV and IR spectral lines is a largely unexplored diagnostic. Here we use magnetohydrodynamic (MHD) simulations to study the magnitude of the signal to be expected for typical coronal magnetic fields for selected spectral lines in the UV and IR wavelength ranges, namely the H I Lyman series (i.e., α, β, and γ), O VI 103.2 nm line, and the He I 1083 nm line. We show that the selected lines may be useful for the diagnostic of coronal magnetic fields. We also show that the combination of polarization measurements of spectral lines with different sensitivities to the Hanle effect may be most appropriate for the interpretation of the data. We propose that UV coronal magnetic field mapper should be a central part of the science payload of any future spacebased solar observatory.
The Host Galaxies Of UV-selected AGNs At z 2-3
NASA Astrophysics Data System (ADS)
Hainline, Kevin; Shapley, A.; Greene, J.; Steidel, C.
2012-01-01
An important goal for studies of galaxy formation consists of tracing a direct evolutionary connection between the growth of supermassive black holes powering active galactic nuclei (AGNs) and the build-up of stellar mass in their host galaxies. In the local universe, AGNs are preferentially found in bulge-dominated galaxies, but the AGN demographics at earlier epochs are not as well understood. We present a rest-frame UV composite spectrum for a sample of 33 z 2-3 AGNs drawn from the UV-selected Lyman Break Galaxy (LBG) survey. This spectrum shows many emission and absorption features, such as HI Lyman-alpha, NV 1240, NIV] 1483, 1486, CIV 1548, 1550, HeII 1640, and CIII] 1907, 1909. Redshifted SiIV 1394 absorption provides evidence for outflowing high-ionization gas in these objects at speeds of 103 km/s. Finally, using optical, near-IR, and mid-IR photometry, which cover the rest-frame UV to near-IR portions of the galaxies' spectral energy distributions, we perform stellar population synthesis modeling of the sample. Based on these results, we explore the relationship in the host galaxy between AGN activity, maturity of the stellar population, and regulation of star formation.
NASA Technical Reports Server (NTRS)
Allamandola, L. J.; Tielens, G. G. M.; Barker, J. R.
1989-01-01
A comprehensive study of the PAH hypothesis is presented, including the interstellar, IR spectral features which have been attributed to emission from highly vibrationally excited PAHs. Spectroscopic and IR emission features are discussed in detail. A method for calculating the IR fluorescence spectrum from a vibrationally excited molecule is described. Analysis of interstellar spectrum suggests that the PAHs which dominate the IR spectra contain between 20 and 40 C atoms. The results are compared with results from a thermal approximation. It is found that, for high levels of vibrational excitation and emission from low-frequency modes, the two methods produce similar results. Also, consideration is given to the relationship between PAH molecules and amorphous C particles, the most likely interstellar PAH molecular structures, the spectroscopic structure produced by PAHs and PAH-related materials in the UV portion of the interstellar extinction curve, and the influence of PAH charge on the UV, visible, and IR regions.
Lutterbeck, Carlos Alexandre; Baginska, Ewelina; Machado, Ênio Leandro; Kümmerer, Klaus
2015-12-01
Anti-cancer drugs are discussed as high risk substances in regard to human health and considered as problematic for the environment. They are of potential environmental relevance due to their poor biodegradability and toxicological properties. Methotrexate (MTX) is an antimetabolite that was introduced in the pharmaceutical market in the 40's and still today is one of the most consumed cytotoxic compounds around the world. In the present study MTX was only partially biodegraded in the closed bottle test (CBT). Therefore, it was submitted to three different advanced oxidation processes (AOPs): UV/H2O2, UV/Fe(2+)/H2O2 and UV/TiO2. The irradiation was carried out with a Hg medium-pressure lamp during 256min whereas the analytical monitoring was done through LC-UV-MS/MS and DOC analysis. MTX was easily removed in all the irradiation experiments, while the highest mineralization values and rates were achieved by the UV/Fe(2+)/H2O2 treatment. The lowest resulted from the UV/H2O2 reactions. The UV/H2O2 treatment resulted in little biodegradable transformation products (TPs). However, the same treatment resulted in a reduction of the toxicity of MTX by forming less toxic TPs. Analysis by LC-UV-MS/MS revealed the existence of nine TPs formed during the photo-catalytic treatments. The pH of the solutions decreased from 6.4 (t 0min) to 5.15 in the UV/H2O2 and from 6.4 (t 0min) to 5.9 in the UV/TiO2 at the end of the experiments. The initial pH of the UV/Fe(2+)/H2O2 experiments was adjusted to 5 and after the addition of H2O2 the pH decreased to around 3 and remained in this range until the end of the treatments. Copyright © 2015 Elsevier Ltd. All rights reserved.
Kanrar, Bappaditya; Bhattacharyya, Anjan
2009-11-01
The photolysis of a rice herbicide Bispyribac sodium (Sodium 2, 6-bis [(4, 6-dimethoxypyrimidin-2-yl) oxy] benzoate) has been studied in different aqueous medium (distilled water, pond water and Irrigation water) under the influence of UV (lambda max > or = 250 nm) and sunlight in presence or absence of sensitizers (TiO(2) and KNO(3)). The study was conducted under laboratory simulated condition which made it possible to evaluate the contribution of different factors viz. source of irradiation, solvent and sensitizers towards the photolysis of bispyribac sodium. The photodegradation proceeds via first order reaction Kinetics in all the cases. Five photo metabolites (M(1)-M(5)) were isolated in pure form by column chromatographic method from the irradiation system under UV influenced and TiO(2) as sensitizer. From the different spectral data (IR, NMR, UV-VIS, Mass) the structure of these five metabolites were assigned as M(1) (Phenol), M(2) [2, 6-Dihydroxy benzoic acid], M(3) [2, 6-bis [(4, 6 dimethoxypyrimidin-2yl) oxy] benzoic acid], M(4) [2-(3-Hydroxy-phenoxy)-pyrimidine-4, 6-diol] and M(5) as [2,4-Dihydroxy-3, 5-dimethoxy-6-(4-methoxy pyrimidine-2-yloxy)-benzoic acid]. Moreover, another six photometabolites (M(6)-M(11)) were identified from the different irradiation system on the basis of Micromass analysis. On the basis of MS/MS data analysis, the structure of these six photometabolites were assigned as M(6) [2-(4, 6-Dimethoxy-pyrimidin-2-yloxy)-6-hydroxy-benzoic acid], M(7) [2-Hydroxy-6-(4-hydroxy-6-methoxy-pyrimidin-2-yloxy)-benzoic acid], M(8) [4, 6-Dimethoxy-pyrimidin-2-ol], M(9) [6-Methoxy-pyrimidine-2, 4-diol], M(10) [2-Hydroxy-6-(pyrimidin-2-yloxy)-benzoic acid] and M(11) [2, 4, 6-Trimethoxy-pyrimidine]. The plausible Photodegradation pathways of bispyribac sodium in the present investigation were portrayed which proceeds via hydrolysis, hydrolytic cleavage, O-dealkylation, decarboxylation, dehydroxylation, O-alkylation and hydroxylation.
The impact of elevated ultraviolet-B radiation (UV-B, 280-320 nm) on membrane systems and lipid peroxidation, and possible involvement of active oxygen radicals was investigated in leaves of two UV-B susceptible rice cultivars (Oryza sativa L. cvs IR74 and Dular). Rice seedlings ...
Loquais, Yohan; Gloaguen, Eric; Habka, Sana; Vaquero-Vara, Vanesa; Brenner, Valérie; Tardivel, Benjamin; Mons, Michel
2015-06-11
The intrinsic conformational landscape of two phenylalanine-containing protein chain models (-Gly-Phe- and -Ala-Phe- sequences) has been investigated theoretically and experimentally in the gas phase. The near UV spectroscopy (first ππ* transition of the Phe ring) is obtained experimentally under jet conditions where the conformational features can be resolved. Single-conformation IR spectroscopy in the NH stretch region is then obtained by IR/UV double resonance in the ground state, leading to resolved vibrational spectra that are assigned in terms of conformation and H-bonding content from comparison with quantum chemistry calculations. For the main conformer, whose UV spectrum exhibits a significant Franck-Condon activity in low frequency modes involving peptide backbone motions relative to the Phe chromophore, excited state IR spectroscopy has also been recorded in a UV/IR/UV experiment. The NH stretch spectral changes observed in such a ππ* labeling experiment enable us to determine those NH bonds that are coupled to the phenyl ring; they are compared to CC2 excited state calculations to quantify the geometry change upon ππ* excitation. The complete and consistent series of data obtained enable us to propose an unambiguous assignment for the gallery of conformers observed and to demonstrate that, in these two sequences, three conceptually important local structural motifs of proteins (β-strands, 27 ribbons, and β-turns) are represented. The satisfactory agreement between the experimental conformational distribution and the predicted landscape anticipated from the DFT-D approach demonstrates the capabilities of a theoretical method that accounts for dispersive interactions. It also shows that the flaws, inherent to a resonant two-photon ionization detection scheme, often evoked for aromatic chromophores, do not seem to be significant in the case of Phe.
Quantitative Profiling of DNA Damage and Apoptotic Pathways in UV Damaged Cells Using PTMScan Direct
Stokes, Matthew P.; Silva, Jeffrey C.; Jia, Xiaoying; Lee, Kimberly A.; Polakiewicz, Roberto D.; Comb, Michael J.
2013-01-01
Traditional methods for analysis of peptides using liquid chromatography and tandem mass spectrometry (LC-MS/MS) lack the specificity to comprehensively monitor specific biological processes due to the inherent duty cycle limitations of the MS instrument and the stochastic nature of the analytical platform. PTMScan Direct is a novel, antibody-based method that allows quantitative LC-MS/MS profiling of specific peptides from proteins that reside in the same signaling pathway. New PTMScan Direct reagents have been produced that target peptides from proteins involved in DNA Damage/Cell Cycle and Apoptosis/Autophagy pathways. Together, the reagents provide access to 438 sites on 237 proteins in these signaling cascades. These reagents have been used to profile the response to UV damage of DNA in human cell lines. UV damage was shown to activate canonical DNA damage response pathways through ATM/ATR-dependent signaling, stress response pathways and induce the initiation of apoptosis, as assessed by an increase in the abundance of peptides corresponding to cleaved, activated caspases. These data demonstrate the utility of PTMScan Direct as a multiplexed assay for profiling specific cellular responses to various stimuli, such as UV damage of DNA. PMID:23344034
Diagnostics of Coronal Magnetic Fields Through the Hanle Effect in UV and IR Lines
NASA Astrophysics Data System (ADS)
Raouafi, Nour E.; Riley, Pete; Gibson, Sarah; Fineschi, Silvano; Solanki, Sami K.
2016-06-01
The plasma thermodynamics in the solar upper atmosphere, particularly in the corona, are dominated by the magnetic field, which controls the flow and dissipation of energy. The relative lack of knowledge of the coronal vector magnetic field is a major handicap for progress in coronal physics. This makes the development of measurement methods of coronal magnetic fields a high priority in solar physics. The Hanle effect in the UV and IR spectral lines is a largely unexplored diagnostic. We use magnetohydrodynamic (MHD) simulations to study the magnitude of the signal to be expected for typical coronal magnetic fields for selected spectral lines in the UV and IR wavelength ranges, namely the HI Ly-α and the He I 10830 Å lines. We show that the selected lines are useful for reliable diagnosis of coronal magnetic fields. The results show that the combination of polarization measurements of spectral lines with different sensitivities to the Hanle effect may be most appropriate for deducing coronal magnetic properties from future observations.
Tarzi, Olga I; Nonami, Hiroshi; Erra-Balsells, Rosa
2009-02-01
The thermal stability of several commonly used crystalline matrix-assisted ultraviolet laser desorption/ionization mass spectrometry (UV-MALDI-MS) matrices, 2,5-dihydroxybenzoic acid (gentisic acid; GA), 2,4,6-trihydroxyacetophenone (THA), alpha-cyano-4-hydroxycinnamic acid (CHC), 3,5-dimethoxy-4-hydroxycinnamic acid (sinapinic acid; SA), 9H-pirido[3,4-b]indole (nor-harmane; nor-Ho), 1-methyl-9H-pirido[3,4-b]indole (harmane; Ho), perchlorate of nor-harmanonium ([nor-Ho+H]+) and perchlorate of harmanonium ([Ho+H]+) was studied by heating them at their melting point and characterizing the remaining material by using different MS techniques [electron ionization mass spectrometry (EI-MS), ultraviolet laserdesorption/ionization-time-of-flight-mass spectrometry (UV-LDI-TOF-MS) and electrospray ionization-time-of-flight-mass spectrometry (ESI-TOF-MS)] as well as by thin layer chromatography analysis (TLC), electronic spectroscopy (UV-absorption, fluorescence emission and excitation spectroscopy) and 1H nuclear magnetic resonance spectroscopy (1H-NMR). In general, all compounds, except for CHC and SA, remained unchanged after fusion. CHC showed loss of CO2, yielding the trans-/cis-4-hydroxyphenylacrilonitrile mixture. This mixture was unambiguously characterized by MS and 1H-NMR spectroscopy, and its sublimation capability was demonstrated. These results explain the well-known cluster formation, fading (vanishing) and further recovering of CHC when used as a matrix in UV-MALDI-MS. Commercial SA (SA 98%; trans-SA/cis-SA 5:1) showed mainly cis- to-trans thermal isomerization and, with very poor yield, loss of CO2, yielding (3',5'-dimethoxy-4'-hydroxyphenyl)-1-ethene as the decarboxilated product. These thermal conversions would not drastically affect its behavior as a UV-MALDI matrix as happens in the case of CHC. Complementary studies of the photochemical stability of these matrices in solid state were also conducted. Copyright (c) 2008 John Wiley & Sons, Ltd.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Faisst, Andreas L.; Capak, Peter L.; Masters, Daniel C.
Recent studies have found a significant evolution and scatter in the relationship between the UV spectral slope ( β {sub UV}) and the infrared excess (IRX; L {sub IR}/ L {sub UV}) at z > 4, suggesting different dust properties of these galaxies. The total far-infrared (FIR) luminosity is key for this analysis, but it is poorly constrained in normal (main-sequence) star-forming z > 5 galaxies, where often only one single FIR point is available. To better inform estimates of the FIR luminosity, we construct a sample of local galaxies and three low-redshift analogues of z > 5 systems. Themore » trends in this sample suggest that normal high-redshift galaxies have a warmer infrared (IR) spectral energy distribution (SED) compared to average z < 4 galaxies that are used as priors in these studies. The blueshifted peak and mid-IR excess emission could be explained by a combination of a larger fraction of metal-poor interstellar medium being optically thin to ultraviolet (UV) light and a stronger UV radiation field due to high star formation densities. Assuming a maximally warm IR SED suggests a 0.6 dex increase in total FIR luminosities, which removes some tension between the dust attenuation models and observations of the IRX− β relation at z > 5. Despite this, some galaxies still fall below the minimum IRX− β relation derived with standard dust cloud models. We propose that radiation pressure in these highly star-forming galaxies causes a spatial offset between dust clouds and young star-forming regions within the lifetime of O/B stars. These offsets change the radiation balance and create viewing-angle effects that can change UV colors at fixed IRX. We provide a modified model that can explain the location of these galaxies on the IRX− β diagram.« less
Innovative Approach to Validation of Ultraviolet (UV) Reactors ...
Slide presentation at Conference: ASCE 7th Civil Engineering Conference in the Asian Region. USEPA in partnership with the Cadmus Group, Carollo Engineers, and other State & Industry collaborators, are evaluating new approaches for validating UV reactors to meet groundwater & surface water pathogen inactivation including viruses for low-pressure and medium-pressure UV systems. Evaluation objectives of the study: Practical approach for validating LP and MP UV reactors for virus & cryptosporidium inactivation using various test microbes, i.e., MS2, B. pumilus, AD2, T1; Apply UV dose algorithms based on theory vs empirical that predict log-I and RED as a function of the UV sensitivity of the microbe (combined variable criteria), flow, lamp-sensor output, DL-ASCFs, w/wo UVT; Assess capabilities of test microbe for predicting target pathogen, assess credibility with second test microbe vs bracketing; Evaluate UV lamp sensor technology that accounts for germicidal contributions of low-and high-wavelength UV light within MP reactors; Address approaches for propagating and assaying AD2, B. pumilus, MS2, and methods for determining low and high wavelength ASCFs using collimated beam LP & MP UV lamps; Determine & apply low and high wavelength ASCFs to predict cryptosporidium and adenovirus credit using MS2, or B. pumilus, T1 test data; Simplify Validation-Factor (VF) analysis of uncertainties/biases; Develop recommendations document from recent lessons learned applicabl
Tertiary treatment using microfiltration and UV disinfection for water reclamation
DOE Office of Scientific and Technical Information (OSTI.GOV)
Jolis, D.; Hirano, R.; Pitt, P.
Microfiltration and UV disinfection are two alternative technologies for water reclamation. The results of a pilot study combining these two processes are presented. In addition to producing filtrate turbidites averaging 0.06 nephelometric turbidity units, microfiltration was an effective barrier to pathogens, demonstrating average log reductions of 4.5 for total coliforms and 2.9 for MS2 bacteriophage. Ultraviolet disinfection following microfiltration reliably met the California Wastewater Reclamation Criteria (Title 22) total coliform standard of 2.2 colony-forming units/100 mL at a UV dose of 450 J/m{sup 2}. The MS2 bacteriophage standard, which requires a 5-log reduction, was achieved by microfiltration and a UVmore » dose of 880 J/m{sup 2}. A model of the kinetics of inactivation of MS2 bacteriophage was used in further analysis of disinfection data. The model indicated that considerable backmixing occurred in the pilot UV disinfection unit, and observed UV doses could be reduced with improved hydraulics.« less
Theoretical and Experimental Spectroscopic Analysis of Cyano-Substituted Styrylpyridine Compounds
Castro, Maria Eugenia; Percino, Maria Judith; Chapela, Victor M.; Ceron, Margarita; Soriano-Moro, Guillermo; Lopez-Cruz, Jorge; Melendez, Francisco J.
2013-01-01
A combined theoretical and experimental study on the structure, infrared, UV-Vis and 1H NMR data of trans-2-(m-cyanostyryl)pyridine, trans-2-[3-methyl-(m-cyanostyryl)] pyridine and trans-4-(m-cyanostyryl)pyridine is presented. The synthesis was carried out with an efficient Knoevenagel condensation using green chemistry conditions. Theoretical geometry optimizations and their IR spectra were carried out using the Density Functional Theory (DFT) in both gas and solution phases. For theoretical UV-Vis and 1H NMR spectra, the Time-Dependent DFT (TD-DFT) and the Gauge-Including Atomic Orbital (GIAO) methods were used, respectively. The theoretical characterization matched the experimental measurements, showing a good correlation. The effect of cyano- and methyl-substituents, as well as of the N-atom position in the pyridine ring on the UV-Vis, IR and NMR spectra, was evaluated. The UV-Vis results showed no significant effect due to electron-withdrawing cyano- and electron-donating methyl-substituents. The N-atom position, however, caused a slight change in the maximum absorption wavelengths. The IR normal modes were assigned for the cyano- and methyl-groups. 1H NMR spectra showed the typical doublet signals due to protons in the trans position of a double bond. The theoretical characterization was visibly useful to assign accurately the signals in IR and 1H NMR spectra, as well as to identify the most probable conformation that could be present in the formation of the styrylpyridine-like compounds. PMID:23429190
Weiler, Martin; Nakamura, Takashi; Sekiya, Hiroshi; Dopfer, Otto; Miyazaki, Mitsuhiko; Fujii, Masaaki
2012-12-07
We present the resonance-enhanced multiphoton ionization, infrared-ultraviolet hole burning (IR-UV HB), and IR dip spectra of the trans-acetanilide-methanol (AA-MeOH) cluster in the S(0), S(1), and cationic ground state (D(0)) in a supersonic jet. The IR-UV HB spectra demonstrate the co-existence of two isomers in S(0,1), in which MeOH binds either to the NH or the CO site of the peptide linkage in AA, denoted as AA(NH)-MeOH and AA(CO)-MeOH. When AA(CO)-MeOH is selectively ionized, its IR spectrum in D(0) is the same as that measured for AA(+) (NH)-MeOH. Thus, photoionization of AA(CO)-MeOH induces migration of MeOH from the CO to the NH site with 100% yield. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
LC-MS guided isolation of diterpenoids from Sapium insigne with α-glucosidase inhibitory activities.
Yan, De-Xiu; Geng, Chang-An; Yang, Tong-Hua; Huang, Xiao-Yan; Li, Tian-Ze; Gao, Zhen; Ma, Yun-Bao; Peng, Hua; Zhang, Xue-Mei; Chen, Ji-Jun
2018-04-08
Ten new (1-10) and ten known (11-20) diterpenoids involving ent-atisane, ent-seco-atisane, ent-kaurane and ent-seco-kaurane types were isolated from Sapium insigne under the guidance of LCMS-IT-TOF analyses. Their structures were characterized by extensive spectroscopic analyses (HRESIMS, UV, IR, 1D and 2D NMR). A putative biosynthetic pathway was proposed for ent-seco-atisane diterpenoids. Their inhibitory activities on α-glucosidase in vitro were tested for the first time. Compound 4 showed moderate inhibitory effect on α-glucosidase with an IC 50 value of 0.34 mM via a noncompetitive inhibition mechanism (K i = 0.27 mM). The preliminary structure-activity relationships of the ent-atisane diterpenoids inhibiting α-glucosidase were discussed. Copyright © 2018 Elsevier B.V. All rights reserved.
ACETYL CHOLINESTERASE AND BUTYRYL CHOLINESTERASE INhIBITORY ACTIVITIES OF ZALEYA PENTANDRA.
Afzal, Samina; Chaudhry, Bashir Ahmad; Afzal, Khurram; Saeed, Javeria; Akash, Sajd Hamid; Qadir, Muhammad Imran
2017-05-01
The aim of this study was to reveal acetyl cholinesterase (AchE) and butyryl cholinesterase (BchE) inhibitory activities of Zaleya pentandra. The aerial parts of the plant were air, freeze-dried and powdered. The extraction was carried out with methanol at room temperature for 24 h. The extract was concentrated on rotavapor and fractioned by column chromatography. The isolation and purification afforded amorphous solid which was subjected to physical, chemical and spectroscopic techniques i.e., UV, IR, H-NMR, "C-NMR and HREI-MS for the structure elucidation of the isolated compound. The compound was concluded as "Pentandradione" a novel compound. AchE and BchE inhibitory activities were estimated. The result showed that the isolated extract possessed significant activity against butyryl cholinesterase as compared to standard eserine while the extract lacks acetyl cholinesterase inhibitory activity.
NASA Astrophysics Data System (ADS)
Huang, Bo; Hu, Xiaokang; Hu, Xunliang; Wang, Nan; Yang, Kang; Xiao, Zicheng; Wu, Pingfan
2017-12-01
Towards design and synthesis of bulky molecules and molecular machines, we reported a new inorganic-organic hybrid material based on polyoxometalates and 1, 3-dicyclohexylcarbodiimide (DCC): (Bu4N)2[V6O13{(OCH2)3CCH2OOCCH2CH2CON(C6H11)CONHC6H11}2]. The hybrid was characterized by FT-IR, 1H NMR, UV-Vis, ESI-MS, and the structure of the compound was determined through single-crystal X-ray diffraction. There was an interesting supramolecular assembly in the hybrid material through intermolecular hydrogen bonding, and each cyclohexyl in the polymer looks like one of blades in the propeller. Furthermore, the thermal stability of the hybrid was tested by TGA analyses, and the electrochemical property has also been studied by cyclic voltammogram.
Khan, Salman A; Asiri, Abdullah M; Basisi, Hadi Mussa; Arshad, Muhammad Nadeem; Sharma, Kamlesh
2015-11-01
Two push-pull chromophores were synthesized by knoevenagel condensation under microwave irradiation. The structure of synthesized chromophores were established by spectroscopic (FT-IR, (1)H NMR, (13)C NMR, EI-MS) and elemental analysis. Structure of the chromophores was further conformed by X-ray crystallographic. UV-Vis and fluorescence spectroscopy measurements provided that chromophores were good absorbent and fluorescent properties. Fluorescence polarity studies demonstrated that chromophores were sensitive to the polarity of the microenvironment provided by different solvents. Physicochemical parameters, including singlet absorption, extinction coefficient, stokes shift, oscillator strength, dipole moment and flurescence quantum yield were investigated in order to explore the analytical potential of the synthesized chromophores. In addition, the total energy, frontier molecular orbitals, hardness, electron affinity, ionization energy, electrostatic potential map were also studied computationally by using density functional theoretical method.
Physicochemical characterization of ezetimibe and its impurities
NASA Astrophysics Data System (ADS)
Filip, Katarzyna; Bańkowski, Krzysztof; Sidoryk, Katarzyna; Zagrodzka, Joanna; Łaszcz, Marta; Trzcińska, Kinga; Szyprowska, Anna; Cmoch, Piotr; Maruszak, Wioleta
2011-04-01
The physicochemical characterization of major degradation and process-related impurities associated with the synthesis of ezetimibe was performed. The possibility of forming the undesirable ( R, R, S) stereoisomer of ezetimibe has been mentioned in literature (Vinod KK, Suhail A, Bhupendra T, Nitin G US 2010/0010212 A1, Ind-Swift Laboratories Limited WO 2008/096372), but no study of its structure determination has been published yet. This paper discusses the structure elucidation of the ( R, R, S) stereoisomer as well as ezetimibe degradation product on the bases of NMR, IR and MS data. Other potential impurities of ezetimibe are also described. A selective and stability-indicating high-performance liquid chromatography method with dual UV detection was developed for the determination of chemical and stereochemical purity of ezetimibe. The characterization of particle size and shape for ezetimibe and its stereoisomer is also described.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Doménech, J. L.; Herrero, V. J.; Tanarro, I.
The chloroniumyl cation, HCl{sup +}, has been recently identified in space from Herschel 's spectra. A joint analysis of extensive vis-UV spectroscopy emission data together with a few high-resolution and high-accuracy millimeter-wave data provided the necessary rest frequencies to support the astronomical identification. Nevertheless, the analysis did not include any infrared (IR) vibration–rotation data. Furthermore, with the end of the Herschel mission, IR observations from the ground may be one of the few available means to further study this ion in space. In this work, we provide a set of accurate rovibrational transition wavenumbers, as well as a new andmore » improved global fit of vis-UV, IR, and millimeter-wave spectroscopy laboratory data, that will aid in future studies of this molecule.« less
Chen, Jun; Carl, Michael; Ma, Yajun; Shao, Hongda; Lu, Xing; Chen, Bimin; Chang, Eric Y; Wu, Zhihong; Du, Jiang
2016-10-01
We report the three-dimensional ultrashort-TE (3D UTE) and adiabatic inversion recovery UTE (IR-UTE) sequences employing a radial trajectory with conical view ordering for bi-component T2 * analysis of bound water (T2 *(BW) ) and pore water (T2 *(PW) ) in cortical bone. An interleaved dual-echo 3D UTE acquisition scheme was developed for fast bi-component analysis of bound and pore water in cortical bone. A 3D IR-UTE acquisition scheme employing multiple spokes per IR was developed for bound water imaging. Two-dimensional UTE (2D UTE) and IR-UTE sequences were employed for comparison. The sequences were applied to bovine bone samples (n = 6) and volunteers (n = 6) using a 3-T scanner. Bi-component fitting of 3D UTE images of bovine samples showed a mean T2 *(BW) of 0.26 ± 0.04 ms and T2 *(PW) of 4.16 ± 0.35 ms, with fractions of 21.5 ± 3.6% and 78.5 ± 3.6%, respectively. The 3D IR-UTE signal showed a single-component decay with a mean T2 *(BW) of 0.29 ± 0.05 ms, suggesting selective imaging of bound water. Similar results were achieved with the 2D UTE and IR-UTE sequences. Bi-component fitting of 3D UTE images of the tibial midshafts of healthy volunteers showed a mean T2 *(BW) of 0.32 ± 0.08 ms and T2 *(PW) of 5.78 ± 1.24 ms, with fractions of 34.2 ± 7.4% and 65.8 ± 7.4%, respectively. Single-component fitting of 3D IR-UTE images showed a mean T2 *(BW) of 0.35 ± 0.09 ms. The 3D UTE and 3D IR-UTE techniques allow fast volumetric mapping of bound and pore water in cortical bone. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Salate derivatives found in sunscreens block experimental autoimmune encephalomyelitis in mice
Wang, Yanping; Marling, Steven J.; Plum, Lori A.; DeLuca, Hector F.
2017-01-01
UV light suppresses experimental autoimmune encephalomyelitis (EAE), a widely used animal model of MS, in mice and may be responsible for the decreased incidence of MS in equatorial regions. To test this concept further, we applied commercially available sunblock preparations to mice before exposing them to UV radiation. Surprisingly, some of the sunblock preparations blocked EAE without UV radiation. Furthermore, various sunblock preparations had variable ability to suppress EAE. By examining the components of the most effective agents, we identified homosalate and octisalate as the components responsible for suppressing EAE. Thus, salates may be useful in stopping the progression of MS, and may provide new insight into mechanisms of controlling autoimmune disease. PMID:28739922
NASA Astrophysics Data System (ADS)
Warad, Ismail; Abdoh, Muneer; Al Ali, Anas; Shivalingegowda, Naveen; Kumara, Karthik; Zarrouk, Abdelkader; Lokanath, Neartur Krishnappagowda
2018-02-01
Dipyridin-2-ylmethanone oxime (C11H9N3O), was prepared using di-2-pyridyl ketone. The oxime ligand and its neutral CuX2 (oxime)2 (X = Cl or Br) complexes have been identified with the aid of several spectroscopic techniques such as: IR, EI-MS, EA, UV-visible, TG, 1H-NMR and finally the structure of the free oxime ligand was confirmed by X-ray diffraction studies. The oxime crystallizes in the monoclinic space group P21/c, with cell parameters a = 8.8811 (8) Å, b = 10.6362 (8) Å, c = 11.2050 (8) Å, β = 109.085 (4) º, V = 1000.26 (14) Å3 and Z = 4. The molecular conformation is stabilized by a strong intramolecular Osbnd H⋯N hydrogen bonding between the hydroxyl group of the oxime moiety and the nitrogen of the pyridine ring. Since the oxime structure was solved by XRD, the ligand structure parameters like bond length and angles were compared to the DFT computed one, the UV-visible to TD-SCF and Hirshfeld surface to MEP analysis.
NASA Astrophysics Data System (ADS)
Gokul Raj, K.; Manikandan, R.; Arulvasu, C.; Pandi, M.
2015-03-01
Cladosporium oxysporum a new taxol producing endophytic fungus was identified and production of taxol were characterized using UV-visible spectroscopy (UV-vis), high-performance liquid chromatography (HPLC), infrared (IR) nuclear magnetic resonance spectroscopy (NMR (13C and 1H)) and liquid chromatography-mass spectrometry (LC-MS). The taxol biosynthetic gene (dbat) was evaluated for new taxol producing fungus. Antibacterial activity against six different human pathogenic bacteria was done by agar well diffusion method. The anticancer efficacy of isolated fungal taxol were also evaluated in human colon cancer cell HCT 15 by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT), cytotoxicity and nuclear morphology analysis. The isolated fungal taxol showed positive towards biosynthetic gene (dbat) and effective against both Gram positive as well as Gram negative. The fungal taxol suppress growth of cancer cell line HCT 15 with an IC50 value of 3.5 μM concentration by 24 h treatment. Thus, the result reveals that C. oxysporum could be a potential alternative source for production of taxol and have antibacterial as well as anticancer properties with possible clinical applications.
McMahon, Gillian; Wall, Rachel; Nolan, Kieran; Diamond, Dermot
2002-07-19
A series of derivatisation reactions between p-t-butyl calix[4]arene and ethyl bromoacetate were carried out in order to prepare 1,3 diester substituted calix[4]arene. Mass spectral data, obtained from direct injection of samples, indicated that the reactions were rich in the desired product. Since the ultra violet (UV) spectra of the desired product and possible impurities are very similar, liquid chromatography (LC) chromatographic data seemed to corroborate these results. However, when on-line LC-UV-MS was carried out and each LC peak subjected to MS analysis as it eluted, a very different picture emerged. It was found that many of these reactions actually contained high levels of the monoester product which, having less affinity for sodium in the MS, is therefore seriously underestimated in any direct injection assay. LC-diode array detection (DAD) methods were also used to help successfully identify and characterise the compounds being formed in these complex reactions. The overall results obtained in this paper allowed the optimal reaction conditions to be determined for this reaction. LC-MS analysis of the chromatographic peaks also identified the presence of two isomers of the diester substituted calix[4]arene (1,3 and 1,2 diesters). The combination of LC and UV/MS detection is required for accurate analysis of the products of such reactions.
Moore, Henna M; Bai, Baoyan; Boisvert, François-Michel; Latonen, Leena; Rantanen, Ville; Simpson, Jeremy C; Pepperkok, Rainer; Lamond, Angus I; Laiho, Marikki
2011-10-01
The nucleolus is a nuclear organelle that coordinates rRNA transcription and ribosome subunit biogenesis. Recent proteomic analyses have shown that the nucleolus contains proteins involved in cell cycle control, DNA processing and DNA damage response and repair, in addition to the many proteins connected with ribosome subunit production. Here we study the dynamics of nucleolar protein responses in cells exposed to stress and DNA damage caused by ionizing and ultraviolet (UV) radiation in diploid human fibroblasts. We show using a combination of imaging and quantitative proteomics methods that nucleolar substructure and the nucleolar proteome undergo selective reorganization in response to UV damage. The proteomic responses to UV include alterations of functional protein complexes such as the SSU processome and exosome, and paraspeckle proteins, involving both decreases and increases in steady state protein ratios, respectively. Several nonhomologous end-joining proteins (NHEJ), such as Ku70/80, display similar fast responses to UV. In contrast, nucleolar proteomic responses to IR are both temporally and spatially distinct from those caused by UV, and more limited in terms of magnitude. With the exception of the NHEJ and paraspeckle proteins, where IR induces rapid and transient changes within 15 min of the damage, IR does not alter the ratios of most other functional nucleolar protein complexes. The rapid transient decrease of NHEJ proteins in the nucleolus indicates that it may reflect a response to DNA damage. Our results underline that the nucleolus is a specific stress response organelle that responds to different damage and stress agents in a unique, damage-specific manner.
Degradation and mineralization of 2,4,6-trinitroresorcine in various photochemical systems.
Khue, Do Ngoc; Chat, Nguyen Van; Minh, Do Binh; Lam, Tran Dai; Lan, Pham Hong; Loi, Vu Duc
2013-05-01
Comparison was observed for degradation and mineralization of the explosive 2,4,6-trinitroresorcine (TNR) in different photochemical systems TNR/UV, TNR/UV/TiO2, TNR/UV/H2O2, TNR/UV/O3, TNR/UV/TiO2/H2O2 and TNR/UV/TiO2/O3 using High Performance Liquid Chromatography coupled with Mass Spectrometry (HPLC/MS) and Total Organic Carbon (TOC) analysis. Addition of oxidizing agents such as H2O2 or O3 accelerated the rate of TNR conversion and mineralization. Highest reaction rate was obtained in TNR/UV/TiO2/H2O2 system. The intermediate products were characterized and identified by LS-MS technique. The similarity in intermediate products of TNR suggested the analogous reaction pathways of the TNR degradation by these different systems. Copyright © 2013 Elsevier B.V. All rights reserved.
NASA Technical Reports Server (NTRS)
Megie, G.; Menzies, R. T.
1980-01-01
An analysis of the potential capabilities of a spectrally diversified DIAL technique for monitoring atmospheric species is presented assuming operation from an earth-orbiting platform. Emphasis is given to the measurement accuracies and spatial and temporal resolutions required to meet present atmospheric science objectives. The discussion points out advantages of spectral diversity to perform comprehensive studies of the atmosphere; in general it is shown that IR systems have an advantage in lower atmospheric measurements, while UV systems are superior for middle and upper atmospheric measurements.
De Orsi, Daniela; Pellegrini, Manuela; Pichini, Simona; Mattioli, Donatella; Marchei, Emilia; Gagliardi, Luigi
2008-11-04
A simple high-performance liquid chromatography (HPLC) method with ultraviolet diode array (UV-DAD) and electrospray ionisation mass spectrometry (ESI-MS) detection has been developed for the determination of minoxidil, progesterone, estrone, spironolactone, canrenone, hydrocortisone and triamcinolone acetonide in cosmetic products. The presence of these substances in commercial cosmetic samples is prohibited. The compounds were separated by reversed phase chromatography with water (0.1% trifluoroacetic acid) and acetonitrile gradient elution and detected by UV-DAD at 230, 254 and 280 nm and by ESI-MS positive ionisation mode. Benzoic acid was used as internal standard. Linearity was studied with UV-DAD detection from 1.50 to 1,000 microg/ml or mug/g range, depending on the different compounds and type of cosmetic preparation and with ESI-MS in the 50-1,000 ng/ml or ng/g range. Good determination coefficients (r(2)>or=0.99) were found in both UV and ESI-MS. At three concentrations spanning the linear dynamic ranges of both UV-DAD and ESI-MS assay, mean recoveries were always higher than 90% for the different analytes. This method was successfully applied to the analysis of substances under investigations illegally added in cosmetic cream and lotions, sold on internet web sites to prevent hair loss and other hormone-dependent skin diseases, like acne and hirsutism.
Xiong, Bo; Wang, Ling-Ling; Li, Qiong; Nie, Yu-Ting; Cheng, Shuang-Shuang; Zhang, Hui; Sun, Ren-Qiang; Wang, Yu-Jiao; Zhou, Hong-Bin
2015-11-01
A parallel microscope-based laser-induced fluorescence (LIF), ultraviolet-visible absorbance (UV) and time-of-flight mass spectrometry (TOF-MS) detection for high performance liquid chromatography (HPLC) was achieved and used to determine glucosamine in urines. First, a reliable and convenient LIF detection was developed based on an inverted microscope and corresponding modulations. Parallel HPLC-LIF/UV/TOF-MS detection was developed by the combination of preceding Microscope-based LIF detection and HPLC coupled with UV and TOF-MS. The proposed setup, due to its parallel scheme, was free of the influence from photo bleaching in LIF detection. Rhodamine B, glutamic acid and glucosamine have been determined to evaluate its performance. Moreover, the proposed strategy was used to determine the glucosamine in urines, and subsequent results suggested that glucosamine, which was widely used in the prevention of the bone arthritis, was metabolized to urines within 4h. Furthermore, its concentration in urines decreased to 5.4mM at 12h. Efficient glucosamine detection was achieved based on a sensitive quantification (LIF), a universal detection (UV) and structural characterizations (TOF-MS). This application indicated that the proposed strategy was sensitive, universal and versatile, and it was capable of improved analysis, especially for analytes with low concentrations in complex samples, compared with conventional HPLC-UV/TOF-MS. Copyright © 2015 Elsevier B.V. All rights reserved.
Frederiksen, Hanne; Nielsen, Ole; Skakkebaek, Niels E; Juul, Anders; Andersson, Anna-Maria
2017-03-01
Experimental studies indicate that some chemicals with UV blocking properties (known as UV filters) can act as endocrine disruptors. UV filters are used in sunscreens and other cosmetic- and personal care products, as well as in other consumer products such as food packaging, clothing and furniture textiles to protect the products against UV radiation. Here we present the urinary excretion of suspected endocrine active UV filters in Danish children and adolescents recruited from the general population. The content of benzophenone (BP), benzophenone-1 (BP-1), benzophenone-2 (BP-2), benzophenone-3 (BP-3), 5-chloro-2- hydroxybenzophenone (BP-7), 4-hydroxybenzophenone (4-HBP), 4-methyl-benzophenone (4-MBP), 3-(4- methylbenzylidene)-camphor (4-MBC) and 3-benzylidene camphor (3-BC) were monitored in 24h urine and two consecutive first morning samples from 129 healthy Danish children and adolescents (6-21 yrs). All 387 samples were collected during the autumn (Nov. 2007) and were analyzed by a new on-line TurboFlow-LC-MS/MS method developed for simultaneous biomonitoring of these nine UV filters in urine. BP-3 and BP-1 were detected in more than 80% of the 24h samples and were significantly correlated (R 2 =0.815). BP, 4-HBP and BP-2 were found in 43, 15 and 5% of the samples, respectively. The median (range) concentrations of the UV-filters in 24-h urine were as follows: BP-3, 0.92 (LOD-115); BP-1, 0.54 (LOD-44.6); BP,
Characterization of diffraction gratings scattering in uv and ir for space applications
NASA Astrophysics Data System (ADS)
Achour, Sakina; Kuperman-Le Bihan, Quentin; Etcheto, Pierre
2017-09-01
The use of Bidirectional Scatter Distribution Function (BSDF) in space industry and especially when designing telescopes is a key feature. Indeed when speaking about space industry, one can immediately think about stray light issues. Those important phenomena are directly linked to light scattering. Standard BSDF measurement goniophotometers often have a resolution of about 0.1° and are mainly working in or close to the visible spectrum. This resolution is far too loose to characterize ultra-polished surfaces. Besides, wavelength range of BSDF measurements for space projects needs to be done far from visible range. How can we measure BSDF of ultra-polished surfaces and diffraction gratings in the UV and IR range with high resolution? We worked on developing a new goniophometer bench in order to be able to characterize scattering of ultra-polished surfaces and diffraction gratings used in everyday space applications. This ten meters long bench was developed using a collimated beam approach as opposed to goniophotometer using focused beam. Sources used for IR characterization were CO2 (10.6?m) and Helium Neon (3.39?m) lasers. Regarding UV sources, a collimated and spatially filtered UV LED was used. The detection was ensure by a photomultiplier coupled with synchronous detection as well as a MCT InSb detector. The so-built BSDF measurement instrument allowed us to measure BSDF of ultra-polished surfaces as well as diffraction gratings with an angular resolution of 0.02° and a dynamic of 1013 in the visible range. In IR as well as in UV we manage to get 109 with same angular resolution of 0.02°. The 1m arm and translation stages allows us to measure samples up to 200mm. Thanks to such a device allowing ultra-polished materials as well as diffraction gratings scattering characterization, it is possible to implement those BSDF measurements into simulation software and predict stray light issues. This is a big help for space industry engineers to apprehend stray light due to surface finishes and to delete those effects before the whole project is done. We are now thinking of possible improvement on our optical bench to try to get dynamic in IR and UV similar to what we have in visible range (e.g. 1013).
Advanced capabilities for in situ planetary mass spectrometry
NASA Astrophysics Data System (ADS)
Arevalo, R. D., Jr.; Mahaffy, P. R.; Brinckerhoff, W. B.; Getty, S.; Benna, M.; van Amerom, F. H. W.; Danell, R.; Pinnick, V. T.; Li, X.; Grubisic, A.; Cornish, T.; Hovmand, L.
2015-12-01
NASA GSFC has delivered highly capable quadrupole mass spectrometers (QMS) for missions to Venus (Pioneer Venus), Jupiter (Galileo), Saturn/Titan (Cassini-Huygens), Mars (MSL and MAVEN), and the Moon (LADEE). Our understanding of the Solar System has been expanded significantly by these exceedingly versatile yet low risk and cost efficient instruments. GSFC has developed more recently a suite of advanced instrument technologies promising enhanced science return while selectively leveraging heritage designs. Relying on a traditional precision QMS, the Analysis of Gas Evolved from Samples (AGES) instrument measures organic inventory, determines exposure age and establishes the absolute timing of deposition/petrogenesis of interrogated samples. The Mars Organic Molecule Analyzer (MOMA) aboard the ExoMars 2018 rover employs a two-dimensional ion trap, built analogously to heritage QMS rod assemblies, which can support dual ionization sources, selective ion enrichment and tandem mass spectrometry (MS/MS). The same miniaturized analyzer serves as the core of the Linear Ion Trap Mass Spectrometer (LITMS) instrument, which offers negative ion detection (switchable polarity) and an extended mass range (>2000 Da). Time-of-flight mass spectrometers (TOF-MS) have been interfaced to a range of laser sources to progress high-sensitivity laser ablation and desorption methods for analysis of inorganic and non-volatile organic compounds, respectively. The L2MS (two-step laser mass spectrometer) enables the desorption of neutrals and/or prompt ionization at IR (1.0 up to 3.1 µm, with an option for tunability) or UV wavelengths (commonly 266 or 355 nm). For the selective ionization of specific classes of organics, such as aromatic hydrocarbons, a second UV laser may be employed to decouple the desorption and ionization steps and limit molecular fragmentation. Mass analyzers with substantially higher resolving powers (up to m/Δm > 100,000), such as the Advanced Resolution Organic Molecule Analyzer (AROMA) and multipass QMS instruments now under development, offer the potential to disambiguate key chemical signatures in complex mass spectra. Other innovative technologies being pursued include: ion inlet systems; tunable lasers; high-temp pyrolysis ovens; and, sample capture/enrichment techniques.
Mathon, Caroline; Ankli, Anita; Reich, Eike; Bieri, Stefan; Christen, Philippe
2014-01-01
The adulteration of herbal supplements is of growing importance, especially when they contain undeclared compounds like sibutramine that are unsafe drugs. Sibutramine was withdrawn from US and European markets in 2010. In this study, an HPTLC-UV densitometric method was developed for the quantification of sibutramine in herbal diet foods. Sample extracts were directly applied onto HPTLC silica gel plates and separated with a mobile phase made of a toluene-methanol mixture. Sibutramine was quantified at 225 nm and its unequivocal identification was confirmed by MS using a TLC-MS interface. During two surveys, 52 weight loss supplements obtained via the Internet were screened. Half of those were adulterated with sibutramine at amounts reaching up to 35 mg per capsule. The results of this validated HPTLC method were compared with those obtained by HPLC-UV and HPLC-MS/MS. The results were not significantly different with the three methods.
Surface Modified TiO2 Obscurants for Increased Safety and Performance
2012-11-01
based obscurant devices in performance. 15. SUBJECT TERMS Obscurant, visible, IR , smoke, TiO2, aerosol, particle, surface modification...hexamethyldimethoxysilane IR Infrared wavelength LabRAM Lab scale Resonant Acoustic Mixer from Resodyn Corporation LPM Liters Per Minute M106 Currently fielded (Army...trinitrophloroglucinol UV-Vis Ultraviolet-visible wavelengths KEYWORDS Obscurant, visible, IR , smoke, TiO2, aerosol, particle, surface modification
Savoca, Marco; Lagutschenkov, Anita; Langer, Judith; Harding, Dan J; Fielicke, André; Dopfer, Otto
2013-02-14
Vibrational spectra of mixed silicon carbide clusters Si(m)C(n) with m + n = 6 in the gas phase are obtained by resonant infrared-vacuum-ultraviolet two-color ionization (IR-UV2CI for n ≤ 2) and density functional theory (DFT) calculations. Si(m)C(n) clusters are produced in a laser vaporization source, in which the silicon plasma reacts with methane. Subsequently, they are irradiated with tunable IR light from an IR free electron laser before they are ionized with UV photons from an F(2) laser. Resonant absorption of one or more IR photons leads to an enhanced ionization efficiency for Si(m)C(n) and provides the size-specific IR spectra. IR spectra measured for Si(6), Si(5)C, and Si(4)C(2) are assigned to their most stable isomers by comparison with calculated linear absorption spectra. The preferred Si(m)C(n) structures with m + n = 6 illustrate the systematic transition from chain-like geometries for bare C(6) to three-dimensional structures for bare Si(6). In contrast to bulk SiC, carbon atom segregation is observed already for the smallest n (n = 2).
Saheb, Vahid; Sheikhshoaie, Iran; Setoodeh, Nasim; Rudbari, Hadi Amiri; Bruno, Giuseppe
2013-06-01
A new Cu(II) complex [Cu(L)(NCS)] has been synthesized, using 1-(N-salicylideneimino)-2-(N,N-methyl)-aminoethane as tridentate ONN donor Schiff base ligand (HL). The dark green crystals of the compound are used for single-crystal X-ray analysis and measuring Fourier Transform Infrared (FT-IR) and UV-Visible spectra. Electronic structure calculations at the B3LYP and MP2 levels of theory are performed to optimize the molecular geometry and to calculate the UV-Visible and FT-IR spectra of the compound. Vibrational assignments and analysis of the fundamental modes of the compound are performed. Time-dependent density functional theory (TD-DFT) method is used to calculate the electronic transitions of the complex. A scaling factor of 1.015 is obtained for vibrational frequencies computed at the B3LYP level using basis sets 6-311G(d,p). It is found that solvent has a profound effect on the electronic absorption spectrum. The UV-Visible spectrum of the complex recorded in DMSO and DMF solution can be correctly predicted by a model in which DMSO and DMF molecules are coordinated to the central Cu atom via their oxygen atoms. Copyright © 2013 Elsevier B.V. All rights reserved.
Infrared and Skin: Friend or Foe
Barolet, Daniel; Christiaens, François; Hamblin, Michael R
2016-01-01
In the last decade, it has been proposed that the sun's IR-A wavelengths might be deleterious to human skin and that sunscreens, in addition to their desired effect to protect against UV-B and UV-A, should also protect against IR-A (and perhaps even visible light). Several studies showed that NIR may damage skin collagen content via an increase in MMP-1 activity in the same manner as is known for UVR. Unfortunately, the artificial NIR light sources used in such studies were not representative of the solar irradiance. Yet, little has been said about the other side of the coin. This article will focus on key information suggesting that IR-A may be more beneficial than deleterious when the skin is exposed to the appropriate irradiance/dose of IR-A radiation similar to daily sun exposure received by people in real life. IR-A might even precondition the skin – a process called photoprevention - from an evolutionary standpoint since exposure to early morning IR-A wavelengths in sunlight may ready the skin for the coming mid-day deleterious UVR. Consequently IR-A appears to be the solution, not the problem. It does more good than bad for the skin. It is essentially a question of intensity and how we can learn from the sun. PMID:26745730
HAZMAT. III. The UV Evolution of Mid- to Late-M Stars with GALEX
NASA Astrophysics Data System (ADS)
Schneider, Adam C.; Shkolnik, Evgenya L.
2018-03-01
Low-mass stars are currently the most promising targets for detecting and characterizing habitable planets in the solar neighborhood. However, the ultraviolet (UV) radiation emitted by such stars can erode and modify planetary atmospheres over time, drastically affecting their habitability. Thus, knowledge of the UV evolution of low-mass stars is critical for interpreting the evolutionary history of any orbiting planets. Shkolnik & Barman used photometry from the Galaxy Evolution Explorer (GALEX) to show how UV emission evolves for early-type M stars (>0.35 M ⊙). In this paper, we extend their work to include both a larger sample of low-mass stars with known ages as well as M stars with lower masses. We find clear evidence that mid- and late-type M stars (0.08–0.35 M ⊙) do not follow the same UV evolutionary trend as early-Ms. Lower-mass M stars retain high levels of UV activity up to field ages, with only a factor of 4 decrease on average in GALEX NUV and FUV flux density between young (<50 Myr) and old (∼5 Gyr) stars, compared to a factor of 11 and 31 for early-Ms in NUV and FUV, respectively. We also find that the FUV/NUV flux density ratio, which can affect the photochemistry of important planetary biosignatures, is mass- and age-dependent for early-Ms, but remains relatively constant for the mid- and late-type Ms in our sample.
Nascimento, Henrique; Costa, Elísio; Rocha, Susana; Lucena, Clarice; Rocha-Pereira, Petronila; Rêgo, Carla; Mansilha, Helena Ferreira; Quintanilha, Alexandre; Aires, Luísa; Mota, Jorge; Santos-Silva, Alice; Belo, Luís
2014-08-01
Adiponectin circulates as low-, medium-, and high-molecular-weight multimers (LMW, MMW, and HMW) and influences lipid profile and insulin resistance (IR), HMW being considered as the most biologically active form. We aimed to study the relation between adiponectin and markers of metabolic syndrome (MS) in pediatric obesity, and the impact of physical exercise. The study consisted of a cross-sectional part and an 8-mo physical exercise program. Lipid profile, insulin, glucose, C-reactive protein (CRP), total adiponectin (TA), and homeostasis model assessment IR (HOMA-IR) were measured. Adiponectin multimers were studied in a prepubertal group. Obesity is associated with increased dyslipidemia, IR, and inflammation. TA is correlated inversely with adiposity, triglycerides, HOMA-IR, and CRP, and positively with high-density lipoprotein cholesterol (HDLc)/total cholesterol (TC) ratio. HMW mimicked TA associations. The intervention program led to a reduction of TC, low-density lipoprotein cholesterol (LDLc), insulin, HOMA-IR, and trunk percentage of fat, and an increase of HDLc/TC ratio, in the obese group. BMI improvements prevented adiponectin reduction and correlated with increments in HMW and MMW. Obesity-related increase in MS features might be linked to lower adiponectin. HMW and MMW were the multimers that most explained the MS features. The intervention program improved the lipid profile and IR, and prevented the reduction of adiponectin.
Sundararajan, M; Kennedy, L John; Vijaya, J Judith; Aruldoss, Udaya
2015-04-05
Nanostructured pure and zinc doped cobalt ferrites (Co1-xZnxFe2O4 where x fraction ranging from 0 to 0.5) were prepared by microwave combustion method employing urea as a fuel. The nanostructured samples were characterized by using various instrumental techniques such as X-ray powder diffractometry, high resolution scanning electron microscopy, energy dispersive X-ray analysis, UV-visible diffuse reflectance spectroscopy, photoluminescence spectroscopy and Fourier transformed infrared (FT-IR) spectroscopy. Vibrating sample magnetometry at room temperature was recorded to study the magnetic behavior of the samples. X-ray analysis and the FT-IR spectroscopy revealed the formation of cobalt ferrite cubic spinel-type structure. The average crystallite sizes for the samples were in the range of 3.07-11.30 nm. The direct band gap (Eg) was estimated using Kubelka-Munk method and is obtained from the UV-vis spectra. The band gap value decreased with an increase in zinc fraction (2.56-2.17 eV). The violet and green emission observed in the photoluminescence spectra revealed that cobalt ferrites are governed by defect controlled processes. The elemental analysis of zinc doped cobalt ferrites were obtained from energy dispersive X-ray (EDX) analysis. From the magnetic measurements, it is observed that cobalt ferrite and zinc doped cobalt ferrite systems fall under the soft ferrite category. The saturation magnetization (Ms) value of undoped cobalt ferrite is 14.26 emu/g, and it has reached a maximum of 29.61 emu/g for Co0.7Zn0.3Fe2O4. Copyright © 2014 Elsevier B.V. All rights reserved.
Decontamination of soil washing wastewater using solar driven advanced oxidation processes.
Bandala, Erick R; Velasco, Yuridia; Torres, Luis G
2008-12-30
Decontamination of soil washing wastewater was performed using two different solar driven advanced oxidation processes (AOPs): the photo-Fenton reaction and the cobalt/peroxymonosulfate/ultraviolet (Co/PMS/UV) process. Complete sodium dodecyl sulphate (SDS), the surfactant agent used to enhance soil washing process, degradation was achieved when the Co/PMS/UV process was used. In the case of photo-Fenton reaction, almost complete SDS degradation was achieved after the use of almost four times the actual energy amount required by the Co/PMS/UV process. Initial reaction rate in the first 15min (IR15) was determined for each process in order to compare them. Highest IR15 value was determined for the Co/PMS/UV process (0.011mmol/min) followed by the photo-Fenton reaction (0.0072mmol/min) and the dark Co/PMS and Fenton processes (IR15=0.002mmol/min in both cases). Organic matter depletion in the wastewater, as the sum of surfactant and total petroleum hydrocarbons present (measured as chemical oxygen demand, COD), was also determined for both solar driven processes. It was found that, for the case of COD, the highest removal (69%) was achieved when photo-Fenton reaction was used whereas Co/PMS/UV process yielded a slightly lower removal (51%). In both cases, organic matter removal achieved was over 50%, which can be consider proper for the coupling of the tested AOPs with conventional wastewater treatment processes such as biodegradation.
Probing the infrared counterparts of diffuse far-ultraviolet sources in the Galaxy
NASA Astrophysics Data System (ADS)
Saikia, Gautam; Shalima, P.; Gogoi, Rupjyoti; Pathak, Amit
2017-12-01
Recent availability of high quality infrared (IR) data for diffuse regions in the Galaxy and external galaxies have added to our understanding of interstellar dust. A comparison of ultraviolet (UV) and IR observations may be used to estimate absorption, scattering and thermal emission from interstellar dust. In this paper, we report IR and UV observations for selective diffuse sources in the Galaxy. Using archival mid-infrared (MIR) and far-infrared (FIR) observations from Spitzer Space Telescope, we look for counterparts of diffuse far-ultraviolet (FUV) sources observed by the Voyager, Far Ultraviolet Spectroscopic Explorer (FUSE) and Galaxy Evolution Explorer (GALEX) telescopes in the Galaxy. IR emission features at 8 μm are generally attributed to Polycyclic Aromatic Hydrocarbon (PAH) molecules, while emission at 24 μm are attributed to Very Small Grains (VSGs). The data presented here is unique and our study tries to establish a relation between various dust populations. By studying the FUV-IR correlations separately at low and high latitude locations, we have identified the grain component responsible for the diffuse FUV emission.
Rapid analysis of lignans from leaves of Podophyllum peltatum l. samples using UPLC-UV-MS
USDA-ARS?s Scientific Manuscript database
A new rapid UPLC-UV-MS method has been developed that permits the analysis of four lignans in P. peltatum L. Podophyllotoxin is a natural lignan that is being used as a precursor for the semi-synthetic anti-cancer drugs etoposide, teniposide and etopophos. The chromatographic separation was achieved...
Rapid analysis of lignans from leaves of Podophyllum peltatum L samples using UPLC-UV-MS
USDA-ARS?s Scientific Manuscript database
A new rapid UPLC-UV-MS method has been developed that permits the analysis of four lignans in P. peltatum L. Podophyllotoxin is a natural lignan that is being used as a precursor for the semi-synthetic anti-cancer drugs etoposide, teniposide and etopophos. The chromatographic separation was achieved...
USDA-ARS?s Scientific Manuscript database
In natural product chemistry, it is often crucial to determine sugar composition as well as the absolute configuration of each monosaccharide in glycosides. An ultra-performance liquid chromatography method using both photodiode array (PDA) and mass spectrometry detectors (UPLC-UV/MS) was developed....
USDA-ARS?s Scientific Manuscript database
A simple, fast UPLC-UV-MS method was developed for the determination of curcuminoids from roots of Curcuma longa L., Curcuma species (C. zedoaria, C. phaecaulis, C. wenyujin and C. kwangsiensis) and dietary supplements claiming to contain C. longa. The total content of curcuminoids (curcumin, desmet...
Uribarri, Jaime; Cai, Weijing; Woodward, Mark; Tripp, Elizabeth; Goldberg, Laurie; Pyzik, Renata; Yee, Kalle; Tansman, Laurie; Chen, Xue; Mani, Venkatesh; Fayad, Zahi A; Vlassara, Helen
2015-05-01
Although obesity can predispose to the metabolic syndrome (MS), diabetes, and cardiovascular disease, not all obese subjects develop MS, hence the need for new indicators of risk for this syndrome. Advanced glycation end products (AGEs) correlate with factors involved in the MS, including inflammation and insulin resistance (IR). Because AGEs can be derived from food and are modifiable, it is important to determine whether they are a risk factor for MS. The objective of this study was to assess the association of endogenous and exogenous AGEs with MS criteria. The following data were collected in a cross-sectional study of subjects with and without the MS: serum AGEs (sAGEs) and mononuclear cell AGEs, metabolites, pro- and antiinflammatory markers, body fat mass measures, including abdominal magnetic resonance imaging, and caloric and dietary AGE (dAGE) consumption. The study was conducted in the general community. Participants included 130 MS and 139 non-MS subjects of both sexes, older than 50 years. sAGEs ((ϵ)N-carboxymethyllysine, methylglyoxal) were markedly elevated in obese persons with more than one other MS criteria but not in obese without MS criteria. sAGEs directly correlated with markers of IR (HOMA) and inflammation (leptin, TNFα, RAGE) and inversely with innate defenses (SIRT1, AGE receptor 1 [AGER1], glyoxalase-I, adiponectin). sAGEs correlated with dAGEs but not with calories, nutrient consumption, or fat mass measures. Consumption of dAGE, but not of calories, was markedly higher in MS than in non-MS. High sAGEs, a modifiable risk factor for IR, may indicate risk for the MS, type 2 diabetes, and cardiovascular disease. High dietary AGE consumption and serum AGE levels may link healthy obesity to at-risk obesity.
Pukajło, Katarzyna; Łaczmański, Łukasz; Kolackov, Katarzyna; Kuliczkowska-Płaksej, Justyna; Bolanowski, Marek; Milewicz, Andrzej; Daroszewski, Jacek
2015-01-01
Irisin (Ir), a recently identified adipo-myokine, cleaved and secreted from the protein FNDC5 in response to physical activity, has been postulated to induce the differentiation of a subset of white adipocytes into brown fat and to mediate the beneficial effects on metabolic homeostasis. Metabolic syndrome (MS), a cluster of factors leading to impaired energy homeostasis, affects a significant proportion of subjects suffering from polycystic ovary syndrome (PCOS). The aim of our study was to investigate the relationship between Ir plasma concentrations and metabolic disturbances. The study group consisted of 179 PCOS patients and a population of 122 healthy controls (both groups aged 25-35 years). A subset of 90 subjects with MS was isolated. A positive association between Ir plasma level and MS in the whole group and in controls was found. In subjects with high adipose body content (>40%), Ir was higher than in lean persons (<30%). Our results showed a significant positive association between Ir concentration and android type of adipose tissue in the whole study group and in the control group. Understanding the role of Ir in increased energy expenditure may lead to the development of new therapeutics for obesity and obesity-related diseases.
Rifaximin Stability: A Look at UV, IR, HPLC, and Turbidimetry Methods.
Kogawa, Ana Carolina; Salgado, Hérida Regina Nunes
2018-03-01
The study of the stability of medicines is mandated by the International Conference on Harmonization and the World Health Organization. Rifaximin, an antimicrobial marketed in the form of tablets, has no record of stability studies. Thus, the objective of the present work was to investigate the behavior and stability of rifaximin tablets for 6 months under simultaneous conditions of temperature and humidity by UV, IR, HPLC, and turbidimetry techniques. After 6 months of stability study, rifaximin tablets were shown to obey zero-order kinetics when analyzed by physicochemical methods and second-order kinetics when analyzed by a microbiological method. However, the UV method was not suitable for the evaluation of rifaximin. IR, HPLC, and turbidimetry methods can already be used to evaluate the stability of rifaximin tablets. It is important to analyze products with more than one type of method before releasing results mainly in the case of antimicrobial products in which the association of physicochemical and microbiological techniques must be a rule. Rifaximin tablets can be considered stable after 6 months under conditions of 40 ± 2°C and 75 ± 5% relative humidity.
Experimental and theoretical studies on IR, Raman, and UV-Vis spectra of quinoline-7-carboxaldehyde.
Kumru, M; Küçük, V; Kocademir, M; Alfanda, H M; Altun, A; Sarı, L
2015-01-05
Spectroscopic properties of quinoline-7-carboxaldehyde (Q7C) have been studied in detail both experimentally and theoretically. The FT-IR (4000-50 cm(-1)), FT-Raman (4000-50 cm(-1)), dispersive-Raman (3500-50 cm(-1)), and UV-Vis (200-400 nm) spectra of Q7C were recorded at room temperature (25 °C). Geometry parameters, potential energy surface about CCH(O) bond, harmonic vibrational frequencies, IR and Raman intensities, UV-Vis spectrum, and thermodynamic characteristics (at 298.15K) of Q7C were computed at Hartree-Fock (HF) and density functional B3LYP levels employing the 6-311++G(d,p) basis set. Frontier molecular orbitals, molecular electrostatic potential, and Mulliken charge analyses of Q7C have also been performed. Q7C has two stable conformers that are energetically very close to each other with slight preference to the conformer that has oxygen atom of the aldehyde away from the nitrogen atom of the quinoline. Copyright © 2014 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Sarkar, Supratik; Bhattacharyay, A.
2017-09-01
Arising out of a nonlocal nonrelativistic Bose-Einstein condensates (BEC), we present an analogue gravity model up to O (ξ2) accuracy (ξ being the healing length of the condensate) in the presence of the quantum potential term for a canonical acoustic black hole in (3 +1 )D spacetime, where the series solution of the free minimally coupled KG equation for the large-length-scale massive scalar modes is derived. We systematically address the issues of the presence of the quantum potential term being the root cause of a UV-IR coupling between short-wavelength primary modes which are supposedly Hawking-radiated through the sonic horizon and the large-wavelength secondary modes. In the quantum gravity experiments of analogue Hawking radiation within the scope of the laboratory set up, this UV-IR coupling is inevitable, and one cannot get rid of these large-wavelength excitations which would grow over space by gaining energy from the short-wavelength Hawking-radiated modes. We identify the characteristic feature in the growth rate(s) that would distinguish these primary and secondary modes.
Medvedovici, Andrei; Albu, Florin; Naşcu-Briciu, Rodica Domnica; Sârbu, Costel
2014-02-01
Discrimination power evaluation of UV-Vis and (±) electrospray ionization/mass spectrometric techniques, (ESI-MS) individually considered or coupled as detectors to reversed phase liquid chromatography (RPLC) in the characterization of Ginkgo Biloba standardized extracts, is used in herbal medicines and/or dietary supplements with the help of Fuzzy hierarchical clustering (FHC). Seventeen batches of Ginkgo Biloba commercially available standardized extracts from seven manufacturers were measured during experiments. All extracts were within the criteria of the official monograph dedicated to dried refined and quantified Ginkgo extracts, in the European Pharmacopoeia. UV-Vis and (±) ESI-MS spectra of the bulk standardized extracts in methanol were acquired. Additionally, an RPLC separation based on a simple gradient elution profile was applied to the standardized extracts. Detection was made through monitoring UV absorption at 220 nm wavelength or the total ion current (TIC) produced through (±) ESI-MS analysis. FHC was applied to raw, centered and scaled data sets, for evaluating the discrimination power of the method with respect to the origins of the extracts and to the batch to batch variability. The discrimination power increases with the increase of the intrinsic selectivity of the spectral technique being used: UV-Vis
Kalpana, Duraisamy; Shim, Jae Hong; Oh, Byung-Taek; Senthil, Kalaiselvi; Lee, Yang Soo
2011-12-30
The present study was conducted to evaluate the decolorization and degradation of the chromium metal complex dye Isolan Dark Blue 2SGL-01 by Irpex lacteus, a white rot lignolytic fungus. I. lacteus effectively decolorized the sulphonated reactive dye at a high concentration of 250 mg/l over a wide range of pH values of 5-9 and temperatures between 20 and 35°C. Complete (100%) decolorization occurred within 96h, and I. lacteus demonstrated resistance to the metallic dye. UV-vis spectroscopy, HPLC, GC-MS, and FT-IR analyses of the extracted metabolites confirmed that the decolorization process occurred due to degradation of the dye and not merely by adsorption. GC-MS analysis indicated the formation of 1(2H)-naphthalenone, 3,4-dihydro- and 2-naphthalenol as the main metabolite. ICP analysis demonstrated the removal of 13.49% chromium, and phytotoxicity studies using germinated seeds of Vigna radiata and Brassica juncea demonstrated the nontoxic nature of the metabolites formed during the degradation of Isolan Dark Blue 2SGL-01 dye. Copyright © 2011 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Hussain, Naseer; Abbasi, Tasneem; Abbasi, S. A.
2016-06-01
In a first study of its kind, the composition of vermicompost derived solely from the toxic and allelopathic weed lantana has been investigated using UV-visible and Fourier transform infrared (FT-IR) spectroscopy, thermogravimetric (TG) and differential scanning calorimetry (DSC), gas chromatography-mass spectometry (GC-MS), and scanning electron microscopy (SEM). The studies reveal that a sharp reduction in humification index, substantial mineralization of organic matter and degradation of complex aromatics such as lignin and polyphenols into simpler carbohydrates and lipids occur in the course of vermicomposting. GC-MS analysis shows significant fragmentation, bio-oxidation and molecular rearrangements of chemical compounds in vermicompost in comparison to those in lantana. SEM micrographs of vermicompost reflect strong disaggregation of material compared to the much better formed lantana matrices. The phenols and sesquiterpene lactones which are specifically responsible for the toxicity and allelopathy of lantana are seen to get significantly degraded in the course of vermicomposting - turning it into a plant-friendly organic fertilizer. The study leads to the possibility that the millions of tons of phytomass that is generated annually by lantana can be gainfully utilized in producing organic fertilizer via vermicomposting.
Wang, Chengjian; Lu, Yu; Han, Jianli; Jin, Wanjun; Li, Lingmei; Zhang, Ying; Song, Xuezheng; Huang, Linjuan; Wang, Zhongfu
2018-05-24
Most glycoproteins and biological protein samples undergo both O- and N-glycosylation, making characterization of their structures very complicated and time-consuming. Nevertheless, to fully understand the biological functions of glycosylation, both the glycosylation forms need to be analyzed. Herein we report a versatile, convenient one-pot method in which O- and N-glycans are simultaneously released from glycoproteins and chromogenically labeled in situ and thus available for further characterization. In this procedure, glycoproteins are incubated with 1-phenyl-3-methyl-5-pyrazolone (PMP) in aqueous ammonium hydroxide, making O-glycans released from protein backbones by β-elimination and N-glycans liberated by alkaline hydrolysis. The released glycans are promptly derivatized with PMP in situ by Knoevenagel condensation and Michael addition, with peeling degradation almost completely prevented. The recovered mixture of O- and N-glycans as bis-PMP derivatives features strong ultraviolet (UV) absorbing ability and hydrophobicity, allowing for high-resolution chromatographic separation and high-sensitivity spectrometric detection. Using this technique, O- and N-glycans were simultaneously prepared from some model glycoproteins and complex biological samples, without significant peeling, desialylation, deacetylation, desulfation or other side-reactions, and then comprehensively analyzed by online HILIC-UV-ESI-MS/MS and RP-HPLC-UV-ESI-MS/MS, with which some novel O- and N-glycan structures were first found. This method provides a simple, versatile strategy for high-throughput glycomics analysis.
UV-Visible reflectance of Phobos from SPICAM and OMEGA and comparison with Deimos
NASA Astrophysics Data System (ADS)
Gondet, Brigitte; Bertaux, Jean-Loup; Montmessin, Franck; Reberarc, Aurelie
2016-04-01
Mars Express made several encounters with Phobos and a few with Deimos since 2004. Observations with SPICAM and OMEGA imaging spectrometers on board Mars Express covers the range from UV (110-312 nm) to visible and mid IR up to 5 μm. In the following we consider the ultraviolet (UV) channel of SPICAM and only the visible channel of OMEGA and its small UV extension down to 390 nm, in order to compare with SPICAM. Preliminary results were presented already in the past [1]. Since then, a more detailed analysis was carried out, subtracting some internally scattered light affecting the SPICAM UV retrieved reflectance. The combined spectrum of Radiance Factor from SPICAM and OMEGA suggests the presence of a deep absorption feature. Both instruments, taken separately, support also this absorption feature. In the visible part of CRISM [2] on board MRO, one feature is centered at 0.65 μm, with an absorption depth varying from 0 to 4%, an other one is centered at 2.8μm. These two Visible IR features were interpreted [2] either to highly desiccated Fe-phyllosilicate minerals indigenous to the bodies, or to a surface process involving Rayleigh scattering and absorption of small iron particles formed by exogenic space weathering processing. In this rather uncertain situation, the UV band detected by SPICAM and OMEGA on board Mars Express is of great importance to attempt discriminating between the two scenarios proposed above to explain the Visible-IR reflectance spectra of Phobos. [1] Bertaux J.L. et al. (2011) EPSC/DPS conference abstract, Nantes, November 2011, [5] Freaman A.A. et al. (2014) Icarus, 229 , 196-205.
The relationship between IR, optical, and UV extinction
NASA Technical Reports Server (NTRS)
Cardelli, Jason A.; Clayton, Geoffrey C.; Mathis, John S.
1989-01-01
An analysis is presented for the variability of absolute IR, optical, and UV extinction, A(sub lambda), derived through the ratio of total-to-selective extinction, R, for 31 lines of sight for which reliable UV extinction parameters were derived. These data sample a wide range of environments and are characterized by 2.5 is less than or equal to R is less than or equal to 6.0. It was found that there is a strong linear dependence between extinction expressed as A(sub lambda)/A(sub V) and 1/R for 1.25 micron is less than or equal to lambda is less than or equal to 0.12 micron. Differences in the general shape of extinction curves are largely due to variations in shape of optical/near-UV extinction corresponding to changes in R, with A(sub lambda)/A(sub V) decreasing for increasing R. From a least-squares fit of the observed R-dependence as a function of wavelength for 0.8/micron is less than or greater than 1/lambda is less than or equal to 8.3/micron, an analytic expression was generated from which IR, optical, and UV extinction curves of the form A(sub lambda)/A(sub V) can be reproduced with reasonable accuracy from a knowledge of R. It was also found that the absolute bump strength normalized to A(sub V) shows a general decrease with increasing R, suggesting that some fraction of bump grains may be selectively incorporated into coagulated grains. Finally, it was found that absolute extinction normalized by suitably chosen color indices results in a minimization of the R-dependence of portions of the UV curve, allowing A(sub lambda) to be estimated for these wavelengths independent of R.
Yamakata, Akira; Yoshida, Masaaki; Kubota, Jun; Osawa, Masatoshi; Domen, Kazunari
2011-07-27
Recombination kinetics of photogenerated electrons in n-type and p-type GaN photoelectrodes active for H(2) and O(2) evolution, respectively, from water was examined by time-resolved IR absorption (TR-IR) spectroscopy. Illumination of a GaN film with UV pulse (355 nm and 6 ns in duration) gives transient interference spectra in both transmittance and reflection modes. Simulation shows that the interference spectra are caused by photogenerated electrons. We observed that recombination in the microsecond region is greatly affected by the applied potentials, the lifetime becoming longer at negative and positive potentials for n- and p-type GaN electrodes, respectively. There is a good correlation between potential dependence of the steady-state reaction efficiency and that of the number of surviving electrons in the millisecond region. We also performed potential jump measurement to examine the shift in Fermi level by photogenerated charge carriers. In the case of n-type GaN, the electrode potential jumps to the negative side by accumulation of electrons in the bulk. However, in the case of p-type GaN, the electrode potential first jumps to the negative side within 20 μs and gradually shifts to the positive side in a few milliseconds, while the number of charge carriers is constant at >0.2 ms. This two-step process is ascribed to electron transport from the bulk to the surface of GaN, because the electrode potential is sensitive to the number of electrons in the bulk. The results confirm that TR-IR combined with potential jump measurement provides useful information for understanding the behavior of charge carriers in photoelectrochemical systems.
Required technologies for a lunar optical UV-IR synthesis array
NASA Technical Reports Server (NTRS)
Johnson, Stewart W.; Wetzel, John P.
1992-01-01
A Lunar Optical UV-IR Synthesis Array (LOUISA) proposed to take advantage of the characteristics of the lunar environment requires appropriate advances in technology. These technologies are in the areas of contamination/interference control, test and evaluation, manufacturing, construction, autonomous operations and maintenance, power and heating/cooling, stable precision structures, optics, parabolic antennas, and communications/control. LOUISA needs to be engineered to operate for long periods with minimal intervention by humans or robots. What is essential for LOUISA operation is enforcement of a systems engineering approach that makes compatible all lunar operations associated with habitation, resource development, and science.
Generation of radicals in hard biological tissues under the action of laser radiation
NASA Astrophysics Data System (ADS)
Sviridov, Alexander P.; Bagratashvili, Victor N.; Sobol, Emil N.; Omelchenko, Alexander I.; Lunina, Elena V.; Zhitnev, Yurii N.; Markaryan, Galina L.; Lunin, Valerii V.
2002-07-01
The formation of radicals upon UV and IR laser irradiation of some biological tissues and their components was studied by the EPR technique. The radical decay kinetics in body tissue specimens after their irradiation with UV light were described by various models. By the spin trapping technique, it was shown that radicals were not produced during IR laser irradiation of cartilaginous tissue. A change in optical absorption spectra and the dynamics of optical density of cartilaginous tissue, fish scale, and a collagen film under exposure to laser radiation in an air, oxygen, and nitrogen atmosphere was studied.
NASA Astrophysics Data System (ADS)
Jha, Animesh
2006-12-01
In the review article we explain the recent investigations on rare-earth doped glass and optical fibres for designing lasers which may be suitable for remote sensing and LIDAR applications. The paper explains the importance of engineering efficient lasing transitions in visible (480-650 nm) for generating UV lasers via one-stage harmonic generation. Besides visible transitions, we also demonstrate the transitions in near- and mid-IR via near-IR pumping scheme.
Solar Spectral Irradiance Variations in 240 - 1600 nm During the Recent Solar Cycles 21 - 23
NASA Astrophysics Data System (ADS)
Pagaran, J.; Weber, M.; Deland, M. T.; Floyd, L. E.; Burrows, J. P.
2011-08-01
Regular solar spectral irradiance (SSI) observations from space that simultaneously cover the UV, visible (vis), and the near-IR (NIR) spectral region began with SCIAMACHY aboard ENVISAT in August 2002. Up to now, these direct observations cover less than a decade. In order for these SSI measurements to be useful in assessing the role of the Sun in climate change, records covering more than an eleven-year solar cycle are required. By using our recently developed empirical SCIA proxy model, we reconstruct daily SSI values over several decades by using solar proxies scaled to short-term SCIAMACHY solar irradiance observations to describe decadal irradiance changes. These calculations are compared to existing solar data: the UV data from SUSIM/UARS, from the DeLand & Cebula satellite composite, and the SIP model (S2K+VUV2002); and UV-vis-IR data from the NRLSSI and SATIRE models, and SIM/SORCE measurements. The mean SSI of the latter models show good agreement (less than 5%) in the vis regions over three decades while larger disagreements (10 - 20%) are found in the UV and IR regions. Between minima and maxima of Solar Cycles 21, 22, and 23, the inferred SSI variability from the SCIA proxy is intermediate between SATIRE and NRLSSI in the UV. While the DeLand & Cebula composite provide the highest variability between solar minimum and maximum, the SIP/Solar2000 and NRLSSI models show minimum variability, which may be due to the use of a single proxy in the modeling of the irradiances. In the vis-IR spectral region, the SCIA proxy model reports lower values in the changes from solar maximum to minimum, which may be attributed to overestimations of the sunspot proxy used in modeling the SCIAMACHY irradiances. The fairly short timeseries of SIM/SORCE shows a steeper decreasing (increasing) trend in the UV (vis) than the other data during the descending phase of Solar Cycle 23. Though considered to be only provisional, the opposite trend seen in the visible SIM data challenges the validity of proxy-based linear extrapolation commonly used in reconstructing past irradiances.
Multispectral Observations of Explosive Gas Emissions from Santiaguito, Guatemala
NASA Astrophysics Data System (ADS)
Carn, S. A.; Watson, M.; Thomas, H.; Rodriguez, L. A.; Campion, R.; Prata, F. J.
2016-12-01
Santiaguito volcano, Guatemala, has been persistently active for decades, producing frequent explosions from its actively growing lava dome. Repeated release of volcanic gases contains information about conduit processes during the cyclical explosions at Santiaguito, but the composition of the gas phase and the amount of volatiles released in each explosion remains poorly constrained. In addition to its persistent activity, Santiaguito offers an exceptional opportunity to investigate lava dome degassing processes since the upper surface of the active lava dome can be viewed from the summit of neighboring Santa Maria. In January 2016 we conducted multi-spectral observations of Santiaguito's explosive eruption plumes and passive degassing from multiple perspectives as part of the first NSF-sponsored `Workshop on Volcanoes' instrument deployment. Gas measurements included open-path Fourier-Transform infrared (OP-FTIR) spectroscopy from the Santa Maria summit, coincident with ultraviolet (UV) and infrared (IR) camera and UV Differential Optical Absorption Spectroscopy (DOAS) from the El Mirador site below Santiaguito's active Caliente lava dome. Using the OP-FTIR in passive mode with the Caliente lava dome as the source of IR radiation, we were able to collect IR spectra at high temporal resolution prior to and during two explosions of Santiaguito on 7-8 January, with volcanic SO2 and H2O emissions detected. UV and IR camera data provide constraints on the total SO2 burden in the emissions (and potentially the volcanic ash burden), which coupled with the FTIR gas ratios provides new constraints on the mass and composition of volatiles driving explosions at Santiaguito. All gas measurements indicate significant volatile release during explosions with limited degassing during repose periods. In this presentation we will present ongoing analysis of the unique Santiaguito gas dataset including estimation of the total volatile mass released in explosions and an intercomparison of SO2 amounts recorded by the UV and IR instruments.
Zn2+ -Ion Sensing by Fluorescent Schiff Base Calix[4]arene Macrocycles.
Ullmann, Steve; Schnorr, René; Handke, Marcel; Laube, Christian; Abel, Bernd; Matysik, Jörg; Findeisen, Matthias; Rüger, Robert; Heine, Thomas; Kersting, Berthold
2017-03-17
A macrocyclic ligand (H 2 L) containing two o,o'-bis(iminomethyl)phenol and two calix[4]arene head units has been synthesized and its coordination chemistry towards divalent Ni and Zn investigated. The new macrocycle forms complexes of composition [ML] (M=Zn, M=Ni) and [ZnL(py) 2 ], which were characterized by elemental analysis; IR, UV/Vis, and NMR spectroscopy; electrospray ionization mass spectrometry (ESI-MS); and X-ray crystallography (for [ZnL(py) 2 ] and [NiL]). H 2 L allows the sensitive optical detection of Zn 2+ among a series of biologically relevant metal ions by a dual fluorescence enhancement/quenching effect in solution. The fluorescence intensity of the macrocycle increases by a factor of ten in the presence of Zn 2+ with a detection limit in the lower nanomolar region. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
[Effect of gene disruption of aveD on avermectins production in Streptomyces avermitilis].
Chen, Z; Song, Y; Wen, Y; Li, J
2001-08-01
Recombinant plasmid pCZ2(pKC1139::475 bp aveD) was used for aveD gene disruption in Streptomyces avermitilis 76-9. The plasmid was inserted into the chromosome by homogenous recombination between partial aveD gene in the plasmid and aveD in the chromosome. Disruptants were confirmed by Southern blotting. Shaking flask experiments and HPLC analysis showed that the disruptant produced only four components, which were C5-oxo-avermectin B1a, B1b, B2a, B2b as identified by UV, IR, NMR, and MS. This revealed that both aveD and aveF were not expressed in the disruptant. This is consistent with that aveD and aveF are in a transcription unit. This paper also provided a new genetic method to obtain C5-oxo-avermectin B-producing strain.
Tang, Hui-Ling; Sun, Cheng-Hang; Hu, Xin-Xin; You, Xue-Fu; Wang, Min; Liu, Shao-Wei
2016-11-23
Two new amicoumacins, named Damxungmacin A ( 1 ) and B ( 2 ), were isolated from the culture broth of a soil-derived bacterium Bacillus subtilis XZ-7. Their chemical structures were elucidated by spectroscopic studies (UV, IR, NMR and HR-ESI-MS). Compound 1 possessed a 1,4-diazabicyclo[2.2.1]heptane-2-one ring system in its structure, which was reported for the first time, while 2 had a 1-acetylmorpholine-3-one moiety, which was naturally rare. Compound 1 exhibited moderate to weak cytotoxic activities against three human tumor cell lines (A549, HCT116 and HepG2) with IC 50 values of 13.33, 14.34 and 13.64 μM, respectively. Meanwhile, compound 1 showed weak antibacterial activities against some strains of Staphylococcus epidermidis , while compound 2 at 16 μg/mL did not show antibacterial activity.
Ultrafast third-order nonlinear optical response of pyrene derivatives
NASA Astrophysics Data System (ADS)
Shi, Yufang; Li, Zhongguo; Fang, Yu; Sun, Jinyu; Zhao, Minggen; Song, Yinglin
2017-05-01
Two mono-substituted pyrene derivatives with delocalized electron system 1-(pyren-1-yl)-3-(4-Methyl thiophene-2-yl) acrylic ketone (13#) and 1-(pyren-1-yl)-3-(4-bromo thiophene-2-yl) acrylic ketone (15#) were successfully synthesized. The resultant compounds were characterized by nuclear magnetic resonance (NMR), infrared spectroscopy (IR), high resolution mass spectrum (HR-MS), and UV-vis spectra. The third-order nonlinear optical properties of the compounds were investigated using Z-scan technique with femtosecond laser pulses at 500 nm and 700 nm, respectively. Both of the compounds showed a decrease in transmittance about the focus, which are typical of two-photon absorption. It was found that the two-photon absorption behavior of the pyrene derivatives were modified by substituents on thiophene ring. These results indicate that both compounds can be promising candidates for future optoelectronic and bio-imaging applications.
Single-photon and two-photon excited fluorescence behavior of a novel fluorene-based compound
NASA Astrophysics Data System (ADS)
Ma, Wenbo; Wu, Yiquan; Gu, Donghong; Gan, Fuxi
2005-09-01
A D-π-D type compound, 2,7-bis(4-methoxystyryl)-9,9-bis(2-ethylhexyl)-9H-fluorene (abbreviated as MO-Flu-MO), where electron-donor D is methoxy group andπis fluorene unit, has been synthesized. The molecular structures of the compound were characterized by elemental analyses, EI-MS and FT-IR spectra. UV-Vis spectra in the region 230--1000 nm and single-photon excited fluorescence in tetrahydrofuran (THF) of the compound were measured. It is found that the new compound exhibits strong two-photon excited fluorescence in the region 380--500 nm and moderate two-photon absorption (TPA) value in the femtoseconds regime (TPA cross-section as high as 55×10-50 cm4 s photon-1 with 13fs laser pulses). The results demonstrate that the compound is a promising candidate for two-photon three-dimensional (3D) optical data storage.
A novel two-level dielectric barrier discharge reactor for methyl orange degradation.
Tao, Xumei; Wang, Guowei; Huang, Liang; Ye, Qingguo; Xu, Dongyan
2016-12-15
A novel pilot two-level dielectric barrier discharge (DBD) reactor has been proposed and applied for degradation of continuous model wastewater. The two-level DBD reactor was skillfully realized with high space utilization efficiency and large contact area between plasma and wastewater. Various conditions such as applied voltage, initial concentration and initial pH value on methyl orange (MO) model wastewater degradation were investigated. The results showed that the appropriate applied voltage was 13.4 kV; low initial concentration and low initial pH value were conducive for MO degradation. The percentage removal of 4 L MO with concentration of 80 mg/L reached 94.1% after plasma treatment for 80min. Based on ultraviolet spectrum (UV), Infrared spectrum (IR), liquid chromatography-mass spectrometry (LC-MS) analysis of degradation intermediates and products, insights in the degradation pathway of MO were proposed. Copyright © 2016 Elsevier Ltd. All rights reserved.
Pastuszko, Adam; Majchrzak, Kinga; Czyz, Malgorzata; Kupcewicz, Bogumiła; Budzisz, Elzbieta
2016-06-01
A series of arene ruthenium(II) complexes with the general formula [(η(6)-arene)Ru(L)X2] (where arene=p-cymene, benzene, hexamethylbenzene or mesitylene, L=aminoflavone or aminochromone derivatives and X=Cl, I) were synthesized and characterized by elemental analysis, MS, IR and (1)H NMR spectroscopy. The stability of the selected complexes was assessed by UV-Vis spectroscopy in 24-hour period. The lipophilicity of the synthesized complexes was determined by the shake-flask method, and their cytotoxicity evaluated in vitro on patient-derived melanoma populations. The most active complexes against melanoma cells contain 7-aminoflavone and 6-aminoflavone as a ligand. The relationship between the cytotoxicity of all the obtained compounds and their logP values was determined and briefly analyzed with two different patterns observed. Copyright © 2016 Elsevier Inc. All rights reserved.
Wang, Xiquan; Gong, Xiaokang; Zhang, Qiuxia; Du, Haijuan
2013-12-01
The Direct Pink 12B dye was treated by iron-carbon micro-electrolysis (ICME) and Fenton oxidation. The degradation pathway of Direct Pink 12B dye was inferred by ultraviolet visible (UV-Vis), infrared absorption spectrum (IR) and high performance liquid chromatography-mass spectrometry (HPLC-MS). The major reason of decolorization was that the conjugate structure was disrupted in the iron-carbon micro-electrolysis (ICME) process. However, the dye was not degraded completely because benzene rings and naphthalene rings were not broken. In the Fenton oxidation process, the azo bond groups surrounded by higher electron cloud density were first attacked by hydroxyl radicals to decolorize the dye molecule. Finally benzene rings and naphthalene rings were mineralized to H2O and CO2 under the oxidation of hydroxyl radicals. Copyright © 2013 The Research Centre for Eco-Environmental Sciences, Chinese Academy of Sciences. Published by Elsevier B.V. All rights reserved.
Bioactive compounds from Rhodiola rosea (Crassulaceae).
Ming, Dong Sheng; Hillhouse, Brian J; Guns, Emma S; Eberding, Andy; Xie, Sherwin; Vimalanathan, Selvarani; Towers, G H Neil
2005-09-01
The methanol extract of the underground part of Rhodiola rosea was found to show inhibitory activity against Staphylococcus aureus. Bioactivity-guided fractionation of a 95% ethanol extract from the stems of R. rosea led to the isolation of five compounds: gossypetin-7-O-L-rhamnopyranoside (1), rhodioflavonoside (2), gallic acid (3), trans-p-hydroxycinnamic acid (4) and p-tyrosol (5). Their structures were elucidated by UV, IR, MS and NMR data, as well as by comparison with those of the literature. Compounds 1 and 2 were evaluated for their antibacterial and antiprostate cancer cell activities. Compounds 1 and 2 exhibited activity against Staphylococcus aureus with minimum inhibitory concentrations of 50 microg/mL and 100 microg/mL, respectively. Cytotoxicity studies of 1 and 2 also displayed activity against the prostate cancer cell line with IC(50) values of 50 microg/mL and 80 microg/mL, respectively. Copyright 2005 John Wiley & Sons, Ltd.
NASA Astrophysics Data System (ADS)
Alsalme, Ali; Laeeq, Sameen; Dwivedi, Sourabh; Khan, Mohd. Shahnawaz; Al Farhan, Khalid; Musarrat, Javed; Khan, Rais Ahmad
2016-06-01
We have synthesized two new complexes of platinum (1) and ruthenium (2) with α-amino acid, L-alanine, and 2,3-dihydroxybenzaldehyde derived Schiff base (L). The ligand and both complexes were characterized by using elemental analysis and several other spectroscopic techniques viz; IR, 1H, 13C NMR, EPR, and ESI-MS. Furthermore, the protein-binding ability of synthesized complexes was monitored by UV-visible, fluorescence and circular dichroism techniques with a model protein, human serum albumin (HSA). Both the PtL2 and RuL2 complexes displayed significant binding towards HSA. Also, in vitro cytotoxicity assay for both complexes was carried out on human hepatocellular carcinoma cancer (HepG2) cell line. The results showed concentration-dependent inhibition of cell viability. Moreover, the generation of reactive oxygen species was also evaluated, and results exhibited substantial role in cytotoxicity.
Hepatoprotective activity of twelve novel 7'-hydroxy lignan glucosides from Arctii Fructus.
Yang, Ya-Nan; Huang, Xiao-Ying; Feng, Zi-Ming; Jiang, Jian-Shuang; Zhang, Pei-Cheng
2014-09-17
Twelve novel 7'-hydroxy lignan glucosides (1-12), including two benzofuran-type neolignans, two 8-O-4' neolignans, two dibenzylbutyrolactone lignans, and six tetrahydrofuranoid lignans, together with six known lignan glucosides (13-18), were isolated from the fruit of Arctium lappa L. (Asteraceae), commonly known as Arctii Fructus. Their structures were elucidated using spectroscopy (1D and 2D NMR, MS, IR, ORD, and UV) and on the basis of chemical evidence. The absolute configurations of compounds 1-12 were confirmed using rotating frame nuclear overhauser effect spectroscopy (ROESY), the circular dichroic (CD) exciton chirality method, and Rh2(OCOCF3)4-induced CD spectrum analysis. All of the isolated compounds were tested for hepatoprotective effects against D-galactosamine-induced cytotoxicity in HL-7702 hepatic cells. Compounds 1, 2, 7-12, and 17 showed significantly stronger hepatoprotective activity than the positive control bicyclol at a concentration of 1 × 10(-5) M.
Four new neolignan glucosides from the fruits of Arctium lappa.
Huang, Xiao-Ying; Feng, Zi-Ming; Yang, Ya-Nan; Jiang, Jian-Shuang; Zhang, Pei-Cheng
2015-05-01
Four new neolignan glucosides named (7S, 8R)-4,7,9,9'-tetrahydroxy-3,3'-dimethoxy-8-O-4'-neolignan-9'-O-β-d-apiofuranosyl-(1 → 6)-O-β-d-glucopyranoside (1), (8R)-4,9,9'-trihydroxy-3,3'-dimethoxy-7-oxo-8-O-4'-neolignan-4-O-β-d-glucopyranoside (2), (7R, 8S)-dihydrodehydrodiconiferyl alcohol-7'-oxo-4-O-β-d-glucopyranoside (3), and (7'S, 8'R, 8S)-4,4',9'-trihydroxy-3,3'-dimethoxy-7',9-epoxylignan-7-oxo-4-O-β-d-glucopyranoside (4) were isolated from the fruits of Arctium lappa L. Their structures and absolute configurations were elucidated on the basis of comprehensive spectroscopic analyses (UV, IR, HR-ESI-MS, 1D and 2D NMR, CD), as well as by comparison with known analogues in the literature.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Oezay, H.; Yildiz, M., E-mail: myildiz@comu.edu.tr; Uenver, H.
2013-01-15
The compound called 3-methoxy-2- [(2,4,4,6,6-pentachloro-1,3,5,2{lambda}{sup 5},4{lambda}{sup 5},6{lambda}{sup 5}-triazatriphosphin-2-yl)oxy] benzaldehyde has been synthesized from the reaction of 2-hydroxy-3-methoxybenzaldehyde with hexachlorocyclotriphosphazene. It has been characterized by elemental analysis, MS, IR, {sup 1}H NMR, {sup 13}C NMR, {sup 31}P NMR and UV-visible spectroscopic techniques. The structure of the title compound has been determind by X-ray analysis. Crystals are orthorhombic, space group P2{sub 1}2{sub 1}2{sub 1}, Z = 4, a = 7.705(1), b = 12.624(1), c = 17.825(2) A, R{sub 1} = 0.0390 and wR{sub 2} = 0.1074 [I > 2{sigma}(I)], respectively.
OXIDANT FORMATION IN THE GENERATION OF OZONE
Ozone samples generated by UV photolysis and silent electric discharge upon air or oxygen were examined to determine if other oxidants were formed. Chemical and physical methods (IR and UV spectroscopy) failed to show the presence of such oxidants. Absence of such oxidants was al...
NASA Technical Reports Server (NTRS)
Chandra, S.; Mcpeters, R. D.; Srivastava, D. N.
1986-01-01
The spatial and temporal characteristics of ozone density measured from the SBUV (Solar Backscatter Ultraviolet) spectrometer on Nimbus-7 and the UV and the UV and the IR spectrometers on SME (Solar Mesosphere Explorer) are compared in the altitude region near 50 km where the three data sets overlap. Their temporal characteristics, when averaged over the same longitude range, are remarkably similar with respect to seasonal variations and short term fluctuations induced by transient planetary waves. The long term trends in the three data sets, however, differ significantly with each other. Over the three year period after 1982 ozone mixing ratio at 1 mb decreased by about 10 percent based on SEUV measurements but increased by 12 and 30 percent respectively based on SME-IR and SME-UV measurements. None of these estimates are consistent with the predicted decrease of about 2 percent based on solar UV flux and temperature changes during this period.
77 FR 67282 - Dinotefuran; Pesticide Tolerances for Emergency Exemptions
Federal Register 2010, 2011, 2012, 2013, 2014
2012-11-09
... performance liquid chromatography/tandem mass spectrometry (HPLC/MS/MS) method is available. For the determination of residues of dinotefuran only, an HPLC/ultraviolet (UV) detection method is available. For the determination of only the metabolites (DN and UF), HPLC/MS and HPLC/MS/MS methods are available. These methods...
Alemzadeh, Ramin; Kichler, Jessica; Calhoun, Mariaelena
2010-06-01
Polycystic ovary syndrome (PCOS) in adult women is associated with increased risk of metabolic syndrome (MS) and atherosclerosis. We evaluated the spectrum of metabolic dysfunction in relationship with hyperandrogenemia (HA) in adolescent girls with PCOS. Ovulatory function, acne, hirsutism (HS), body mass index (BMI), body composition, fasting lipids, glucose, insulin, free testosterone (FT), high-sensitivity C-reactive protein (hs-CRP), and HbA1c were evaluated in 103 girls. The homeostatic assessment model equations (HOMA-IR and HOMA-%B) were used for determination of insulin resistance and beta-cell function respectively. The oligo-ovulation (Oligo)+HA+HS (n=44), Oligo+HA (n=28), and Oligo+HS (n=31) phenotypes had similar BMI. However, hyperandrogenemic phenotypes had higher prevalence of acanthosis nigricans (AN) and acne (P<0.01) and higher insulin, HOMA-IR, HOMA-%B, HbA1c, and hs-CRP levels than Oligo+HS group (P<0.01). Serum FT was correlated with HOMA-IR (r=0.38, P<0.01), HOMA-%B (r=0.49, P<0.01), hs-CRP (r=0.42, P<0.01), AN (r=0.39, P<0.01), and HbA1c (r=0.27, P<0.01). Furthermore, 34% of girls met diagnostic criteria for MS displaying higher BMI, FT, HOMA-%B, HOMA-IR, hs-CRP, and HbA1c than subjects without MS (P<0.01). Using combined HOMA-IR>or=4.0 and hs-CRP>3.0 cut-off values, 71.4% of MS versus 23.5% non-MS group were considered at risk of diabetes and atherosclerosis (P<0.0001). Hyperandrogenemic PCOS phenotypes have greatest degree of insulin resistance and inflammation. The use of insulin resistance and inflammatory markers may help identify adolescent girls with PCOS at risk of cardiometabolic syndrome.
Steinhardt, Alberto Penas; Aranguren, Florencia; Tellechea, Mariana L; Gómez Rosso, Leonardo A; Brites, Fernando D; Martínez-Larrad, Maria T; Serrano-Ríos, Manuel; Frechtel, Gustavo D; Taverna, Mariano J
2010-05-01
Toll-like receptor 4 (TLR4) plays a key role in the activation of innate immune responses. Loss-of-function mutations in TLR4 prevent diet-induced obesity and insulin resistance (IR). We conducted a population cross-sectional study to evaluate whether Asp299Gly (rs4986790) TLR4 gene polymorphism is associated with metabolic syndrome (MS), surrogates of IR, and syndromes of lipid accumulation (SLAs) in Argentinean healthy male subjects. rs4986790 was genotyped in 621 healthy unrelated male blood donors. National Cholesterol Education Program/Adult Treatment Panel III-MS (NCEP/ATP III-MS); SLAs such as enlarged waist elevated triglyceride syndrome (EWET), hypertriglyceridemic waist (HW), and overweight-lipid syndrome (OLS); and surrogates of IR were assessed. The prevalence of MS, OLS, and EWET was significantly higher among Asp299Asp carriers (P < .05). These findings were confirmed using 32 000 bootstrap samples. Surrogate markers of IR were also significantly higher in Asp299Asp carriers (P < .05). Most findings were especially strengthened among individuals with C-reactive protein below the 95th percentile and/or total cholesterol to high-density lipoprotein cholesterol ratio >or=5. This is the first report to find, in Argentinean healthy male blood donors, associations between the Asp299Asp genotype of rs4986790 TLR4 gene polymorphism and high risk for NCEP/ATP III-MS, SLAs, and surrogates of IR. These findings are consistent with previous functional and observational studies showing that Asp299 allele, in comparison with Gly299, is associated with increased TLR4 activation, higher levels of inflammatory cytokines, acute-phase reactants and soluble adhesion molecules, and higher risk of atherosclerosis.
Monge, María Eugenia; Negri, R Martín; Kolender, Adriana A; Erra-Balsells, Rosa
2007-01-01
The successful analysis by ultraviolet matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (UV-MALDI-TOF MS) of native and hydrolyzed high-methoxylated pectin samples is described. In order to find the optimal conditions for UV-MALDI-TOF MS analysis several experimental variables were studied such as: different UV-MALDI matrices (nor-harmane, 2,5-dihydroxybenzoic acid), sample preparation methods (mixture, sandwich), inorganic salt addition (doping salts, NaCl, KCl, NH(4)Cl), ion mode (positive, negative), linear and reflectron mode, etc. nor-Harmane has never been used as a UV-MALDI matrix for the analysis of pectins but its use avoids pre-treatment of the sample, such as an enzymatic digestion or an acid hydrolysis, and there is no need to add salts, making the analysis easier and faster. This study suggested an alternative way of analyzing native high-methoxylated pectins, with UV-MALDI-TOF MS, by using nor-harmane as the matrix in negative ion mode. The analysis by (1)H and (13)C nuclear magnetic resonance (NMR) spectroscopy of the native and hydrolyzed pectin is also briefly described. Copyright (c) 2007 John Wiley & Sons, Ltd.
NASA Astrophysics Data System (ADS)
Eufrasio, R. T.; Lehmer, B. D.; Zezas, A.; Dwek, E.; Arendt, R. G.; Basu-Zych, A.; Wiklind, T.; Yukita, M.; Fragos, T.; Hornschemeier, A. E.; Markwardt, L.; Ptak, A.; Tzanavaris, P.
2017-12-01
We present LIGHTNING, a new spectral energy distribution fitting procedure, capable of quickly and reliably recovering star formation history (SFH) and extinction parameters. The SFH is modeled as discrete steps in time. In this work, we assumed lookback times of 0-10 Myr, 10-100 Myr, 0.1-1 Gyr, 1-5 Gyr, and 5-13.6 Gyr. LIGHTNING consists of a fully vectorized inversion algorithm to determine SFH step intensities and combines this with a grid-based approach to determine three extinction parameters. We apply our procedure to the extensive far-UV-to-far-IR photometric data of M51, convolved to a common spatial resolution and pixel scale, and make the resulting maps publicly available. We recover, for M51a, a peak star formation rate (SFR) between 0.1 and 5 Gyr ago, with much lower star formation activity over the past 100 Myr. For M51b, we find a declining SFR toward the present day. In the outskirt regions of M51a, which includes regions between M51a and M51b, we recover an SFR peak between 0.1 and 1 Gyr ago, which corresponds to the effects of the interaction between M51a and M51b. We utilize our results to (1) illustrate how UV+IR hybrid SFR laws vary across M51 and (2) provide first-order estimates for how the IR luminosity per unit stellar mass varies as a function of the stellar age. From the latter result, we find that IR emission from dust heated by stars is not always associated with young stars and that the IR emission from M51b is primarily powered by stars older than 5 Gyr.
Sheth, Vipul R.; Fan, Shujuan; He, Qun; Ma, Yajun; Annesse, Jacopo; Switzer, Robert; Corey-Bloom, Jody; Bydder, Graeme M; Du, Jiang
2017-01-01
Multiple sclerosis (MS)causes demyelinating lesions in the white matter and increased iron deposition in the subcortical gray matter. Myelin protons have an extremely short T2* (less than 1 ms) and are not directly detected with conventional clinical magnetic resonance (MR) imaging sequences. Iron deposition also reduces T2*, leading to reduced signal on clinical sequences. In this study we tested the hypothesis that the inversion recovery ultrashort echo time (IR-UTE) pulse sequence can directly and simultaneously image myelin and iron deposition using a clinical 3T scanner. The technique was first validated on a synthetic myelinphantom (myelin powder in D2O) and a Feridex iron phantom. This was followed by studies of cadaveric MS specimens, healthy volunteers and MS patients. UTE imaging of the synthetic myelin phantom showed an excellent bi-component signal decay with two populations of protons, one with a T2* of 1.2 ms (residual water protons) and the other with a T2* of 290 μs (myelin protons). IR-UTE imaging shows sensitivity to a wide range of iron concentrations from 0.5 to ∼30 mM. The IR-UTE signal from white matter of the brain of healthy volunteers shows a rapid signal decay with a short T2* of ∼300 μs, consistent with the T2* values of myelin protons in the synthetic myelin phantom. IR-UTE imaging in MS brain specimens and patients showed multiple white matter lesions as well as areas of high signal in subcortical gray matter. This in specimens corresponded in position to Perl's diaminobenzide staining results, consistent with increased iron deposition. IR-UTE imaging simultaneously detects lesions with myelin loss in the white matter and iron deposition in the gray matter. PMID:28038965
Photochemical isomerizations of thiosemicarbazide, a matrix isolation study.
Rostkowska, Hanna; Lapinski, Leszek; Kozankiewicz, Boleslaw; Nowak, Maciej J
2012-10-11
Two thione conformers of monomeric thiosemicarbazide were trapped from the gas phase into a low-temperature Ar matrix. A phototransformation converting the less stable form of the compound into the most stable conformer was induced by irradiation with near-IR (λ = 1462 nm) or UV (λ > 320 nm) light. This photoeffect allowed separation of the IR spectra of the observed thione forms. The structures of both observed isomers were identified by comparison of the separated experimental IR spectra with the spectra theoretically predicted for two most stable forms of the compound. The population ratio of the two conformers in an Ar matrix, prior to any irradiation, was estimated to be equal ≈2:1. Irradiation of matrix-isolated thiosemicarbazide with shorter-wavelength UV (λ > 270 nm) light induced a phototautomeric reaction generating thiol forms of the compound.
Multifunctional optical correlator for picosecond ultraviolet laser pulse measurement
Rakhman, Abdurahim; Wang, Yang; Garcia, Frances; ...
2014-01-01
A compact optical correlator system that measures both the autocorrelation between two infrared (IR) lights and the cross-correlation between an IR and an ultraviolet (UV) light using a single nonlinear optical crystal has been designed and experimentally demonstrated. The rapid scanning of optical delay line, switching between auto and cross-correlations, crystal angle tuning, and data acquisition and processing are all computer controlled. Pulse widths of an IR light from a mode-locked laser are measured by the correlator and the results are compared with a direct measurement using a high-speed photodetector system. The correlator has been used to study the parametermore » dependence of the pulse width of a macropulse UV laser designed for laser-assisted hydrogen ion (H-) beam stripping for the Spallation Neutron Source at Oak Ridge National Laboratory.« less
Hu, Jianxia; Liu, Xiaoyi; Chi, Jingwei; Che, Kui; Feng, Yan; Zhao, Shihua; Wang, Zhongchao; Wang, Yangang
2018-01-01
Epidemiological data have revealed that colorectal cancer (CRC) risk is increased in patients with Metabolic syndrome. To explore the expressions of IGF-1, ERK, GLUT4, IRS-1 in MS patients with CRC and their associations with the clinical characteristics of CRC. We investigated the expressions of IGF-1, ERK, GLUT4 and IRS-1 in greater omental adipose tissues of 168 MS patients with/without CRC, 85 CRC patients without MS and 98 healthy controls by RT-PCR, and analyzed the relationships between their expressions and clinical characteristics of CRC. The expression levels of IGF-1 and ERK in MS patients with/without CRC were higher while the expression levels of GLUT4 were lower compared with CRC patients without MS and healthy controls (P< 0.01). The expression levels of IGF-1 and ERK in MS patients with CRC were higher while expression levels of GLUT4 were lower compared to MS patients without CRC (P< 0.01). Expression levels of ERK, IGF-1, GLUT4 were associated with clinical characteristics of CRC, including tumor size, distant metastasis and advanced stages (III/IV) (P< 0.05). Expressions of IGF-1, ERK and GLUT4 in greater omental adipose tissues might be useful biomarkers and predictive targets in the diagnosis of CRC.
Multifunctional Nanotherapeutic System for Advanced Prostate Cancer
2012-10-01
aqueous part was again dialyzed against fresh deionized water two times for 12 hours. After dialysis the whole content was lyophilized using Freeze ... dryer (VirTis).The conjugate was characterized using UV visible spectroscopy, FT-IR spectroscopy and proton NMR. The results of the UV –Visible
Yuan, Yongbo; Dong, Qingfeng; Yang, Bin; Guo, Fawen; Zhang, Qi; Han, Ming; Huang, Jinsong
2013-01-01
High sensitivity photodetectors in ultraviolet (UV) and infrared (IR) range have broad civilian and military applications. Here we report on an un-cooled solution-processed UV-IR photon counter based on modified organic field-effect transistors. This type of UV detectors have light absorbing zinc oxide nanoparticles (NPs) sandwiched between two gate dielectric layers as a floating gate. The photon-generated charges on the floating gate cause high resistance regions in the transistor channel and tune the source-drain output current. This "super-float-gating" mechanism enables very high sensitivity photodetectors with a minimum detectable ultraviolet light intensity of 2.6 photons/μm(2)s at room temperature as well as photon counting capability. Based on same mechansim, infrared photodetectors with lead sulfide NPs as light absorbing materials have also been demonstrated.
Global structure and composition of the martian atmosphere with SPICAM on Mars express
NASA Astrophysics Data System (ADS)
Bertaux, Jean-Loup; Korablev, O.; Fonteyn, D.; Guibert, S.; Chassefière, E.; Lefèvre, F.; Dimarellis, E.; Dubois, J. P.; Hauchecorne, A.; Cabane, M.; Rannou, P.; Levasseur-Regourd, A. C.; Cernogora, G.; Quémerais, E.; Hermans, C.; Kockarts, G.; Lippens, C.; de Maziere, M.; Moreau, D.; Muller, C.; Neefs, E.; Simon, P. C.; Forget, F.; Hourdin, F.; Talagrand, O.; Moroz, V. I.; Rodin, A.; Sandel, B.; Stern, A.
SPectroscopy for the Investigation of the Characteristics of the Atmosphere of Mars (SPICAM) Light, a light-weight (4.7 kg) UV-IR instrument to be flown on Mars Express orbiter, is dedicated to the study of the atmosphere and ionosphere of Mars. A UV spectrometer (118-320 nm, resolution 0.8 nm) is dedicated to nadir viewing, limb viewing and vertical profiling by stellar and solar occultation (3.8 kg). It addresses key issues about ozone, its coupling with H2O, aerosols, atmospheric vertical temperature structure and ionospheric studies. UV observations of the upper atmosphere will allow studies of the ionosphere through the emissions of CO, CO+, and CO2+, and its direct interaction with the solar wind. An IR spectrometer (1.0-1.7 μm, resolution 0.5-1.2 nm) is dedicated primarily to nadir measurements of H2O abundances simultaneously with ozone measured in the UV, and to vertical profiling during solar occultation of H2O, CO2, and aerosols. The SPICAM Light near-IR sensor employs a pioneering technology acousto-optical tunable filter (AOTF), leading to a compact and light design. Overall, SPICAM Light is an ideal candidate for future orbiter studies of Mars, after Mars Express, in order to study the interannual variability of martian atmospheric processes. The potential contribution to a Mars International Reference Atmosphere is clear.
UV-IR mixing in nonassociative Snyder ϕ4 theory
NASA Astrophysics Data System (ADS)
Meljanac, Stjepan; Mignemi, Salvatore; Trampetic, Josip; You, Jiangyang
2018-03-01
Using a quantization of the nonassociative and noncommutative Snyder ϕ4 scalar field theory in a Hermitian realization, we present in this article analytical formulas for the momentum-conserving part of the one-loop two-point function of this theory in D -, 4-, and 3-dimensional Euclidean spaces, which are exact with respect to the noncommutative deformation parameter β . We prove that these integrals are regularized by the Snyder deformation. These results indicate that the Snyder deformation does partially regularize the UV divergences of the undeformed theory, as it was proposed decades ago. Furthermore, it is observed that different nonassociative ϕ4 products can generate different momentum-conserving integrals. Finally, most importantly, a logarithmic infrared divergence emerges in one of these interaction terms. We then analyze sample momentum nonconserving integral qualitatively and show that it could exhibit IR divergence too. Therefore, infrared divergences should exist, in general, in the Snyder ϕ4 theory. We consider infrared divergences at the limit p →0 as UV/IR mixings induced by nonassociativity, since they are associated to the matching UV divergence in the zero-momentum limit and appear in specific types of nonassociative ϕ4 products. We also discuss the extrapolation of the Snyder deformation parameter β to negative values as well as certain general properties of one-loop quantum corrections in Snyder ϕ4 theory at the zero-momentum limit.
Generation of chemical movies: FT-IR spectroscopic imaging of segmented flows.
Chan, K L Andrew; Niu, X; deMello, A J; Kazarian, S G
2011-05-01
We have previously demonstrated that FT-IR spectroscopic imaging can be used as a powerful, label-free detection method for studying laminar flows. However, to date, the speed of image acquisition has been too slow for the efficient detection of moving droplets within segmented flow systems. In this paper, we demonstrate the extraction of fast FT-IR images with acquisition times of 50 ms. This approach allows efficient interrogation of segmented flow systems where aqueous droplets move at a speed of 2.5 mm/s. Consecutive FT-IR images separated by 120 ms intervals allow the generation of chemical movies at eight frames per second. The technique has been applied to the study of microfluidic systems containing moving droplets of water in oil and droplets of protein solution in oil. The presented work demonstrates the feasibility of the use of FT-IR imaging to study dynamic systems with subsecond temporal resolution.
Looking at Art in the IR and UV
NASA Astrophysics Data System (ADS)
Falco, Charles
2013-03-01
Starting with the very earliest cave paintings art has been created to be viewed by the unaided eye and, until very recently, it wasn't even possible to see it at wavelengths outside the visible spectrum. However, it is now possible to view paintings, sculptures, manuscripts, and other cultural artifacts at wavelengths from the x-ray, through the ultraviolet (UV), to well into the infrared (IR). Further, thanks to recent advances in technology, this is becoming possible with hand-held instruments that can be used in locations that were previously inaccessible to anything but laboratory-scale image capture equipment. But, what can be learned from such ``non-visible'' images? In this talk I will briefly describe the characteristics of high resolution UV and IR imaging systems I developed for this purpose by modifying high resolution digital cameras. The sensitivity of the IR camera makes it possible to obtain images of art ``in situ'' with standard museum lighting, resolving features finer than 0.35 mm on a 1.0x0.67 m painting. I also have used both it and the UV camera in remote locations with battery-powered illumination sources. I will illustrate their capabilities with images of various examples of Western, Asian, and Islamic art in museums on three continents, describing how these images have revealed important new information about the working practices of artists as famous as Jan van Eyck. I also will describe what will be possible for this type of work with new capabilities that could be developed within the next few years. This work is based on a collaboration with David Hockney, and benefitted from image analys research supported by ARO grant W911NF-06-1-0359-P00001.
Brufani, Claudia; Grossi, Armando; Fintini, Danilo; Fiori, Rossana; Ubertini, Graziamaria; Colabianchi, Diego; Ciampalini, Paolo; Tozzi, Alberto; Barbetti, Fabrizio; Cappa, Marco
2008-01-01
To evaluate if insulin resistance (IR) and metabolic syndrome (MS) were associated with poor cardiovascular fitness in very obese prepubertal Italian subjects. Children referred to the Endocrinology and Diabetes Unit of Bambino Gesù Children's Hospital underwent an OGTT with glucose and insulin assays. QUICKI, ISI and HOMA-IR were calculated. Total and HDL cholesterol, triglycerides and percentage of body fat (DEXA) were determined. Cardiovascular fitness (maximal treadmill time) was evaluated using a treadmill protocol. The MS was defined as having 3 or more of following risk factors: obesity, impaired glucose tolerance, high blood pressure, low HDL-cholesterol, high triglycerides. Fifty-five very obese prepubertal Italian children were enrolled in the study. Unadjusted correlation revealed maximal treadmill time negatively related to fasting insulin (r = -0.53, p < 0.0001) and HOMA-IR (r = -0.57, p < 0.0001) and positively to QUICKI (r = 0.51, p < 0.0001) and ISI (r = 0.46, p = 0.0035). These relationships remained significant when in multivariate analysis age, gender, BMI SD and body composition were accounted for (all p < 0.01). The presence of the MS was independently associated with maximal treadmill time. Poorcardiovascular fitness, IR and MS were independently related, suggesting that the relationship between fitness and insulin action develops early in life. Copyright 2008 S. Karger AG, Basel.
Quantum-chemical, NMR, FT IR, and ESI MS studies of complexes of colchicine with Zn(II).
Jankowski, Wojciech; Kurek, Joanna; Barczyński, Piotr; Hoffmann, Marcin
2017-04-01
Colchicine is a tropolone alkaloid from Colchicinum autumnale. It shows antifibrotic, antimitotic, and anti-inflammatory activities, and is used to treat gout and Mediterranean fever. In this work, complexes of colchicine with zinc(II) nitrate were synthesized and investigated using DFT, 1 H and 13 C NMR, FT IR, and ESI MS. The counterpoise-corrected and uncorrected interaction energies of these complexes were calculated. We also calculated their 1 H, 13 C NMR, and IR spectra and compared them with the corresponding experimentally obtained data. According to the ESI MS mass spectra, colchicine forms stable complexes with zinc(II) nitrate that have various stoichiometries: 2:1, 1:1:1, and 2:1:1 with respect to colchichine, Zn(II), and nitrate ion. All of the complexes were investigated using the quantum theory of atoms in molecules (QTAIM). The calculated and the measured spectra showed differences before and after the complexation process. Calculated electron densities and bond critical points indicated the presence of bonds between the ligands and the central cation in the investigated complexes that satisfied the quantum theory of atoms in molecules. Graphical Abstract DFT, NMR, FT IR, ESI MS, QTAIM and puckering studies of complexes of colchicine with Zn(II).
Oliveira, Elisabete; Genovese, Damiano; Juris, Riccardo; Zaccheroni, Nelsi; Capelo, José Luis; Raposo, M Manuela M; Costa, Susana P G; Prodi, Luca; Lodeiro, Carlos
2011-09-19
Seven new bioinspired chemosensors (2-4 and 7-10) based on fluorescent peptides were synthesized and characterized by elemental analysis, (1)H and (13)C NMR, melting point, matrix-assisted laser desorption-ionization time-of-flight mass spectrometry (MALDI-TOF-MS), and IR and UV-vis absorption and emission spectroscopy. The interaction with transition- and post-transition-metal ions (Cu(2+), Ni(2+), Ag(+), Zn(2+), Cd(2+), Hg(2+), Pb(2+), and Fe(3+)) has been explored by absorption and fluorescence emission spectroscopy and MALDI-TOF-MS. The reported fluorescent peptide systems, introducing biological molecules in the skeleton of the probes, enhance their sensitivity and confer them strong potential for applications in biological fields. Gold and silica nanoparticles functionalized with these peptides were also obtained. All nanoparticles were characterized by dynamic light scattering, transmission electron microscopy, and UV-vis absorption and fluorescence spectroscopy. Stable gold nanoparticles (diameter 2-10 nm) bearing ligands 1 and 4 were obtained by common reductive synthesis. Commercial silica nanoparticles were decorated at their surface using compounds 8-10, linked through a silane spacer. The same chemosensors were also taken into aqueous solutions through their dispersion in the outer layer of silica core/poly(ethylene glycol) shell nanoparticles. In both cases, these complex nanoarchitectures behaved as new sensitive materials for Ag(+) and Hg(2+) in water. The possibility of using these species in this solvent is particularly valuable because the impact on human health of heavy- and transition-metal-ion pollution is very severe, and all analytical and diagnostics investigations involve a water environment.
USDA-ARS?s Scientific Manuscript database
A new rapid UHPLC-UV-QTOF/MS method has been developed for the simultaneous analysis of nine phenolic compounds [cis-GMCA, chlorogenic acid, trans-GMCA, quercetagetin-7-O-ß-D-glucopyranoside, luteolin-7-O-ß-D-glucoside, apigenin-7-O- ß-Dglucoside, chamaemeloside, apigenin 7-O-(6"-O-acetyl-ß-D-glucop...
Two-point T1 measurement: wide-coverage optimizations by stochastic simulations.
Lin, M S; Fletcher, J W; Donati, R M
1986-08-01
Stochastic reliability of T1 measurement from image signal ratios is examined in the ideal case by stochastic simulations in the context of wide-coverage optimizations. Precise measurements prove to be accurate, and accurate ones precise. Sign-preserved inversion-recovery (IR)/non-IR techniques are the best ratio method, reciprocal non-IR/IR ones being equivalent, but inconvenient. Wide-coverage optima are relatively unsharp. Suggested guidelines for covering the 150- to 1500-ms T1 band are minimal relevant TE; TI about 400 ms; effective repetition times about in the ratio, TR2(IR)/TR1 (non-IR) = 2.5-3.0, and in a sum as long as possible up to about TR1 + TR2 = 3.5-4.0 s; signal-averaging after and only after TR1 + TR2 has been lengthened to the said region. Also suggested are different guidelines for covering T1 bands, 120-1200 and 200-1800 ms. Typically, precisions and accuracies improve linearly or faster with increasing S/N and (S/N)2, respectively. Unnecessarily high pixel resolutions or thin slicings exact great penalties in accuracies. Progressively shortening TR1 eventually transforms a wide coverage into a sharp targeting with small potential gains in a narrow T1 locality and large compromises almost everywhere else. The simulations yield an insight into applicabilities of standard error propagation analyses in two-point T1 measurement.
Li, Mengkai; Li, Wentao; Wen, Dong; Qiang, Zhimin; Blatchley, Ernest R
2017-11-21
Turbidity is a common parameter used to assess particle concentration in water using visible light. However, the fact that particles play multiple roles (e.g., scattering, refraction, and reflection) in influencing the optical properties of aqueous suspensions complicates examinations of their effects on ultraviolet (UV) photoreactor performance. To address this issue, UV fluence rate (FR) distributions in a photoreactor containing various particle suspensions (SiO 2 , MgO, and TiO 2 ) were measured using a microfluorescent silica detector (MFSD). Reflectance of solid particles, as well as transmittance and scattering properties of the suspensions were characterized at UV, visible, and infrared (IR) wavelengths. The results of these measurements indicated that the optical properties of all three particle types were similar at visible and IR wavelengths, but obvious differences were evident in the UV range. The FR results indicated that for turbidity associated with SiO 2 and MgO suspensions, the weighted average FR (WAFR) increased relative to deionized water. These increases were attributed to low particle photon absorption and strong scattering. In contrast, the WAFR values decreased with increasing turbidity for TiO 2 suspensions because of their high particle photon absorption and low scattering potential. The findings also indicate that measurements of scattering and transmittance at UV wavelengths can be used to quantify the effects of turbidity on UV FR distributions.
Płaczkowska, Sylwia; Pawlik-Sobecka, Lilla; Kokot, Izabela; Piwowar, Agnieszka
2018-05-09
Civilizational developments occurring during recent decades have resulted in an increased incidence of a variety of metabolic disorders related to insulin resistance in younger people. The determination of decision limits for insulin resistance indices, especially among young people, is a significant challenge in clinical practice. The aim of this study was the estimation of metabolic factors related to their relationship to insulin resistance and metabolic syndrome (MS) features in young, apparently healthy people. Moreover, we evaluated the optimal decision limits for patients with MS identification for HOMA1-IR, HOMA2-IR, HOMA2 obtained from C-peptide concentrations. 349 apparently healthy people aged 18-31 (260 women and 89 men), were enrolled in this study. The present analysis of metabolic, anthropometric and clinical parameters observed them in clusters covering the criteria of MS recognition, but MS in this group was only partially related to insulin resistance. The HOMA1-IR decision limit estimation is likely to became be useful in the prognostication of metabolic disturbances in young, apparently healthy people. A measure of insulin resistance that can provide a reliable early prediction of MS is likely to provide an opportunity for instigating preventive measures of significant clinical utility.
Lipidomic analysis of glycerolipid and cholesteryl ester autooxidation products.
Kuksis, Arnis; Suomela, Jukka-Pekka; Tarvainen, Marko; Kallio, Heikki
2009-06-01
Thin-layer chromatography (TLC), gas chromatography (GC), and liquid chromatography (LC) in combination with mass spectrometry (MS) have been adopted for the isolation and identification of oxolipids and for determining their functionality. TLC provides a rapid separation and access to most oxolipids as intact molecules and has recently been effectively interfaced with time-of-flight (TOF) MS (TOF-MS). GC with flame ionization (FI) (GC/FI) and electron impact (EI) MS (GC/EI-MS) has been extensively utilized in the analysis of isoprostanes and other low-molecular-weight oxolipids, although these methods require derivatization of the analytes. In contrast, LC with ultraviolet (UV) absorption (LC/UV) or evaporate light scattering detection (ELSD) (LC/ELSD) as well as electrospray ionization (ESI) or atmospheric pressure chemical ionization (APCI) MS (LC/ESI-MS) or LC/APCI-MS has proven to be well suited for the analysis of intact oxolipids and their conjugates without or with minimal derivatization. Nevertheless, kit-based colorimetric and fluorescent procedures continue to serve as sensitive indicators of the presence of hydroperoxides and aldehydes.
Capillary electrophoretic determination of main components of natural dyes with MS detection.
Surowiec, Izabella; Pawelec, Katarzyna; Rezeli, Melinda; Kilar, Ferenc; Trojanowicz, Marek
2008-07-01
CE with UV-Vis and MS detections was investigated as a technique for detection of main components of selected natural dyes of plant and insect origin. The BGE giving the best separation of the investigated flavonoids and anthraquinoids, suitable for MS detection consisted of 40 mM ammonium acetate solution of pH 9.5 with 40% ACN. LODs obtained with MS detection were even one order of magnitude lower than the ones obtained with UV-Vis detection. Application of MS detection enabled determination of eleven dye compounds from three different chemical groups in 15 min. and proved to be more satisfactory than diode-array detection in the electrophoretic analysis of main classes of natural dyes both in terms of selectivity and sensitivity of analysis.
Observation sequences and onboard data processing of Planet-C
NASA Astrophysics Data System (ADS)
Suzuki, M.; Imamura, T.; Nakamura, M.; Ishi, N.; Ueno, M.; Hihara, H.; Abe, T.; Yamada, T.
Planet-C or VCO Venus Climate Orbiter will carry 5 cameras IR1 IR 1micrometer camera IR2 IR 2micrometer camera UVI UV Imager LIR Long-IR camera and LAC Lightning and Airglow Camera in the UV-IR region to investigate atmospheric dynamics of Venus During 30 hr orbiting designed to quasi-synchronize to the super rotation of the Venus atmosphere 3 groups of scientific observations will be carried out i image acquisition of 4 cameras IR1 IR2 UVI LIR 20 min in 2 hrs ii LAC operation only when VCO is within Venus shadow and iii radio occultation These observation sequences will define the scientific outputs of VCO program but the sequences must be compromised with command telemetry downlink and thermal power conditions For maximizing science data downlink it must be well compressed and the compression efficiency and image quality have the significant scientific importance in the VCO program Images of 4 cameras IR1 2 and UVI 1Kx1K and LIR 240x240 will be compressed using JPEG2000 J2K standard J2K is selected because of a no block noise b efficiency c both reversible and irreversible d patent loyalty free and e already implemented as academic commercial software ICs and ASIC logic designs Data compression efficiencies of J2K are about 0 3 reversible and 0 1 sim 0 01 irreversible The DE Digital Electronics unit which controls 4 cameras and handles onboard data processing compression is under concept design stage It is concluded that the J2K data compression logics circuits using space
US EPA Testing of LP & MP UV Disinfection Technologies
Presentation will discuss the ongoing USEPA research on UV disinfection addressing the following objectives: Conservatively predict log inactivation and RED of adenovirus with surrogates; Conduct many (LP=61) UV reactor conditions challenged with Ad2, B. pumilus, and MS2 & conduc...
Zaltariov, Mirela-Fernanda; Bele, Adrian; Vasiliu, Lavinia; Gradinaru, Luiza; Vornicu, Nicoleta; Racles, Carmen; Cazacu, Maria
2018-01-05
A series of elastomers, either natural or synthetic (some of them commercial, while others prepared in the laboratory), suitable for use as active elements in devices for wave energy harvesting, were evaluated concerning their behavior and effects on the marine environment. In this aim, the elastomer films, initially evaluated regarding their aspect, structure, surface wettability, and tolerance of microorganisms growth, were immersed in synthetic seawater (SSW) within six months for assessing compounds released. There were analyzed the changes occurred both in the elastomers and salt water in which they were immersed. For this, water samples taken at set time intervals were analyzed by using a sequence of sensitive spectral techniques: UV-vis, IR, and in relevant cases 1 H NMR and electrospray ionization mass spectrometry (ESI-MS), able to detect and identify organic compounds, while after six months, they were also investigated from the point of view of aspect, presence of metal traces, pH, and biological activity. The changes in aspect, structure and morphology of the dielectric films at the end of the dipping period were also evaluated by visual inspection, IR spectroscopy by using spectral subtraction method, and SEM-EDX technique. Copyright © 2017 Elsevier B.V. All rights reserved.
Synthesis and spectroscopic properties of novel asymmetric Schiff bases.
Güngör, Ozlem; Gürkan, Perihan
2010-09-15
Three novel diimine Schiff bases including two asymmetric imines (2-OH)R-CHN-C(6)H(4)-CHN-R'(2-OH) type [where R=R'=phenyl for H(2)L(1); R=naphthyl, R'=phenyl for H(2)L(2) and R=R'=naphthyl for H(2)L(3)] have been synthesized with a new two step method. For this purpose, the starting Schiff bases 4-nitrobenzylidene-2-hydroxyaniline (SB(1)-NO(2)) and 4-nitrobenzylidene-2-hydroxy-3-naphthylamine (SB(2)-NO(2)) have been synthesized, previously. Nitro groups of them have been reduced into their amino derivatives (SB(1)-NH(2) and SB(2)-NH(2)) with sodium dithionite as selective reductant and the other imino groups have been formed by adding salicylaldehyde or 2-hydroxy-1-naphthaldehyde to the same solutions. The structures of the diimine Schiff bases were confirmed by elemental analyses, ESI-MS, FT-IR, (1)H NMR and (13)C NMR spectroscopy. The phenol-imine and keto-amine tautomerism of the Schiff bases were investigated by FT-IR, (1)H NMR, (13)C NMR techniques and UV-vis spectra in different solvents (DMSO, methanol, chloroform, toluene and cyclohexane). The effects of acidic and basic media on the tautomeric equilibria were discussed. Copyright 2010 Elsevier B.V. All rights reserved.
Pereira, Cidália D; Passos, Emanuel; Severo, Milton; Vitó, Isabel; Wen, Xiaogang; Carneiro, Fátima; Gomes, Pedro; Monteiro, Rosário; Martins, Maria J
2016-05-01
High-fructose and/or low-mineral diets are relevant in metabolic syndrome (MS) development. Insulin resistance (IR) represents a central mechanism in MS development. Glucocorticoid signalling dysfunction and endoplasmic reticulum (ER) and oxidative stresses strongly contribute to IR and associate with MS. We have described that natural mineral-rich water ingestion delays fructose-induced MS development, modulates fructose effects on the redox state and glucocorticoid signalling and increases sirtuin 1 expression. Here, we investigated mineral-rich water ingestion effects on insulin signalling and ER homeostasis of fructose-fed rats. Adult male Sprague-Dawley rats had free access to standard-chow diet and different drinking solutions (8 weeks): tap water (CONT), 10%-fructose/tap water (FRUCT) or 10%-fructose/mineral-rich water (FRUCTMIN). Hepatic and adipose (visceral, VAT) insulin signalling and hepatic ER homeostasis (Western blot or PCR) as well as hepatic lipid accumulation were evaluated. Hepatic p-IRS1Ser307/IRS1 (tendency), p-IRS1Ser307, total JNK and (activated IRE1α)/(activated JNK) decreased with fructose ingestion, while p-JNK tended to increase; mineral-rich water ingestion, totally or partially, reverted all these effects. Total PERK, p-eIF2α (tendency) and total IRS1 (tendency) decreased in both fructose-fed groups. p-ERK/ERK and total IRE1α increasing tendencies in FRUCT became significant in FRUCTMIN (similar pattern for lipid area). Additionally, unspliced-XBP1 increased with mineral-rich water. In VAT, total ERK fructose-induced increase was partially prevented in FRUCTMIN. Mineral-rich water modulation of fructose-induced effects on insulin signalling and ER homeostasis matches the better metabolic profile previously reported. Increased p-ERK/ERK, adding to decreased IRE1α activation, and increased unspliced-XBP1 and lipid area may protect against oxidative stress and IR development in FRUCTMIN.
Zanolari, Boris; Ndjoko, Karine; Ioset, Jean-Robert; Marston, Andrew; Hostettmann, Kurt
2003-01-01
The development and validation of a rapid qualitative and quantitative method based on an HPLC-UV-MS technique with atmospheric pressure chemical ionisation and electrospray ionisation for the analysis of yohimbine in a number of commercial aphrodisiac products is reported. HPLC with multiple-stage mass spectrometry experiments allowed the identification of the target compound and increased the selectivity of complex analyses such as those involved with multi-botanical preparations. The precision and the robustness of the method were improved by the use of two internal standards: codeine for UV detection and deuterium-labelled yohimbine for MS detection. Twenty commercial aphrodisiac preparations were analysed and the amount of yohimbine measured and expressed as the maximal dose per day suggested on product labels ranged from 1.32 to 23.16 mg.
Wang, Xing-Juan; Jin, Hua-Liang; Liu, Ying
2010-11-01
To evaluate the relation between Pi-deficiency syndrome (PDS) pattern and metabolic syndrome (MS) in patients with polycystic ovarian syndrome (PCOS), for exploring their internal pathologic mechanism. Among the 102 PCOS patients, 22 complicated with MS (PCOS-MS) and 80 not complicated with MS (PCOS-NMS), the Chinese medicine syndrome pattern was differentiated as PDS in 50 patients and non-PDS in 52. The clinical data, in terms of fasting blood glucose (FBG), fasting insulin (FINS), waistline, body weight (BW), stature, blood pressure (BP), etc. was collected and compared and the relation between data was analyzed. Levels of FINS and homeostasis model of assessment for insulin resistence index (HOMA-IR), in PCOS-MS patients were significantly higher than those in PCOS-NMS patients, also higher in patients of PDS pattern than those of non-PDS pattern (P < 0.01); the occurrences of MS and PDS were highly positively correlated with levels of FINS and HOMA-IR (P < 0.01); incidence of MS in patients of PDS pattern was significantly higher than those in patients of non-PDS pattern (P < 0.05); presenting of PDS was positively related with the existence of MS (P < 0.05), but in case of the FINS or HOMA-IR factor being controlled, statistical meaning of the relativity between them turned to insignificant (P > 0.05). PCOS patients of PDS pattern are the high-risk population of MS, which might be related with the insulin resistance. So, early treatment of PCOS, especially on patients of PDS pattern, is of important significance for preventing the complication, as MS, of the disease.
Isolation and purification of Cu-free methanobactin from Methylosinus trichosporium OB3b
2011-01-01
Background The isolation of highly pure copper-free methanobactin is a prerequisite for the investigation of the biogeochemical functions of this chalkophore molecule produced by methane oxidizing bacteria. Here, we report a purification method for methanobactin from Methylosinus trichosporium OB3b cultures based on reversed-phase HPLC fractionation used in combination with a previously reported resin extraction. HPLC eluent fractions of the resin extracted product were collected and characterized with UV-vis, FT-IR, and C-1s NEXAFS spectroscopy, as well as with elemental analysis and ESI-MS. Results The results showed that numerous compounds other than methanobactin were present in the isolate obtained with resin extraction. Molar C/N ratios, mass spectrometry measurements, and UV-vis spectra indicated that methanobactin was only present in one of the HPLC fractions. On a mass basis, methanobactin carbon contributed only 32% to the total organic carbon isolated with resin extraction. Our spectroscopic results implied that besides methanobactin, the organic compounds in the resin extract comprised breakdown products of methanobactin as well as polysaccharide-like substances. Conclusion Our results demonstrate that a purification step is indispensable in addition to resin extraction in order to obtain pure methanobactin. The proposed HPLC purification procedure is suitable for semi-preparative work and provides copper-free methanobactin. PMID:21299876
NASA Astrophysics Data System (ADS)
Singh, Ashok K.; Saxena, Gunjan; Dixit, Shivani; Hamidullah; Singh, Sachin K.; Singh, Sudheer K.; Arshad, M.; Konwar, Rituraj
2016-05-01
Four new Ru(II) DMSO complexes with substituted chalcone ligands viz. (E)-1-(2-hydroxyphenyl)-3-(4-methoxyphenyl)prop-2-en-1-one (HL1), (E)-1-(2-hydroxyphenyl)-3-(4-nitrophenyl)prop-2-en-1-one (HL2), (E)-3-(4-(dimethylamino)phenyl)-1-(2-hydroxyphenyl)prop-2-en-1-one (HL3) and (E)-1-(2-hydroxyphenyl)-3-(4-Chlorophenyl)prop-2-en-1-one (HL4) have been synthesized, and characterized by micro-analyses, IR, 1H NMR, UV-Vis and ESI-MS and screened for anti-cancer activity against breast cancer cell lines (MCF-7 and MDA MB-231). Compounds HL4 and [Ru(HL1) (O-DMSO)3(S-DMSO)]Cl (M1R) showed significant anti-breast cancer activity as evident from cytotoxicity, morphological and nuclear changes, DNA fragmentation and cell cycle arrest in breast cancer cells. UV-Vis and CD-spectra analysis showed HL4 and M1R interfered with DNA absorption spectra possibly due to DNA binding whereas these compounds were devoid of DNA topoisomerase inhibiting activity. Thus, these Ru(II) compounds have been established as new leads for future optimization by improving anti-cancer potency and safety.
Isolation and Purification of Cu-free Methanobactin from Methylosinus trichosporium OB3b
DOE Office of Scientific and Technical Information (OSTI.GOV)
M Pesch; I Christl; K Barmettler
The isolation of highly pure copper-free methanobactin is a prerequisite for the investigation of the biogeochemical functions of this chalkophore molecule produced by methane oxidizing bacteria. Here, we report a purification method for methanobactin from Methylosinus trichosporium OB3b cultures based on reversed-phase HPLC fractionation used in combination with a previously reported resin extraction. HPLC eluent fractions of the resin extracted product were collected and characterized with UV-vis, FT-IR, and C-1s NEXAFS spectroscopy, as well as with elemental analysis and ESI-MS. The results showed that numerous compounds other than methanobactin were present in the isolate obtained with resin extraction. Molar C/Nmore » ratios, mass spectrometry measurements, and UV-vis spectra indicated that methanobactin was only present in one of the HPLC fractions. On a mass basis, methanobactin carbon contributed only 32% to the total organic carbon isolated with resin extraction. Our spectroscopic results implied that besides methanobactin, the organic compounds in the resin extract comprised breakdown products of methanobactin as well as polysaccharide-like substances. Our results demonstrate that a purification step is indispensable in addition to resin extraction in order to obtain pure methanobactin. The proposed HPLC purification procedure is suitable for semi-preparative work and provides copper-free methanobactin.« less
The study of the martian atmosphere from top to bottom with SPICAM light on mars express
NASA Astrophysics Data System (ADS)
Bertaux, Jean-Loup; Fonteyn, D.; Korablev, O.; Chassefière, E.; Dimarellis, E.; Dubois, J. P.; Hauchecorne, A.; Cabane, M.; Rannou, P.; Levasseur-Regourd, A. C.; Cernogora, G.; Quemerais, E.; Hermans, C.; Kockarts, G.; Lippens, C.; de Maziere, M.; Moreau, D.; Muller, C.; Neefs, B.; Simon, P. C.; Forget, F.; Hourdin, F.; Talagrand, O.; Moroz, V. I.; Rodin, A.; Sandel, B.; Stern, A.
2000-10-01
SPICAM Light is a small UV-IR instrument selected for Mars Express to recover most of the science that was lost with the demise of Mars 96, where the SPICAM set of sensors was dedicated to the study of the atmosphere of Mars (Spectroscopy for the investigation of the characteristics of the atmosphere of mars). The new configuration of SPICAM Light includes optical sensors and an electronics block. A UV spectrometer (118-320 nm, resolution 0.8 nm) is dedicated to Nadir viewing, limb viewing and vertical profiling by stellar occultation (3.8 kg). It addresses key issues about ozone, its coupling with H 2O, aerosols, atmospheric vertical temperature structure and ionospheric studies. An IR spectrometer (1.2- 4.8 μm, resolution 0.4-1 nm) is dedicated to vertical profiling during solar occultation of H 2O, CO 2, CO, aerosols and exploration of carbon compounds (3.5 kg). A nadir looking sensor for H 2O abundances (1.0- 1.7 μm, resolution 0.8 nm) is recently included in the package (0.8 kg). A simple data processing unit (DPU, 0.9 kg) provides the interface of these sensors with the spacecraft. In nadir orientation, SPICAM UV is essentially an ozone detector, measuring the strongest O 3 absorption band at 250 nm in the spectrum of the solar light scattered back from the ground. In the stellar occultation mode the UV Sensor will measure the vertical profiles of CO 2, temperature, O 3, clouds and aerosols. The density/temperature profiles obtained with SPICAM Light will constrain and aid in the development of the meteorological and dynamical atmospheric models, from the surface to 160 km in the atmosphere. This is essential for future missions that will rely on aerocapture and aerobraking. UV observations of the upper atmosphere will allow study of the ionosphere through the emissions of CO, CO +, and CO 2+, and its direct interaction with the solar wind. Also, it will allow a better understanding of escape mechanisms and estimates of their magnitude, crucial for insight into the long-term evolution of the atmosphere. The SPICAM Light IR sensor is inherited from the IR solar part of the SPICAM solar occultation instrument of Mars 96. Its main scientific objective is the global mapping of the vertical structure of H 2O, CO 2, CO, HDO, aerosols, atmospheric density, and temperature by the solar occultation. The wide spectral range of the IR spectrometer and its high spectral resolution allow an exploratory investigation addressing fundamental question of the possible presence of carbon compounds in the Martian atmosphere. Because of severe mass constraints this channel is still optional. An additional nadir near IR channel that employs a pioneering technology acousto-optical tuneable filter (AOTF) is dedicated to the measurement of water vapour column abundance in the IR simultaneously with ozone measured in the UV. It will be done at much lower telemetry budget compared to the other instrument of the mission, planetary fourier spectrometer (PFS).
Computational Design of Tunable UV-Vis-IR Filters Based on Silver Nanoparticle Arrays
NASA Astrophysics Data System (ADS)
Waters, Michael; Shi, Guangsha; Kioupakis, Emmanouil
We propose design strategies to develop selective optical filters in the UV-Vis-IR spectrum using the surface plasmon response of silver nanoparticle arrays. Our finite-difference time-domain simulations allow us to rapidly evaluate many nanostructures comprising simple geometries while varying their shape, height, width, and spacing. Our results allow us to identify trends in the filtering spectra as well as the relative amount of absorption and reflection. Optical filtering with nanoparticles is applicable to any transparent substrate and can be easily adapted to existing manufacturing processes while keeping the total cost of materials low. This work was supported by Guardian Industries Corp.
NASA Astrophysics Data System (ADS)
Orellana, Sandra; Soto, César; Toral, M. Inés
2010-01-01
The present study shows the formation and characterization of the ionic-pair between the antibiotic oxytetracycline and the dye crystal violet in ammonia solution pH 9.0 ± 0.2 extracted into chloroform. The characterization was demonstrated using UV-vis spectrophotometry, 1H NMR, measurement of relaxation times T1 and IR spectroscopy, using a comparison between the signals of individual pure compounds with the signals with the mixture CV-OTC in different alkaline media. The formation of ionic-pair was also corroborated by new signals and chemical shifts. (2D) NMR spectroscopy experiments show that the interaction is electrostatic.
Sopronyi, Mihai; Sima, Felix; Vaulot, Cyril; Delmotte, Luc; Bahouka, Armel; Matei Ghimbeu, Camelia
2016-01-01
The design of mesoporous carbon materials with controlled textural and structural features by rapid, cost-effective and eco-friendly means is highly demanded for many fields of applications. We report herein on the fast and tailored synthesis of mesoporous carbon by UV and IR laser assisted irradiations of a solution consisting of green phenolic resins and surfactant agent. By tailoring the UV laser parameters such as energy, pulse repetition rate or exposure time carbon materials with different pore size, architecture and wall thickness were obtained. By increasing irradiation dose, the mesopore size diminishes in the favor of wall thickness while the morphology shifts from worm-like to an ordered hexagonal one. This was related to the intensification of phenolic resin cross-linking which induces the reduction of H-bonding with the template as highlighted by 13C and 1H NMR. In addition, mesoporous carbon with graphitic structure was obtained by IR laser irradiation at room temperature and in very short time periods compared to the classical long thermal treatment at very high temperatures. Therefore, the carbon texture and structure can be tuned only by playing with laser parameters, without extra chemicals, as usually required. PMID:28000781
NASA Astrophysics Data System (ADS)
Gür, Mahmut; Muğlu, Halit; Çavuş, M. Serdar; Güder, Aytaç; Sayıner, Hakan S.; Kandemirli, Fatma
2017-04-01
A series of 1,3,4-thiadiazole derivatives including 2- and 3-methoxy cinnamic acids were synthesized, and their structures were elucidated by the UV, IR, 1H NMR, 13C NMR spectroscopies and elemental analysis. The UV and IR calculations of the molecules were performed by using B3LYP, HF and MP2 methods with selected 6-311++G(2d,2p), 6-311++G(3df,3pd) and cc-pvtz basis sets. Dipole moment, polarizability, chemical hardness/softness and electronegativity were also calculated and analyzed. Experimental FT-IR spectra and UV-Vis spectrum of the compounds were compared with theoretical data. Furthermore, antioxidant activities of the compounds were practised via different test methods such as 2,2-diphenyl-1-picryl-hydrazyl (DPPHrad), N,N-dimethyl-p-phenylenediamine (DMPDrad +), and 2,2‧-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTSrad +) scavenging activity assays. When compared with standards (BHA-Butylated hydroxyanisole, RUT-Rutin, and TRO-Trolox), it was observed that especially XIII and XIV which include methoxy groups at the o- and m-positions, respectively, had effective activities.
2014-01-01
Background Insulin resistance plays an important role in the development of metabolic syndrome (MS). Fu Fang Zhen Zhu Tiao Zhi formula (FTZ), a Chinese medicinal decoction, has been used to relieve hyperlipidemia, atherosclerosis and other symptoms associated with metabolic disorders in the clinic. Methods To evaluate the effect of FTZ on insulin resistance, HepG2 cells were induced with high insulin as a model of insulin resistance and treated with FTZ at one of three dosages. Next, the levels of glucose content, insulin receptor substrate1 (IRS1) protein expression and phosphatidylinositol 3-kinase (PI3K) subunit p85 mRNA expression were measured. Alternatively, MS was induced in rats via gavage feeding of a high-fat diet for four consecutive weeks followed by administration of FTZ for eight consecutive weeks. Body weight and the plasma levels of lipids, insulin and glucose were evaluated. Finally, the expression of PI3K p85 mRNA in adipose tissue of rats was measured. Results Our results revealed that FTZ attenuated glucose content and up-regulated the expression of PI3K p85 mRNA and IRS1 protein in insulin-resistant HepG2 cells in vitro. Moreover, FTZ reduced body weight and the plasma concentrations of triacylglycerol, cholesterol, fasting glucose and insulin in insulin resistant MS rats. FTZ also elevated the expression of PI3K p85 mRNA in the adipose tissues of MS rats. Conclusion FTZ attenuated MS symptoms by decreasing the plasma levels of glucose and lipids. The underlying mechanism was attenuation of the reduced expression of PI3K p85 mRNA and IRS1 protein in both insulin-resistant HepG2 cells and MS rats. PMID:24555840
Kinetics and evolved gas analysis for pyrolysis of food processing wastes using TGA/MS/FT-IR.
Özsin, Gamzenur; Pütün, Ayşe Eren
2017-06-01
The objective of this study was to identify the pyrolysis of different bio-waste produced by food processing industry in a comprehensible manner. For this purpose, pyrolysis behaviors of chestnut shells (CNS), cherry stones (CS) and grape seeds (GS) were investigated by thermogravimetric analysis (TGA) combined with a Fourier-transform infrared (FT-IR) spectrometer and a mass spectrometer (MS). In order to make available theoretical groundwork for biomass pyrolysis, activation energies were calculated with the help of four different model-free kinetic methods. The results are attributed to the complex reaction schemes which imply parallel, competitive and complex reactions during pyrolysis. During pyrolysis, the evolution of volatiles was also characterized by FT-IR and MS. The main evolved gases were determined as H 2 O, CO 2 and hydrocarbons such as CH 4 and temperature dependent profiles of the species were obtained. Copyright © 2017 Elsevier Ltd. All rights reserved.
Brünen, Sonja; Krüger, Ralf; Finger, Susann; Korf, Felix; Kiefer, Falk; Wiedemann, Klaus; Lackner, Karl J; Hiemke, Christoph
2010-02-01
We present data for a comparison of a liquid-chromatographic method coupled with tandem mass spectrometry (LC-MS/MS) and a high-performance liquid-chromatographic method with column switching and UV spectrophotometric detection. The two methods were developed for determination of naltrexone and 6beta-naltrexol in blood serum or plasma aiming to be used for therapeutic drug monitoring to guide the treatment of patients with naltrexone. For the high-performance liquid chromatography (HPLC)/UV detection, online sample cleanup was conducted on Perfect Bond C(18) material with 2% (vol/vol) acetonitrile in deionized water. Drugs were separated on a C(18) column using 11.5% (vol/vol) acetonitrile and 0.4% (vol/vol) N,N,N,N-tetramethylethylenediamine within 20 min. LC-MS/MS used naltrexone-d (3) and 6beta-naltrexol-d (4) as internal standards. After protein precipitation, the chromatographic separation was performed on a C(18) column by applying a methanol gradient (5-100%, vol/vol) with 0.1% formic acid over 9.5 min. The HPLC/UV method was found to be linear for concentrations ranging from 2 to 100 ng/ml, with a regression correlation coefficient of r (2) > 0.998 for naltrexone and 6beta-naltrexol. The limit of quantification was 2 ng/ml for naltrexone and 6beta-naltrexol. For the LC-MS/MS method the calibration curves were linear (r(2) > 0.999) from 0.5 to 200 ng/ml for both substances, and the limit of quantification was 0.5 ng/ml. The concentrations measured by the two methods correlated significantly for both substances (r(2) > 0.967; p < 0.001). Both methods could be used for therapeutic drug monitoring. The HPLC/UV method was advantageous regarding automatization and costs, whereas LC-MS/MS was superior with regard to sensitivity.
2012-09-01
Jonesboro UV1 UV163 UV158 UV1 Ar 158 Hwy Sta diu m B lvd E Lawson... Jonesboro UV1 UV163 UV158 UV1 Ar 158 Hwy Sta diu m B lvd E Lawson RdHar risb urg Rd Ar 1 Hw y N Il lino is A ve Ar 1 63 Hw y N Il lino is A ve G120 1...Vicksburg, MS 39180 Thomas Foti Arkansas Natural Heritage Commission 323 Center Street Little Rock, AR 72201 Jody Pagan 5-Oaks Wildlife
Magnuson, Matthew L; Kelty, Catherine A; Sharpless, Charles M; Linden, Karl G; Fromme, William; Metz, Deborah H; Kashinkunti, Ramesh
2002-12-01
Ohio River water was treated by settling, sand filtration, and granular activated carbon filtration. It was then irradiated by low-pressure (monochromatic) and medium-pressure (polychromatic) UV lamps to investigate the effects of UV irradiation on the extracted organic matter (EOM). When the EOM, collected by solid phase extraction cartridges, was analyzed by conventional UV spectroscopy and size exclusion chromatography (SEC), no significant changes in the EOM were revealed for various UV doses. Positive and negative electrospray ionization mass spectrometry (ESI-MS) of the EOM produced mass spectra that vary significantly with UV dose. The UV dosage conditions also appear to affect the reactivity of the EOM to subsequent chlorination. The magnitude of the spectral changes is generally greater for medium-pressure lamps than for low pressure and increases with UV exposure. Based on the observed MS peaks, the changes may be due to the presence of lignin, resulting perhaps from photooxidation and/or photo rearrangement of macromolecules in the sample. When chlorination is used for secondary disinfection, these results suggest that it may be important to consider the effects of UV irradiation on the organic matter in the water before applying UV disinfection technology to a particular source water.
Zhang, Xiao; Ding, Xiaoli; Ji, Yaxi; Wang, Shouchuang; Chen, Yingying; Luo, Jie; Shen, Yingbai; Peng, Li
2018-04-18
Plants respond to UV-B irradiation (280-315 nm wavelength) via elaborate metabolic regulatory mechanisms that help them adapt to this stress. To investigate the metabolic response of the medicinal herb Chinese liquorice (Glycyrrhiza uralensis) to UV-B irradiation, we performed liquid chromatography tandem mass spectrometry (LC-MS/MS)-based metabolomic analysis, combined with analysis of differentially expressed genes in the leaves of plants exposed to UV-B irradiation at various time points. Fifty-four metabolites, primarily amino acids and flavonoids, exhibited changes in levels after the UV-B treatment. The amino acid metabolism was altered by UV-B irradiation: the Asp family pathway was activated and closely correlated to Glu. Some amino acids appeared to be converted into antioxidants such as γ-aminobutyric acid and glutathione. Hierarchical clustering analysis revealed that various flavonoids with characteristic groups were induced by UV-B. In particular, the levels of some ortho-dihydroxylated B-ring flavonoids, which might function as scavengers of reactive oxygen species, increased in response to UV-B treatment. In general, unigenes encoding key enzymes involved in amino acid metabolism and flavonoid biosynthesis were upregulated by UV-B irradiation. These findings lay the foundation for further analysis of the mechanism underlying the response of G. uralensis to UV-B irradiation.
Quasinormal modes of a strongly coupled nonconformal plasma and approach to criticality
NASA Astrophysics Data System (ADS)
Betzios, Panagiotis; Gürsoy, Umut; Järvinen, Matti; Policastro, Giuseppe
2018-04-01
We study fluctuations around equilibrium in a class of strongly interacting nonconformal plasmas using holographic techniques. In particular, we calculate the quasinormal mode spectrum of black hole backgrounds that approach Chamblin-Reall plasmas in the IR. In a specific limit, related to the exact linear-dilaton background in string theory, we observe that the plasma approaches criticality and we obtain the quasinormal spectrum analytically. We regulate the critical limit by gluing the IR geometry that corresponds to the nonconformal plasma to a part of AdS space-time in the UV. Near criticality, the spectrum can still be computed analytically and we find two sets of quasinormal modes, related to the IR and UV parts of the geometry. In the critical limit, the quasinormal modes accumulate to form a branch cut in the correlators of the energy-momentum tensor on the real axis of the complex frequency plane.
Cascade generation in Al laser induced plasma
NASA Astrophysics Data System (ADS)
Nagli, Lev; Gaft, Michael; Raichlin, Yosef; Gornushkin, Igor
2018-05-01
We found cascade IR generation in Al laser induced plasma. This generation includes doublet transitions 3s 25s 2S1/2 → 3s24p 2P1/2,3/2 → 3s24s 2S1/2; corresponding to strong lines at 2110 and 2117 nm, and much weaker lines at 1312-1315 nm. The 3s25s2S 1/2 starting IR generation level is directly pumped from the 3s23p 2P3/2 ground level. The starting level for UV generation at 396.2 nm (transitions 3s24s 2S1/2 → 4p 2P3/2) is populated due to the fast collisional processes in the plasma plume. These differences led to different time and special dependences on the lasing in the IR and UV spectral range within the aluminum laser induced plasma.
IR-laser assisted additive freeform optics manufacturing.
Hong, Zhihan; Liang, Rongguang
2017-08-02
Computer-controlled additive manufacturing (AM) processes, also known as three-dimensional (3D) printing, create 3D objects by the successive adding of a material or materials. While there have been tremendous developments in AM, the 3D printing of optics is lagging due to the limits in materials and tight requirements for optical applicaitons. We propose a new precision additive freeform optics manufacturing (AFOM) method using an pulsed infrared (IR) laser. Compared to ultraviolet (UV) curable materials, thermally curable optical silicones have a number of advantages, such as strong UV stability, non-yellowing, and high transmission, making it particularly suitable for optical applications. Pulsed IR laser radiation offers a distinct advantage in processing optical silicones, as the high peak intensity achieved in the focal region allows for curing the material quickly, while the brief duration of the laser-material interaction creates a negligible heat-affected zone.
More asymptotic safety guaranteed
NASA Astrophysics Data System (ADS)
Bond, Andrew D.; Litim, Daniel F.
2018-04-01
We study interacting fixed points and phase diagrams of simple and semisimple quantum field theories in four dimensions involving non-Abelian gauge fields, fermions and scalars in the Veneziano limit. Particular emphasis is put on new phenomena which arise due to the semisimple nature of the theory. Using matter field multiplicities as free parameters, we find a large variety of interacting conformal fixed points with stable vacua and crossovers inbetween. Highlights include semisimple gauge theories with exact asymptotic safety, theories with one or several interacting fixed points in the IR, theories where one of the gauge sectors is both UV free and IR free, and theories with weakly interacting fixed points in the UV and the IR limits. The phase diagrams for various simple and semisimple settings are also given. Further aspects such as perturbativity beyond the Veneziano limit, conformal windows, and implications for model building are discussed.
Pati, S; Losito, I; Gambacorta, G; La Notte, E; Palmisano, F; Zambonin, P G
2006-07-01
Samples of raw red wine (Primitivo di Manduria, Apulia, Southern Italy) were analysed without any pre-treatment (except 1:2 dilution with water) using HPLC with detection based on UV absorbance and Electrospray Ionisation Sequential Mass Spectrometry (ESI-MSn, with n = 1-3) in a series configuration. In particular, absorbance at 520 nm was monitored for UV detection in order to identify pigments responsible for wine colour. On the other hand, two subsequent stages of MS detection based on positive ions were adopted. The first consisted of an explorative MS acquisition, aimed at the individuation of the m/z ratios for positively charged compounds; the second was based on fragmentation of the detected ions within an ion trap analyser, followed by MS/MS and, if required, MS3 acquisitions. The synergy between UV detection and MSn analysis led to the identification of 41 pigments, which can be classified into five groups: grape anthocyanins, pyranoanthocyanins, vinyl-linked anthocyanin-flavanol pigments, ethyl-bridged anthocyanin-flavanol pigments and flavanol-anthocyanin compounds. Many isomeric and oligomeric structures were found within each group. A further class of compounds, not absorbing in the visible spectrum, could be also characterised by ESI-MSn and corresponded to B-type procyanidins, i.e. proanthocyanidins arising from C4-->C8/C4-->C6 couplings between catechin or epicatechin units. In particular, oligomeric structures (from dimers to pentamers), often present with several isomers, were identified and their fragmentation patterns clarified.
Torres, M J; Petroselli, G; Daz, M; Erra-Balsells, R; Audisio, M C
2015-06-01
In this work a new Bacillus sp. strain, isolated from honey, was characterized phylogenetically. Its antibacterial activity against three relevant foodborne pathogenic bacteria was studied; the main bioactive metabolites were analyzed using ultraviolet matrix assisted laser desorption-ionization mass spectrometry (UV-MALDI MS). Bacillus CBMDC3f was phylogenetically characterized as Bacillus subtilis subsp. subtilis after rRNA analysis of the 16S subunit and the gyrA gene (access codes Genbank JX120508 and JX120516, respectively). Its antibacterial potential was evaluated against Listeria monocytogenes (9 strains), B. cereus (3 strains) and Staphylococcus aureus ATCC29213. Its cell suspension and cell-free supernatant (CFS) exerted significant anti-Listeria and anti-S. aureus activities, while the lipopeptides fraction (LF) also showed anti-B. cereus effect. The UV-MALDI-MS analysis revealed surfactin, iturin and fengycin in the CFS, whereas surfactin predominated in the LF. The CFS from CBMDC3f contained surfactin, iturin and fengycin with four, two and four homologues per family, respectively, whereas four surfactin, one iturin and one fengycin homologues were identified in the LF. For some surfactin homologues, their UV-MALDI-TOF/TOF (MS/MS; Laser Induced Decomposition method, LID) spectra were also obtained. Mass spectrometry analysis contributed with relevant information about the type of lipopeptides that Bacillus strains can synthesize. From our results, surfactin would be the main metabolite responsible for the antibacterial effect.
Kim, Jaehee
2015-03-01
The objective of this study was to investigate whether the relationships of appendicular muscle mass (ASM) with insulin resistance (IR) and metabolic syndrome (MS) vary by gender or obesity. Data of 10 146 normal-weight and obese men and women aged 19 to 93 years from the Korea National Health and Nutrition Examination Survey in 2009 and 2010 were analyzed. In normal-weight men and women, unadjusted odds ratio (OR) of being MS and IR significantly increased with lower ASM/wt. After adjusting for lifestyle factors, these ORs were still significant in normal-weight men but not in women. After controlling for other covariates, lower ASM/wt was related to higher risk for IR but not to MS in obese men. In obese women, relationship of lower ASM/wt with higher risk for MS disappeared after adjusting for covariates. Association between skeletal muscle mass and cardiometabolic abnormalities is dependent on gender and obesity in Korean adults. © 2012 APJPH.
NASA Astrophysics Data System (ADS)
Moon, Ceol Joo; Min, Ahreum; Ahn, Ahreum; Lee, Seung Jun; Choi, Myong Yong; Kim, Seong Keun
2013-06-01
Conformational investigations and photochemistry of jet-cooled methacetine (MA) and phenacetine (PA) using one color resonant two-photon ionization (REMPI), UV-UV hole-burning and IR-dip spectroscopy are presented. MA and PA are derivatives of acetanilide, substituted by methoxyl, ethoxyl group in the para position of acetanilide, respectively. Moreover, we have investigated conformational information of the acetanilide derivatives (AAP, MA and PA)-water. In this work, we will present and discuss the solvent effects of the hydroxyl group of acetanilide derivatives in the excited state.
Gökce, Halil; Öztürk, Nuri; Ceylan, Ümit; Alpaslan, Yelda Bingöl; Alpaslan, Gökhan
2016-06-15
In this study, the 5-(3-pyridyl)-4H-1,2,4-triazole-3-thiol molecule (C7H6N4S) molecule has been characterized by using FT-IR, Laser-Raman, NMR and UV-vis spectroscopies. Quantum chemical calculations have been performed to investigate the molecular structure (thione-thiol tautomerism), vibrational wavenumbers, electronic transition absorption wavelengths in DMSO solvent and vacuum, proton and carbon-13 NMR chemical shifts and HOMOs-LUMOs energies at DFT/B3LYP/6-311++G(d,p) level for all five tautomers of the title molecule. The obtained results show that the calculated vibrational wavenumbers, NMR chemical shifts and UV-vis wavelengths are in a good agreement with experimental data. Copyright © 2016 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Shruthi, C.; Ravindrachary, V.; Guruswamy, B.; Lokanath, N. K.; Kumara, Karthik; Goveas, Janet
2018-05-01
Needle shaped brown coloured single crystal of the title compound was grown by slow evaporation technique using methanol as solvent. The grown crystal was characterized using FT-IR, Single crystal XRD, UV-visible and NLO studies. Crystal structure was confirmed by FT-IR study and the functional groups were identified. XRD study reveals that the crystal belongs to orthorhombic crystal system with pnaa space group and the corresponding cell parameters were calculated. UV-visible spectrum shows that the crystal is transparent in the entire visible region and absorption takes place in the UV-range. NLO efficiency of the crystal obtained 0.66 times that of urea was determined by SHG test. The intermolecular interaction and percentage contribution of each individual atom in the crystal lattice was quantized using Hirshfeld surface and 2D finger print analysis.
Atomic Data for Stellar Astrophysics: from the UV to the IR
NASA Technical Reports Server (NTRS)
Wahlgren, Glenn M.
2011-01-01
The study of stars and stellar evolution relies heavily on the analysis of stellar spectra. The need for atomic line data from the ultraviolet (UV) to the infrared (lR) regions is greater now than ever. In the past twenty years, the time since the launch of the Hubble Space Telescope, great progress has been made in acquiring atomic data for UV transitions. The optical wavelength region, now expanded by progress in detector technology, continues to provide motivation for new atomic data. In addition, investments in new instrumentation for ground-based and space observatories has lead to the availability of high-quality spectra at IR wavelengths, where the need for atomic data is most critical. In this review, examples are provided of the progress made in generating atomic data for stellar studies, with a look to the future for addressing the accuracy and completeness of atomic data for anticipated needs.
Andrade, Gabriel Costa de; Fujise, Luciana Harumi; Santana, Jaime Euclides de; Oliveira, Fabiane; Silva, Rita de Cássia Martins Alves da
2016-01-01
NAFLD is an heterogeneous condition that includes steatosis and non-alcoholic steatohepatitis (NASH), in the absence of significant alcohol consumption, reaching 30% of the population. The most common risk factors are: age, gender, ethnicity, diabetes mellitus (DM), obesity, predisposition, metabolic syndrome (MS), insulin resistance (IR), drugs, and polycystic ovary syndrome. To describe the profile of patients with NAFLD seen at Hospital de Base of Rio Preto, in the state of São Paulo. Patients with NAFLD were assessed, with medical and epidemiological data collected after informed consent. Of the 62 patients evaluated, 76% were women, 73% Caucasians, and 71% were aged between 50 and 69 years and had no symptoms. Ultrasonography results showed steatosis in 84%. NASH was diagnosed in 61% of the sample. 21 patients underwent liver biopsy, of which 36% had cirrhosis, 1 had liver cancer, and 1 pure steatosis (5% each). Risk factors were found in 70% of patients with metabolic syndrome, 87% with increased waist circumference, 63% with dyslipidemia, 61% (n=38) with high blood pressure (HBP), 28% with DM, 52% physically inactive, and 44% with insulin resistance (IR) (HOMA> 3.5). There was an association between IR and NASH (p=0.013), IR and obesity (p=0.027), IR and MS (p=0.006), and MS and steatosis on medical ultrasound (USG) (p=0.014). The most frequent risk factors were MS and its variables: increased waist circumference, dyslipidemia and HBP. This underscores the importance of metabolic control in NAFLD and confirms its role as the hepatic component of metabolic syndrome.
The violent interstellar environment around the Wolf-Rayet star HD 192163
NASA Technical Reports Server (NTRS)
Nichols-Bohlin, Joy; Fesen, Robert A.
1993-01-01
IRAS Skyflux IR images, high-dispersion IUE UV spectra, optical spectra, and optical interference filter images are used to investigate the nature of the interstellar environment around the Wolf-Rayet star HD 192163. IRAS images show an apparent 1.5 x 1.8 deg IR emission shell very nearly centered on HD 192163, which is designated G75.5+2.4. It is suggested that this shell is a possible unrecognized SNR with an estimated age of not less than 100,000 yr if at the assumed 1.8-kpc distance of HD 192163. A well-defined 2 x 4.5 deg region of weak IR emission lying to the southeast of HD 192163 appears to be the IR signature of the Cyg OB1 superbubble. Analysis of IUE spectra shows that high-velocity components of UV interstellar absorption lines are present for both high and low ionization lines in 18 of 22 stars located in the Cyg OB1/OB3 direction with a velocity range of +/- 90 km/s. A possible evolutionary history for this region is outlined.
2011-01-01
Background Disturbances of the fatty acids composition in plasma and red blood cells and eicosanoid synthesis play an important role in the metabolic syndrome (MS) formation. Methods The observation group included 61 people with metabolic syndrome (30 patients with MS and normal levels of insulin, 31 people with MS and insulin resistance - IR). The parameters of carbohydrate and lipid metabolism in blood serum were examined. The composition of nonesterified fatty acids (NEFA), fatty acid (FA) of red blood cells lipids was analyzed by gas-liquid chromatography. Eicosanoids level in MS patients blood serum was studied by enzyme immunoassay. Results In MS patients in the absence of glucose-insulin homeostasis disturbances and in patients with IR the accumulation of polyunsaturated fatty acids (18:2 n6, 18:3 n3, 22:4 n6) and lower pool of saturated FA (12:0, 14:0, 16: 0, 17:0) in plasma were discovered. A deficit of polyunsaturated FA (18:3 n3, 20:4 n6) with a predominance of on-saturated FA (14:0, 18:0) in erythrocyte membranes was revealed. In MS patients regardless of the carbohydrate metabolism status high levels of leukotriene B4 and 6-keto-prostaglandin-F1α in serum were found. The development of IR in MS patients leads to increased synthesis of thromboxane A2. Conclusion The results revealed a disturbance in nonesterified fatty acids of plasma lipids and red blood cells, eicosanoid synthesis in MS patients. The breach of the plasma and cell membranes fatty acids compositions, synthesis of vasoactive and proinflammatory eicosanoids is an important pathogenetic part of the MS development. PMID:21595891
12 years of Phobos observations by Omega and Spicam on board MEX
NASA Astrophysics Data System (ADS)
Gondet, Brigitte; Bertaux, Jean-Loup; Omega Team, Spicam Team
2016-10-01
Mars Express made several encounters with Phobos and a few with Deimos since 2004. Observations with SPICAM and OMEGA imaging spectrometers on board Mars Express covers the range from UV (110-312 nm) to visible and mid IR up to 5 µm. In the following we consider the ultraviolet (UV) channel of SPICAM and only the visible channel of OMEGA and its small UV extension down to 390 nm, in order to compare with SPICAM. Preliminary results were presented already in the past [1]. Since then, a more detailed analysis was carried out, subtracting some internally scattered light affecting the SPICAM UV retrieved reflectance.The combined spectrum of Radiance Factor from SPICAM and OMEGA suggests the presence of a deep absorption feature. Both instruments, taken separately, support also this absorption feature.In the visible part of CRISM [2] on board MRO and recently confirmed by Omega, one feature is centered at 0.65 µm, with an absorption depth varying from 0 to 4%, an other one is centered at 2.8µm. These two Visible IR features were interpreted [2] either to highly desiccated Fe-phyllosilicate minerals indigenous to the bodies, or to a surface process involving Rayleigh scattering and absorption of small iron particles formed by exogenic space weathering processing.In this rather uncertain situation, the UV band detected by SPICAM and OMEGA on board Mars Express is of great importance to attempt discriminating between the two scenarios proposed above to explain the Visible-IR reflectance spectra of Phobos.[1] Bertaux J.L. et al. (2011) EPSC/DPS conference abstract, Nantes, November 2011. [[2] Freaman A.A. et al. (2014) Icarus, 229 , 196-205.
Loziuk, Philip; Meier, Florian; Johnson, Caroline
2016-01-01
Quantitative methods for detection of biological molecules are needed more than ever before in the emerging age of “omics” and “big data.” Here, we provide an integrated approach for systematic analysis of the “lipidome” in tissue. To test our approach in a biological context, we utilized brain tissue selectively deficient for the transcription factor Specificity Protein 2 (Sp2). Conditional deletion of Sp2 in the mouse cerebral cortex results in developmental deficiencies including disruption of lipid metabolism. Silver (Ag) cationization was implemented for infrared matrix-assisted laser desorption electrospray ionization (IR-MALDESI) to enhance the ion abundances for olefinic lipids, as these have been linked to regulation by Sp2. Combining Ag-doped and conventional IR-MALDESI imaging, this approach was extended to IR-MALDESI imaging of embryonic mouse brains. Further, our imaging technique was combined with bottom-up shotgun proteomic LC-MS/MS analysis and western blot for comparing Sp2 conditional knockout (Sp2-cKO) and wild-type (WT) cortices of tissue sections. This provided an integrated omics dataset which revealed many specific changes to fundamental cellular processes and biosynthetic pathways. In particular, step-specific altered abundances of nucleotides, lipids, and associated proteins were observed in the cerebral cortices of Sp2-cKO embryos. PMID:26942738
Mardones, Francisco; Arnaiz, Pilar; Pacheco, Paz; Dominguez, Angelica; Villarroel, Luis; Eriksson, Johan G; Barja, Salesa; Farías, Marcelo; Castillo, Oscar
2014-01-01
The association of prenatal growth with nutritional status, metabolic syndrome (MS), and insulin resistance (IR) was studied in school-age children. A retrospective cohort study was designed linking present data of children with perinatal records. 3325 subjects were enrolled. Anthropometry, blood pressure (BP), and pubertal status were assessed. Blood lipids, glucose, and insulin were measured. Linear associations were assessed using the Cochran-Armitage test. Odds ratios and nonlinear associations were computed. 3290 children (52% females, mean age of 11.4 ± 1 years) were analyzed. Prevalence of obesity, stunting, MS, and IR was 16.0%, 3.6%, 7.3%, and 25.5%, respectively. The strongest positive association was between birth weight (BW) and obesity (OR 2.97 (95% CI 2.01-4.40) at BW ≥ 4,000 g compared to BW 2,500-2,999). The strongest inverse association was between birth length (BL) and stunting (OR 8.70 (95% CI 3.66-20.67) at BL < 48 cm compared to BL 52-53 cm). A U-shaped association between BL and BP ≥ 90th percentile was observed. Significant ORs were also found for MS and IR. Adjustments for present fat mass increased or maintained the most prenatal growth influences. Prenatal growth influences MS, IR, and nutritional status. Prenatal growth was more important than present body composition in determining these outcomes.
Sakota, Kenji; Kageura, Yutaka; Sekiya, Hiroshi
2008-08-07
IR-UV ion-dip spectra of the 7-azaindole (7AI)(CH(3)OH)(n) (n=1-3) clusters have been measured in the hydrogen-bonded NH and OH stretching regions to investigate the stable structures of 7AI(CH(3)OH)(n) (n=1-3) in the S(0) state and the cooperativity of the H-bonding interactions in the H-bonded networks. The comparison of the IR-UV ion-dip spectra with IR spectra obtained by quantum chemistry calculations shows that 7AI(CH(3)OH)(n) (n=1-3) have cyclic H-bonded structures, where the NH group and the heteroaromatic N atom of 7AI act as the proton donor and proton acceptor, respectively. The H-bonded OH stretch fundamental of 7AI(CH(3)OH)(2) is remarkably redshifted from the corresponding fundamental of (CH(3)OH)(2) by 286 cm(-1), which is an experimental manifestation of the cooperativity in H-bonding interaction. Similarly, two localized OH fundamentals of 7AI(CH(3)OH)(3) also exhibit large redshifts. The cooperativity of 7AI(CH(3)OH)(n) (n=2,3) is successfully explained by the donor-acceptor electron delocalization interactions between the lone-pair orbital in the proton acceptor and the antibonding orbital in the proton donor in natural bond orbital (NBO) analyses.
NASA Astrophysics Data System (ADS)
Forrest, Ben; Tran, Kim-Vy H.; Tomczak, Adam R.; Broussard, Adam; Labbé, Ivo; Papovich, Casey; Kriek, Mariska; Allen, Rebecca J.; Cowley, Michael; Dickinson, Mark; Glazebrook, Karl; van Houdt, Josha; Inami, Hanae; Kacprzak, Glenn G.; Kawinwanichakij, Lalitwadee; Kelson, Daniel; McCarthy, Patrick J.; Monson, Andrew; Morrison, Glenn; Nanayakkara, Themiya; Persson, S. Eric; Quadri, Ryan F.; Spitler, Lee R.; Straatman, Caroline; Tilvi, Vithal
2016-02-01
We build a set of composite galaxy spectral energy distributions (SEDs) by de-redshifting and scaling multi-wavelength photometry from galaxies in the ZFOURGE survey, covering the CDFS, COSMOS, and UDS fields. From a sample of ˜4000 Ks-band selected galaxies, we define 38 composite galaxy SEDs that yield continuous low-resolution spectra (R ˜ 45) over the rest-frame range 0.1-4 μm. Additionally, we include far infrared photometry from the Spitzer Space Telescope and the Herschel Space Observatory to characterize the infrared properties of our diverse set of composite SEDs. From these composite SEDs we analyze the rest-frame UVJ colors, as well as the ratio of IR to UV light (IRX) and the UV slope (β) in the IRX-β dust relation at 1 < z < 3. Blue star-forming composite SEDs show IRX and β values consistent with local relations; dusty star-forming galaxies have considerable scatter, as found for local IR bright sources, but on average appear bluer than expected for their IR fluxes. We measure a tight linear relation between rest-frame UVJ colors and dust attenuation for star-forming composites, providing a direct method for estimating dust content from either (U - V) or (V-J) rest-frame colors for star-forming galaxies at intermediate redshifts. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile.
Virus Sensitivity Index of UV disinfection.
Tang, Walter Z; Sillanpää, Mika
2015-01-01
A new concept of Virus Sensitivity Index (VSI) is defined as the ratio between the first-order inactivation rate constant of a virus, ki, and that of MS2-phage during UV disinfection, kr. MS2-phage is chosen as the reference virus because it is recommended as a virus indicator during UV reactor design and validation by the US Environmental Protection Agency. VSI has wide applications in research, design, and validation of UV disinfection systems. For example, it can be used to rank the UV disinfection sensitivity of viruses in reference to MS2-phage. There are four major steps in deriving the equation between Hi/Hr and 1/VSI. First, the first-order inactivation rate constants are determined by regression analysis between Log I and fluence required. Second, the inactivation rate constants of MS2-phage are statistically analysed at 3, 4, 5, and 6 Log I levels. Third, different VSI values are obtained from the ki of different viruses dividing by the kr of MS2-phage. Fourth, correlation between Hi/Hr and 1/VSI is analysed by using linear, quadratic, and cubic models. As expected from the theoretical analysis, a linear relationship adequately correlates Hi/Hr and 1/VSI without an intercept. VSI is used to quantitatively predict the UV fluence required for any virus at any log inactivation (Log I). Four equations were developed at 3, 4, 5, and 6 Log I. These equations have been validated using external data which are not used for the virus development. At Log I less than 3, the equation tends to under-predict the required fluence at both low Log I such as 1 and 2 Log I. At Log I greater than 3 Log I, the equation tends to over-predict the fluence required. The reasons for these may very likely be due to the shoulder at the beginning and the tailing at the end of the collimated beam test experiments. At 3 Log I, the error percentage is less than 6%. The VSI is also used to predict inactivation rate constants under two different UV disinfection scenarios such as under sunlight and different virus aggregates. The correlation analysis shows that viruses will be about 40% more sensitive to sunlight than to UV254. On the other hand, virus size of 500 nm will reduce their VSI by 10%. This is the first attempt to use VSI to predict the required fluence at any given Log I. The equation can be used to quantitatively evaluate other parameters influencing UV disinfection. These factors include environmental species, antibiotic-resistant bacteria or genes, photo and dark repair, water quality such as suspended solids, and UV transmittance.
St-Jacques, Antony; Anichina, Janna; Schneider, Bradley B; Covey, Thomas R; Bohme, Diethard K
2010-07-15
Differential mobility spectrometry has been applied to reveal the occurrence of isomerization of thymine nucleobase and of thymine dideoxynucleotide d(5'-TT-3') due to bond redisposition induced by UV irradiation at 254 nm of frozen aqueous solutions of these molecules. Collision-induced dissociation (CID) spectra of electrosprayed photoproducts of the thymine solution suggest the presence of two isomers (the so-called cyclobutane and 6,4-photoproducts) in addition to the proton-bound thymine dimer, and these were separated using differential mobility spectrometry/mass spectrometry (DMS/MS) techniques with water as the modifier. Similar experiments with d(5'-TT-3') revealed the formation of a new isomer of deprotonated thymine dideoxynucleotide upon UV irradiation that was easily distinguished using DMS/MS with isopropanol as the modifier. The results reinforce the usefulness of DMS/MS in isomer separation.
Hashimoto, Mitsuhiro; Hata, Akihiro; Miyata, Takaki; Hirase, Hajime
2014-01-01
Abstract. We produced a miniaturized, multicode, multiband, and programmable light-emitting diode (LED) stimulator for wireless control of optogenetic experiments. The LED stimulator is capable of driving three independent LEDs upon reception of an infrared (IR) signal generated by a custom-made IR transmitter. Individual LED photopulse patterns are assigned to different codes of the IR signals (up to 256 codes). The photopulse patterns can be programmed in the on-board microcontroller by specifying the parameters of duration (>1 ms), frequency (<500 Hz), and pulse width (>1 ms). The IR signals were modulated at multiple carrier frequencies to establish multiband IR transmission. Using these devices, we could remotely control the moving direction of a Thy1-ChR2-YFP transgenic mouse by transcranially illuminating the corresponding hemisphere of the primary motor cortex. IR transmitter and LED stimulator will be particularly useful in experiments where free movement or patterned concurrent stimulation is desired, such as testing social communication of rodents. PMID:26157963
NASA Technical Reports Server (NTRS)
Petty, S. M.; Neill, J. D.; Jarrett, T. H.; Blain, A. W.; Farrah, D. G.; Rich, R. M.; Tsai, C.-W.; Benford, D. J.; Bridge, C. R.; Lake, S. E.;
2013-01-01
In the local universe, 10% of massive elliptical galaxies are observed to exhibit a peculiar property: a substantial excess of ultraviolet emission than what is expected from their old, red stellar populations. Several origins for this ultraviolet excess (UVX) have been proposed including a population of hot young stars and a population of old, blue horizontal branch or extended horizontal branch (BHB or EHB) stars that have undergone substantial mass loss from their outer atmospheres. We explore the radial distribution of UVX in a selection of 49 nearby E/S0-type galaxies by measuring their extended photometry in the UV through mid-infrared (mid-IR) with the Galaxy Evolution Explorer (GALEX), the Sloan Digital Sky Survey, and the Wide-field Infrared Survey Explorer (WISE). We compare UV/optical and UV/mid-IR colors with the Flexible Stellar Population Synthesis models, which allow for the inclusion of EHB stars. We find that combined WISE mid-IR and GALEX UV colors are more effective in distinguishing models than optical colors, and that the UV/mid-IR combination is sensitive to the EHB fraction. There are strong color gradients, with the outer radii bluer than the inner half-light radii by approx.1 mag. This color difference is easily accounted for with an increase in the BHB fraction of 0.25 with radius. We estimated that the average ages for the inner and outer radii are 7.0 +/- 0.3 Gyr, and 6.2 +/- 0.2 Gyr, respectively, with the implication that the outer regions are likely to have formed approx. 1 Gyr after the inner regions. Additionally, we find that metallicity gradients are likely not a significant factor in the color difference. The separation of color between the inner and outer regions, which agrees with a specific stellar population difference (e.g., higher EHB populations), and the approx. 0.5-2 Gyr age difference suggests multi-stage formation. Our results are best explained by inside-out formation: rapid star formation within the core at early epochs (>4 Gyr ago) and at least one later stage starburst event coinciding with z approx. 1.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Petty, S. M.; Farrah, D. G.; Neill, J. D.
2013-10-01
In the local universe, 10% of massive elliptical galaxies are observed to exhibit a peculiar property: a substantial excess of ultraviolet emission than what is expected from their old, red stellar populations. Several origins for this ultraviolet excess (UVX) have been proposed including a population of hot young stars and a population of old, blue horizontal branch or extended horizontal branch (BHB or EHB) stars that have undergone substantial mass loss from their outer atmospheres. We explore the radial distribution of UVX in a selection of 49 nearby E/S0-type galaxies by measuring their extended photometry in the UV through mid-infraredmore » (mid-IR) with the Galaxy Evolution Explorer (GALEX), the Sloan Digital Sky Survey, and the Wide-field Infrared Survey Explorer (WISE). We compare UV/optical and UV/mid-IR colors with the Flexible Stellar Population Synthesis models, which allow for the inclusion of EHB stars. We find that combined WISE mid-IR and GALEX UV colors are more effective in distinguishing models than optical colors, and that the UV/mid-IR combination is sensitive to the EHB fraction. There are strong color gradients, with the outer radii bluer than the inner half-light radii by {approx}1 mag. This color difference is easily accounted for with an increase in the BHB fraction of 0.25 with radius. We estimated that the average ages for the inner and outer radii are 7.0 {+-} 0.3 Gyr, and 6.2 {+-} 0.2 Gyr, respectively, with the implication that the outer regions are likely to have formed {approx}1 Gyr after the inner regions. Additionally, we find that metallicity gradients are likely not a significant factor in the color difference. The separation of color between the inner and outer regions, which agrees with a specific stellar population difference (e.g., higher EHB populations), and the {approx}0.5-2 Gyr age difference suggests multi-stage formation. Our results are best explained by inside-out formation: rapid star formation within the core at early epochs (>4 Gyr ago) and at least one later stage starburst event coinciding with z {approx} 1.« less
NASA Astrophysics Data System (ADS)
Traill, Robert R.
2011-12-01
The most toxic asbestos fibres have widths 250nm-10nm, and this toxicity is "physical", which could mean either mechanical or optical: Tangling with chromosomes is a •mechanical hazard occasionally reported, and fibres <100nm wide would probably be most knife-like. Our other concern here is •optical: Calculations for fibres <=300nm reveal such a transmission possibility, but only when the amphibole fibres (brown and blue asbestos) are >100nm wide — or chrysotile (white asbestos) is >150nm. In both cases, UVA/UVB -transmission would then predominate. (Chrysotile 150nm might be benign — escaping both mechanical and optical!). But what would generate such UV, and why would its transmission be toxic? Thar and Kühl (J.Theor.Biol.:2004) explain that the long mitochondria on microtubules may be able to act as UV-lasers, (and many observers since Gurwitsch 1923 have reported ultraweak UV emissions escaping from all types of living bio-tissue). That all suggests some universal secret role for UV, apparently related to mitosis. Insertion of fibre "short-circuits" could then cause upsets in mitosis-control, and hence DNA irregularities. Such UV-control could parallel similar lower-powered Infra-Red control-systems (as considered elsewhere for coaxial myelin; or as portrayed by G.Albrecht-Buehler's online animations etc.); and the traditional short mitochondria seem better suited for this IR task.
Naganawa, Shinji; Koshikawa, Tokiko; Nakamura, Tatsuya; Fukatsu, Hiroshi; Ishigaki, Takeo; Aoki, Ikuo
2003-12-01
The small structures in the temporal bone are surrounded by bone and air. The objectives of this study were (a) to compare contrast-enhanced T1-weighted images acquired by fast spin-echo-based three-dimensional real inversion recovery (3D rIR) against those acquired by gradient echo-based 3D SPGR in the visualization of the enhancement of small structures in the temporal bone, and (b) to determine whether either 3D rIR or 3D SPGR is useful for visualizing enhancement of the cochlear lymph fluid. Seven healthy men (age range 27-46 years) volunteered to participate in this study. All MR imaging was performed using a dedicated bilateral quadrature surface phased-array coil for temporal bone imaging at 1.5 T (Visart EX, Toshiba, Tokyo, Japan). The 3D rIR images (TR/TE/TI: 1800 ms/10 ms/500 ms) and flow-compensated 3D SPGR images (TR/TE/FA: 23 ms/10 ms/25 degrees) were obtained with a reconstructed voxel size of 0.6 x 0.7 x 0.8 mm3. Images were acquired before and 1, 90, 180, and 270 min after the administration of triple-dose Gd-DTPA-BMA (0.3 mmol/kg). In post-contrast MR images, the degree of enhancement of the cochlear aqueduct, endolymphatic sac, subarcuate artery, geniculate ganglion of the facial nerve, and cochlear lymph fluid space was assessed by two radiologists. The degree of enhancement was scored as follows: 0 (no enhancement); 1 (slight enhancement); 2 (intermediate between 1 and 3); and 3 (enhancement similar to that of vessels). Enhancement scores for the endolymphatic sac, subarcuate artery, and geniculate ganglion were higher in 3D rIR than in 3D SPGR. Washout of enhancement in the endolymphatic sac appeared to be delayed compared with that in the subarcuate artery, suggesting that the enhancement in the endolymphatic sac may have been due in part to non-vascular tissue enhancement. Enhancement of the cochlear lymph space was not observed in any of the subjects in 3D rIR and 3D SPGR. The 3D rIR sequence may be more sensitive than the 3D SPGR sequence in visualizing the enhancement of small structures in the temporal bone; however, enhancement of the cochlear fluid space could not be visualized even with 3D rIR, triple-dose contrast, and dedicated coils at 1.5 T.
Kallio, Heikki; Yang, Wei; Liu, Pengzhan; Yang, Baoru
2014-08-06
A rapid and sensitive method for profiling of proanthocyanidins (PAs) of sea buckthorn (Hippophaë rhamnoides) berries was established based on aqueous, acidified acetone extraction. The extract was purified by Sephadex column chromatography and analyzed using reversed-phase, normal-phase, and hydrophilic interaction liquid chromatography (HILIC). Negative ion electrospray ionization mass spectrometry (ESI-MS) in single ion recording (SIR) and full scan modes combined with UV detection were used to define the combinations and ratios of PA oligomer classes. PAs with degree of polymerization from 2 to 11 were detected by HILIC-ESI-MS. Quantification of dimeric, trimeric, and tetrameric PAs was carried out with ESI-MS-SIR, and their molar proportions were 40, 40, and 20%, respectively. Only B-type PAs were found, and (epi)gallocatechins were the main monomeric units. More than 60 combinations of (epi)catechins and (epi)gallocatechins of proanthocyanidin dimers and trimers were found. A majority of the PAs were shown to be higher polymers based on the HILIC-UV analysis.
Gören, Ahmet C; Bilsel, Gökhan; Şimşek, Adnan; Bilsel, Mine; Akçadağ, Fatma; Topal, Kevser; Ozgen, Hasan
2015-05-15
High Performance Liquid Chromatography LC-UV and LC-MS/MS methods were developed and validated for quantitative analyses of sodium benzoate and potassium sorbate in foods and beverages. HPLC-UV and LC-MS/MS methods were compared for quantitative analyses of sodium benzoate and potassium sorbate in a representative ketchup sample. Optimisation of the methods enabled the chromatographic separation of the analytes in less than 4 min. A correlation coefficient of 0.999 was achieved over the measured calibration range for both compounds and methods (HPLC and LC-MS/MS). The uncertainty values of sodium benzoate and potassium sorbate were found as 0.199 and 0.150 mg/L by HPLC and 0.072 and 0.044 mg/L by LC-MS/MS, respectively. Proficiency testing performance of Turkish accredited laboratories between the years 2005 and 2013 was evaluated and reported herein. The aim of the proficiency testing scheme was to evaluate the performance of the laboratories, analysing benzoate and sorbate in tomato ketchup. Copyright © 2014 Elsevier Ltd. All rights reserved.
Nestola, Marco; Thellmann, Andrea
2015-01-01
An online normal-phase liquid chromatography-gas chromatography-mass spectrometry (HPLC-GC-MS) method was developed for the determination of vitamins D2 and D3 in selected food matrices. Transfer of the sample from HPLC to GC was realized by large volume on-column injection; detection was performed with a time-of-flight mass spectrometer (TOF-MS). Typical GC problems in the determination of vitamin D such as sample degradation or sensitivity issues, previously reported in the literature, were not observed. Determination of total vitamin D content was done by quantitation of its pyro isomer based on an isotopically labelled internal standard (ISTD). Extracted ion traces of analyte and ISTD showed cross-contribution, but non-linearity of the calibration curve was not determined inside the chosen calibration range by selection of appropriate quantifier ions. Absolute limits of detection (LOD) and quantitation (LOQ) for vitamins D2 and D3 were calculated as approximately 50 and 150 pg, respectively. Repeatability with internal standard correction was below 2 %. Good agreement between quantitative results of an established high-performance liquid chromatography with UV detection (HPLC-UV) method and HPLC-GC-MS was found. Sterol-enriched margarine was subjected to HPLC-GC-MS and HPLC-MS/MS for comparison, because HPLC-UV showed strong matrix interferences. HPLC-GC-MS produced comparable results with less manual sample cleanup. In summary, online hyphenation of HPLC and GC allowed a minimization in manual sample preparation with an increase of sample throughput.
Hu, Qinqin; Xu, Xiahong; Li, Zhanming; Zhang, Ying; Wang, Jianping; Fu, Yingchun; Li, Yanbin
2014-04-15
Acrylamide is a neurotoxin and potential carcinogen, but is found in various thermally processed foods such as potato chips, biscuits, and coffee. Simple and sensitive methods for on-line detection of acrylamide are needed to ensure food safety. In this paper, a novel fluorescent sensing method based on acrylamide polymerization-induced distance increase between quantum dots (QDs) was proposed for detecting acrylamide in potato chips. The functional QDs were prepared by their binding with N-acryloxysuccinimide (NAS), which was characterized by Fourier transform infrared (FR-IR) spectra. The carbon-carbon double bonds of NAS modified QDs polymerized with assistance of photo initiator under UV irradiation, leading to QDs getting closer along with fluorescence intensity decreasing. Acrylamide in the sample participated in the polymerization and induced an increase of fluorescence intensity. This method possessed a linear range from 3.5×10(-5) to 3.5 g L(-1) (r(2)=0.94) and a limit of detection of 3.5×10(-5) g L(-1). Although the sensitivity and specificity cannot be compared with standard LC-MS/MS analysis, this new method requires much less time and cost, which is promising for on-line rapid detection of acrylamide in food processing. © 2013 Published by Elsevier B.V.
Substrate-Mediated Laser Ablation under Ambient Conditions for Spatially-Resolved Tissue Proteomics
Fatou, Benoit; Wisztorski, Maxence; Focsa, Cristian; Salzet, Michel; Ziskind, Michael; Fournier, Isabelle
2015-01-01
Numerous applications of ambient Mass Spectrometry (MS) have been demonstrated over the past decade. They promoted the emergence of various micro-sampling techniques such as Laser Ablation/Droplet Capture (LADC). LADC consists in the ablation of analytes from a surface and their subsequent capture in a solvent droplet which can then be analyzed by MS. LADC is thus generally performed in the UV or IR range, using a wavelength at which analytes or the matrix absorb. In this work, we explore the potential of visible range LADC (532 nm) as a micro-sampling technology for large-scale proteomics analyses. We demonstrate that biomolecule analyses using 532 nm LADC are possible, despite the low absorbance of biomolecules at this wavelength. This is due to the preponderance of an indirect substrate-mediated ablation mechanism at low laser energy which contrasts with the conventional direct ablation driven by sample absorption. Using our custom LADC system and taking advantage of this substrate-mediated ablation mechanism, we were able to perform large-scale proteomic analyses of micro-sampled tissue sections and demonstrated the possible identification of proteins with relevant biological functions. Consequently, the 532 nm LADC technique offers a new tool for biological and clinical applications. PMID:26674367
Zhang, Haiyang; Ou, Junjie; Wei, Yinmao; Wang, Hongwei; Liu, Zhongshan; Zou, Hanfa
2016-04-01
A hybrid fluorous monolithic column was simply prepared via photo-initiated free radical polymerization of an acrylopropyl polyhedral oligomeric silsesquioxane (acryl-POSS) and a perfluorous monomer (2,2,3,3,4,4,5,5,6,6,7,7-dodecafluoroheptyl acrylate) in UV-transparent fused-silica capillaries within 5min. The physical characterization of hybrid fluorous monolith, including scanning electron microscopy (SEM), Fourier transform infrared (FT-IR) spectroscopy, mercury intrusion porosimetry (MIP) and nitrogen adsorption/desorption measurement was performed. Chromatographic performance was also evaluated by capillary liquid chromatography (cLC). Due to the fluorous-fluorous interaction between fluorous monolith and analytes, fluorobenzenes could well be separated, and the column efficiencies reached 86,600-92,500plates/m at the velocity of 0.87mm/s for alkylbenzenes and 51,900-76,000plates/m at the velocity of 1.10mm/s for fluorobenzenes. Meanwhile, an approach to integrate nanoelectrospray ionization (ESI) emitter with hybrid fluorous monolithic column was developed for quantitative determination of perfluoroalkyl acids by nanoHPLC-ESI-MS/MS. The integration design could minimize extracolumn volume, thus excluding undesirable peak broadening and improving separation performance. Copyright © 2016 Elsevier B.V. All rights reserved.
Chen, Yuyan; Li, Chunlei; Zhu, Jianhua; Xie, Wangshi; Hu, Xianjing; Song, Liyan; Zi, Jiachen; Yu, Rongmin
2017-03-01
A polypeptide coded as PGC was isolated from Arca subcrenata muscle using ion exchange, Sephadex G-50 gel chromatography and RP-HPLC. PGC was identified to be a homogeneous compound by Native-PAGE and the purity was more than 98.9% measured by HPLC. The isoelectric point of PGC was determined to be 9.76 by IEF-PAGE. The molecular weight was determined to be 15,973.0Da by ESI-MS/MS. The conformational structure of PGC was characterized by UV-vis, FT-IR and CD spectroscopy. N terminal amino acid sequence of PGC was shown as PSVYDAAAQLTADVKKDLRDSWKVIGGDKKGNGVA by Edman degradation. The results demonstrated that there is a high degree of homology between PGC and the subunit from hemoglobin, and proposed that PGC is the depolymerized polypeptide of Hemoglobin I (HbI) from A. subcrenata. The evaluation of biological activities showed that the diameters of the inhibitory ring of PGC on Escherichia coli and Staphylococcus aureus were 14.5±0.44mm and 16.5±1.15mm, respectively. The IC 50 of inhibition rate for PGC on NO production was 9.60±0.71μg/mL. Therefore, PGC might be developed as one of potential antibacterial and anti-inflammatory agents. Copyright © 2016 Elsevier B.V. All rights reserved.
Lin, Chung-Ho; Lerch, Robert N.; Thurman, E. Michael; Garrett , Harold E.; George, Milon F.
2002-01-01
Balance (isoxaflutole, IXF) belongs to a new family of herbicides referred to as isoxazoles. IXF has a very short soil half-life (<24 h), degrading to a biologically active diketonitrile (DKN) metabolite that is more polar and considerably more stable. Further degradation of the DKN metabolite produces a nonbiologically active benzoic acid (BA) metabolite. Analytical methods using solid phase extraction followed by high-performance liquid chromatography−UV (HPLC-UV) or high-performance liquid chromatography−mass spectrometry (HPLC-MS) were developed for the analysis of IXF and its metabolites in distilled deionized water and ground water samples. To successfully detect and quantify the BA metabolite by HPLC-UV from ground water samples, a sequential elution scheme was necessary. Using HPLC-UV, the mean recoveries from sequential elution of the parent and its two metabolites from fortified ground water samples ranged from 68.6 to 101.4%. For HPLC-MS, solid phase extraction of ground water samples was performed using a polystyrene divinylbenzene polymer resin. The mean HPLC-MS recoveries of the three compounds from ground water samples spiked at 0.05−2 μg/L ranged from 100.9 to 110.3%. The limits of quantitation for HPLC-UV are approximately 150 ng/L for IXF, 100 ng/L for DKN, and 250 ng/L for BA. The limit of quantitation by HPLC-MS is 50 ng/L for each compound. The methods developed in this work can be applied to determine the transport and fate of Balance in the environment.
Lin, Chung-Ho; Lerch, Robert N; Thurman, E Michael; Garrett, Harold E; George, Milon F
2002-10-09
Balance (isoxaflutole, IXF) belongs to a new family of herbicides referred to as isoxazoles. IXF has a very short soil half-life (<24 h), degrading to a biologically active diketonitrile (DKN) metabolite that is more polar and considerably more stable. Further degradation of the DKN metabolite produces a nonbiologically active benzoic acid (BA) metabolite. Analytical methods using solid phase extraction followed by high-performance liquid chromatography-UV (HPLC-UV) or high-performance liquid chromatography-mass spectrometry (HPLC-MS) were developed for the analysis of IXF and its metabolites in distilled deionized water and ground water samples. To successfully detect and quantify the BA metabolite by HPLC-UV from ground water samples, a sequential elution scheme was necessary. Using HPLC-UV, the mean recoveries from sequential elution of the parent and its two metabolites from fortified ground water samples ranged from 68.6 to 101.4%. For HPLC-MS, solid phase extraction of ground water samples was performed using a polystyrene divinylbenzene polymer resin. The mean HPLC-MS recoveries of the three compounds from ground water samples spiked at 0.05-2 microg/L ranged from 100.9 to 110.3%. The limits of quantitation for HPLC-UV are approximately 150 ng/L for IXF, 100 ng/L for DKN, and 250 ng/L for BA. The limit of quantitation by HPLC-MS is 50 ng/L for each compound. The methods developed in this work can be applied to determine the transport and fate of Balance in the environment.
Khaleel, Nareman D H; Mahmoud, Waleed M M; Hadad, Ghada M; Abdel-Salam, Randa A; Kümmerer, Klaus
2013-01-15
Sulfonamides are one of the most frequently used antibiotics worldwide. Therefore, mitigation processes such as abiotic or biotic degradation are of interest. Photodegradation and biodegradation are the potentially significant removal mechanisms for pharmaceuticals in aquatic environments. The photolysis of sulfamethoxypyridazine (SMP) using a medium pressure Hg-lamp was evaluated in three different media: Millipore water pH 6.1 (MW), effluent from sewage treatment plant pH 7.6 (STP), and buffered demineralized water pH 7.4 (BDW). Identification of transformation products (TPs) was performed by LC-UV-MS/MS. The biodegradation of SMP using two tests from the OECD series was studied: Closed Bottle test (OECD 301 D), and Manometric Respirometry test (OECD 301 F). In biodegradation tests, it was found that SMP was not readily biodegradable so it may pose a risk to the environment. The results showed that SMP was removed completely within 128 min of irradiation in the three media, and the degradation rate was different for each investigated type of water. However, dissolved organic carbon (DOC) was not removed in BDW and only little DOC removal was observed in MW and STP, thus indicating the formation of TPs. Analysis by LC-UV-MS/MS revealed new TPs formed. The hydroxylation of SMP represents the main photodegradation pathway. Copyright © 2012 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Gonzaga, S.; et al.
2011-03-01
ACS was designed to provide a deep, wide-field survey capability from the visible to near-IR using the Wide Field Camera (WFC), high resolution imaging from the near-UV to near-IR with the now-defunct High Resolution Camera (HRC), and solar-blind far-UV imaging using the Solar Blind Camera (SBC). The discovery efficiency of ACS's Wide Field Channel (i.e., the product of WFC's field of view and throughput) is 10 times greater than that of WFPC2. The failure of ACS's CCD electronics in January 2007 brought a temporary halt to CCD imaging until Servicing Mission 4 in May 2009, when WFC functionality was restored. Unfortunately, the high-resolution optical imaging capability of HRC was not recovered.
Preferred mirror coatings for UV, visible, and IR space optical instruments
NASA Astrophysics Data System (ADS)
Heaney, James B.; Kauder, Lonny R.; Freese, Scott C.; Quijada, Manuel A.
2012-09-01
This paper will review the suitability of the common four types of reflecting surfaces - Ag, Al, Au and Be - for use aboard satellite borne remote sensing and astrophysical observatories, from the uv to far-ir spectral bands. The choice of appropriate protecting and reflectance enhancing overcoats for these reflecting metals will be discussed. Laboratory test data and optical diagnostic techniques used to verify durability of the selected coatings in a terrestrial storage environment and their sensitivity to a space radiation and cold temperature environment will be presented. For some of the selected coatings, a connection will be made between pre-launch laboratory quality checks and post-launch performance on orbit.
NASA Astrophysics Data System (ADS)
Buat, V.; Heinis, S.; Boquien, M.
2013-11-01
We report on our recent works on the UV-to-IR SED fitting of a sample of distant (z>1) galaxies observed by Herschel in the CDFS as part of the GOODS-Herschel project. Combining stellar and dust emission in galaxies is found powerful to constrain their dust attenuation as well as their star formation activity. We focus on the caracterisation of dust attenuation and on the uncertainties on the derivation of the star formation rates and stellar masses, as a function of the range of wavelengths sampled by the data data and of the assumptions made on the star formation histories
Enqvist, Kari; Sloth, Martin S
2004-11-26
We investigate a possible connection between the suppression of the power at low multipoles in the cosmic microwave background (CMB) spectrum and the late time acceleration. We show that, assuming a cosmic IR/UV duality between the UV cutoff and a global infrared cutoff given by the size of the future event horizon, the equation of state of the dark energy can be related to the apparent cutoff in the CMB spectrum. The present limits on the equation of state of dark energy are shown to imply an IR cutoff in the CMB multipole interval of 9>l>8.5.
Activity and Kinematics of White Dwarf-M Dwarf Binaries from the SUPERBLINK Proper Motion Survey
NASA Astrophysics Data System (ADS)
Skinner, Julie N.; Morgan, Dylan P.; West, Andrew A.; Lépine, Sébastien; Thorstensen, John R.
2017-09-01
We present an activity and kinematic analysis of high proper motion white dwarf-M dwarf binaries (WD+dMs) found in the SUPERBLINK survey, 178 of which are new identifications. To identify WD+dMs, we developed a UV-optical-IR color criterion and conducted a spectroscopic survey to confirm each candidate binary. For the newly identified systems, we fit the two components using model white dwarf spectra and M dwarf template spectra to determine physical parameters. We use Hα chromospheric emission to examine the magnetic activity of the M dwarf in each system, and investigate how its activity is affected by the presence of a white dwarf companion. We find that the fraction of WD+dM binaries with active M dwarfs is significantly higher than their single M dwarf counterparts at early and mid-spectral types. We corroborate previous studies that find high activity fractions at both close and intermediate separations. At more distant separations, the binary fraction appears to approach the activity fraction for single M dwarfs. Using derived radial velocities and the proper motions, we calculate 3D space velocities for the WD+dMs in SUPERBLINK. For the entire SUPERBLINK WD+dMs, we find a large vertical velocity dispersion, indicating a dynamically hotter population compared to high proper motion samples of single M dwarfs. We compare the kinematics for systems with active M dwarfs and those with inactive M dwarfs, and find signatures of asymmetric drift in the inactive sample, indicating that they are drawn from an older population. Based on observations obtained at the MDM Observatory operated by Dartmouth College, Columbia University, The Ohio State University, and the University of Michigan.
Evaluation of UV-fs-LA-MC-ICP-MS for precise in situ copper isotopic microanalysis of cubanite.
Ikehata, Kei; Hirata, Takafumi
2013-01-01
We evaluated the capabilities of an in situ method for measuring copper isotopes of cubanite using UV-fs-LA-MC-ICP-MS. A comparison of the UV-fs laser results with those obtained from the NIR-fs laser system shows that there is obviously an improvement in the precision (<0.10‰, 2SE) when using the UV-fs laser. In both wavelength modes, matrix-matched standards are required for reliable in situ copper isotope analysis of cubanite. This method was applied to determinations for copper isotopes of minute cubanite grains in a skarn ore. Copper isotopic ratios of cubanite grains near a weathered surface of the sample are lower than those of intact cubanite grains within the sample, suggesting that selective leaching of heavier copper isotope in primary minerals occurred during weathering.
UV-light promoted C-H bond activation of benzene and fluorobenzenes by an iridium(i) pincer complex.
Hauser, Simone A; Emerson-King, Jack; Habershon, Scott; Chaplin, Adrian B
2017-03-28
Iridium(i) carbonyl complex [Ir(2,6-(P t Bu 2 CH 2 ) 2 C 6 H 3 )(CO)] undergoes reversible C-H bond activation of benzene and a series of fluorobenzenes on UV irradiation. Exclusive ortho-selectivity is observed in reactions of fluorobenzene and 1,2-difluorobenzene.
Bond Length Dependence on Quantum States as Shown by Spectroscopy
ERIC Educational Resources Information Center
Lim, Kieran F.
2005-01-01
A discussion on how a spreadsheet simulation of linear-molecular spectra could be used to explore the dependence of rotational band spacing and contours on average bond lengths in the initial and final quantum states is presented. The simulation of hydrogen chloride IR, iodine UV-vis, and nitrogen UV-vis spectra clearly show whether the average…
Identification of forensic samples by using an infrared-based automatic DNA sequencer.
Ricci, Ugo; Sani, Ilaria; Klintschar, Michael; Cerri, Nicoletta; De Ferrari, Francesco; Giovannucci Uzielli, Maria Luisa
2003-06-01
We have recently introduced a new protocol for analyzing all core loci of the Federal Bureau of Investigation's (FBI) Combined DNA Index System (CODIS) with an infrared (IR) automatic DNA sequencer (LI-COR 4200). The amplicons were labeled with forward oligonucleotide primers, covalently linked to a new infrared fluorescent molecule (IRDye 800). The alleles were displayed as familiar autoradiogram-like images with real-time detection. This protocol was employed for paternity testing, population studies, and identification of degraded forensic samples. We extensively analyzed some simulated forensic samples and mixed stains (blood, semen, saliva, bones, and fixed archival embedded tissues), comparing the results with donor samples. Sensitivity studies were also performed for the four multiplex systems. Our results show the efficiency, reliability, and accuracy of the IR system for the analysis of forensic samples. We also compared the efficiency of the multiplex protocol with ultraviolet (UV) technology. Paternity tests, undegraded DNA samples, and real forensic samples were analyzed with this approach based on IR technology and with UV-based automatic sequencers in combination with commercially-available kits. The comparability of the results with the widespread UV methods suggests that it is possible to exchange data between laboratories using the same core group of markers but different primer sets and detection methods.
NASA Astrophysics Data System (ADS)
Mindarava, Y. L.; Shundalau, M. B.; Al-Wahaibi, L. H.; El-Emam, A. A.; Matsukovich, A. S.; Gaponenko, S. V.
2018-05-01
Vibrational IR (3200-650 cm-1) and Raman spectra (3200-150 cm-1) of adamantane-containing 3-(adamantan-1-yl)-4-ethyl-1-[(4-phenylpiperazin-1-yl)methyl]-1H-1,2,4-triazole-5(4H)-thione, which is promising for drug design, were examined. The UV/Vis spectrum (450-200 nm) of the compound in EtOH was measured. Full geometry optimization using density functional theory (DFT) in the B3LYP/cc-pVDZ approximation allowed the equilibrium configuration of the molecule to be determined and IR and Raman spectra to be calculated. Based on these, the experimental vibrational IR and Raman spectra were interpreted and the biological activity indices were predicted. The UV/Vis spectrum of the title compound was simulated at the time-dependent DFT/CAM-B3LYP/cc-pVDZ level with and without solvent effects and at the ab initio multi-reference perturbation theory XMCQDPT2 level. The UV/Vis spectrum that was simulated using the multi-reference XMCQDPT2 approximation agreed very successfully with the experimental data, in contrast to the single-reference DFT method. This was probably a consequence of intramolecular charge transfer.
Linewidth studies on the the NI(4S-4P) resonance multiplet. [applicable to analysis of dayglow
NASA Technical Reports Server (NTRS)
Erdman, P. W.; Zipf, E. C.
1983-01-01
Doppler broadening of the 8691, 8212, and 1200-A multiplet lines of N I is investigated experimentally, and its implications for the interpretation of the earth's 1200-A UV dayglow are considered. A regulated 100-eV, 1-mA electron beam is passed through N2 at 300 K and about 0.0005 torr flowing through a collision chamber within a UHV system, and the radiation emitted is observed with a temperature-stabilized short-focal length monochromator with a bandpass of 0.2 A in the IR and an effective UV resolution (in second-order operation with a 3600-groove/mm plane grating) of about 0.04 A. Both the IR and VUV lines are found to be broadened to about 25 times the thermal Doppler linewidth, with the IR transitions accounting for more than half of the total N(4P) cross section at 100 eV. The kinetic energy of the N(4P) atoms produced by dissociative excitation is such that their 1200-A resonance radiation (2p2 3s4P - 2p3 4SO) would be optically thin in the upper atmosphere, contrary to what has been observed. A need to revise some aspects of current UV-dayglow models is identified.
NASA Astrophysics Data System (ADS)
Mindarava, Y. L.; Shundalau, M. B.; Al-Wahaibi, L. H.; El-Emam, A. A.; Matsukovich, A. S.; Gaponenko, S. V.
2018-05-01
Vibrational IR (3200-650 cm-1) and Raman spectra (3200-150 cm-1) of adamantane-containing 3-(adamantan-1-yl)-4-ethyl-1-[(4-phenylpiperazin-1-yl)methyl]-1H-1,2,4-triazole-5(4H)-thione, which is promising for drug design, were examined. The UV/Vis spectrum (450-200 nm) of the compound in EtOH was measured. Full geometry optimization using density functional theory (DFT) in the B3LYP/cc-pVDZ approximation allowed the equilibrium configuration of the molecule to be determined and IR and Raman spectra to be calculated. Based on these, the experimental vibrational IR and Raman spectra were interpreted and the biological activity indices were predicted. The UV/Vis spectrum of the title compound was simulated at the time-dependent DFT/CAM-B3LYP/cc-pVDZ level with and without solvent effects and at the ab initio multi-reference perturbation theory XMCQDPT2 level. The UV/Vis spectrum that was simulated using the multi-reference XMCQDPT2 approximation agreed very successfully with the experimental data, in contrast to the single-reference DFT method. This was probably a consequence of intramolecular charge transfer.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Chan, Chi-Ho; Krolik, Julian H.
2017-07-01
Near-Eddington radiation from active galactic nuclei (AGNs) has significant dynamical influence on the surrounding dusty gas, plausibly furnishing AGNs with geometrically thick obscuration. We investigate this paradigm with radiative magnetohydrodynamics simulations. The simulations solve the magnetohydrodynamics equations simultaneously with the infrared (IR) and ultraviolet (UV) radiative transfer (RT) equations; no approximate closure is used for RT. We find that our torus, when given a suitable sub-Keplerian angular momentum profile, spontaneously evolves toward a state in which its opening angle, density distribution, and flow pattern change only slowly. This “steady” state lasts for as long as there is gas resupply towardmore » the inner edge. The torus is best described as a midplane inflow and a high-latitude outflow. The outflow is launched from the torus inner edge by UV radiation and expands in solid angle as it ascends; IR radiation continues to drive the wide-angle outflow outside the central hole. The dusty outflow obscures the central source in soft X-rays, the IR, and the UV over three-quarters of solid angle, and each decade in column density covers roughly equal solid angle around the central source; these obscuration properties are similar to what observations imply.« less
Aune, Sverre E.; Herr, Daniel J.; Mani, Santhosh K.; Menick, Donald R.
2014-01-01
While inhibition of class I/IIb histone deacetylases (HDACs) protects the mammalian heart from ischemia reperfusion (IR) injury, class selective effects remain unexamined. We hypothesized that selective inhibition of class I HDACs would preserve left ventricular contractile function following IR in isolated hearts. Male Sprague Dawley rats (n=6 per group) were injected with vehicle (dimethylsulfoxide, 0.63 mg/kg), the class I/IIb HDAC inhibitor trichostatin A (1 mg/kg), the class I HDAC inhibitor entinostat (MS-275, 10 mg/kg), or the HDAC6 (class IIb) inhibitor tubastatin A (10 mg/kg). After 24 h, hearts were isolated and perfused in Langendorff mode for 30 min (Sham) or subjected to 30 min global ischemia and 120 min global reperfusion (IR). A saline filled balloon attached to a pressure transducer was placed in the LV to monitor contractile function. After perfusion, LV tissue was collected for measurements of antioxidant protein levels and infarct area. At the conclusion of IR, MS-275 pretreatment was associated with significant preservation of developed pressure, rate of pressure generation, rate of pressure relaxation and rate pressure product, as compared to vehicle treated hearts. There was significant reduction of infarct area with MS-275 pretreatment. Contractile function was not significantly restored in hearts treated with trichostatin A or tubastatin A. Mitochondrial superoxide dismutase (SOD2) and catalase protein and mRNA in hearts from animals pretreated with MS-275 were increased following IR, as compared to Sham. This was associated with a dramatic enrichment of nuclear FOXO3a transcription factor, which mediates the expression of SOD2 and catalase. Tubastatin A treatment was associated with significantly decreased catalase levels after IR. Class I HDAC inhibition elicits protection of contractile function following IR, which is associated with increased expression of endogenous antioxidant enzymes. Class I/IIb HDAC inhibition with trichostatin A or selective inhibition of HDAC6 with tubastatin A was not protective. This study highlights the need for the development of new strategies that target specific HDAC isoforms in cardiac ischemia reperfusion. PMID:24632412
Material Processing Opportunites Utilizing a Free Electron Laser
NASA Astrophysics Data System (ADS)
Todd, Alan
1996-11-01
Many properties of photocathode-driven Free Electron Lasers (FEL) are extremely attractive for material processing applications. These include: 1) broad-band tunability across the IR and UV spectra which permits wavelength optimization, depth deposition control and utilization of resonance phenomena; 2) picosecond pulse structure with continuous nanosecond spacing for optimum deposition efficiency and minimal collateral damage; 3) high peak and average radiated power for economic processing in quantity; and 4) high brightness for spatially defined energy deposition and intense energy density in small spots. We discuss five areas: polymer, metal and electronic material processing, micromachining and defense applications; where IR or UV material processing will find application if the economics is favorable. Specific examples in the IR and UV, such as surface texturing of polymers for improved look and feel, and anti-microbial food packaging films, which have been demonstrated using UV excimer lamps and lasers, will be given. Unfortunately, although the process utility is readily proven, the power levels and costs of lamps and lasers do not scale to production margins. However, from these examples, application specific cost targets ranging from 0.1=A2/kJ to 10=A2/kJ of delivered radiation at power levels from 10 kW to 500 kW, have been developed and are used to define strawman FEL processing systems. Since =46EL radiation energy extraction from the generating electron beam is typically a few percent, at these high average power levels, economic considerations dictate the use of a superconducting RF accelerator with energy recovery to minimize cavity and beam dump power loss. Such a 1 kW IR FEL, funded by the US Navy, is presently under construction at the Thomas Jefferson National Accelerator Facility. This dual-use device, scheduled to generate first light in late 1997, will test both the viability of high-power FELs for shipboard self-defense against cruise missiles, and for the first time, provide an industrial testbed capable of processing various materials in market evaluation quantities.
NASA Astrophysics Data System (ADS)
Gord, Joseph R.; Hewett, Daniel M.; Kubasik, Matthew A.; Zwier, Timothy S.
2014-06-01
2-Aminoisobutyric acid (Aib) is an achiral, α-amino acid having two equivalent methyl groups attached to Cα. Extended Aib oligomers are known to preferentially adopt a 310-helical structure in the condensed phase. Here, we take a simplifying step and focus on the intrinsic folding propensities of Aib by looking at a single, capped Aib structure and then extending to longer oligomers in the gas phase, free from the influence of solvent molecules and cooled in a supersonic expansion. Resonant two-photon ionization and IR-UV holeburning will be used to record single-conformation UV spectra using the Z-cap as UV chromophore. Resonant ion-dip infrared (RIDIR) spectroscopy provides single-conformation IR spectra in the OH stretch, NH stretch, amide I and amide II regions. Two conformational isomers have been identified for the smallest unit in the study, Z-Aib-OH, and four conformational isomers were seen for Z-Aib-Aib-OH, with widely-varying IR spectral patterns. In addition to investigating the conformational dependence on oligomer length, this work also studies the steric and electrostatic impact of different capping groups, R-X where X = -OH, -OMethyl, and -OtButyl. These caps are considered here for the case of Z-Aib-Aib-X. Extension to larger Z-(Aib)n-X oligomers will shed light on the extent to which the solution phase preference for 310-helix formation is retained in the gas phase, and when its onset first appears. When possible 13C isotopomers will be used to assist with the assignments and modulate the coupling between amide I fundamentals. Toniolo, C.; Bonora, G. M.; Barone, V.; Bavoso, A.; Benedetti, E.; Di Blasio, B.; Grimaldi, P.; Lelj, F.; Pavone, V.; Padone, C., Conformation of Pleionomers of α-Aminoisobutyric Acid. Macromolecules 1985, 18, 895-902.
Ozone concentrations and ultraviolet fluxes on Earth-like planets around other stars.
Segura, Antígona; Krelove, Kara; Kasting, James F; Sommerlatt, Darrell; Meadows, Victoria; Crisp, David; Cohen, Martin; Mlawer, Eli
2003-01-01
Coupled radiative-convective/photochemical modeling was performed for Earth-like planets orbiting different types of stars (the Sun as a G2V, an F2V, and a K2V star). O(2) concentrations between 1 and 10(-5) times the present atmospheric level (PAL) were simulated. The results were used to calculate visible/near-IR and thermal-IR spectra, along with surface UV fluxes and relative dose rates for erythema and DNA damage. For the spectral resolution and sensitivity currently planned for the first generation of terrestrial planet detection and characterization missions, we find that O(2) should be observable remotely in the visible for atmospheres containing at least 10(-2) PAL of O(2). O(3) should be visible in the thermal-IR for atmospheres containing at least 10(-3) PAL of O(2). CH(4) is not expected to be observable in 1 PAL O(2) atmospheres like that of modern Earth, but it might be observable at thermal-IR wavelengths in "mid-Proterozoic-type" atmospheres containing approximately 10(-1) PAL of O(2). Thus, the simultaneous detection of both O(3) and CH(4) - considered to be a reliable indication of life - is within the realm of possibility. High-O(2) planets orbiting K2V and F2V stars are both better protected from surface UV radiation than is modern Earth. For the F2V case the high intrinsic UV luminosity of the star is more than offset by the much thicker ozone layer. At O(2) levels below approximately 10(-2) PAL, planets around all three types of stars are subject to high surface UV fluxes, with the F2V planet exhibiting the most biologically dangerous radiation environment. Thus, while advanced life is theoretically possible on high-O(2) planets around F stars, it is not obvious that it would evolve as it did on Earth.
Impact of iron particles in groundwater on the UV inactivation of bacteriophages MS2 and T4.
Templeton, M R; Andrews, R C; Hofmann, R
2006-09-01
To investigate the impact of iron particles in groundwater on the inactivation of two model viruses, bacteriophages MS2 and T4, by 254-nm ultraviolet (UV) light. One-litre samples of groundwater with high iron content (from the Indianapolis Water Company, mean dissolved iron concentration 1.3 mg l(-1)) were stirred vigorously while exposed to air, which oxidized and precipitated the dissolved iron. In parallel samples, ethylenediaminetetra-acetic acid (EDTA) was added to chelate the iron and prevent formation of iron precipitate. The average turbidity in the samples without EDTA (called the 'raw' samples) after 210 min of stirring was 2.7 +/- 0.1 NTU while the average turbidity of the samples containing EDTA (called the 'preserved' samples) was 1.0 +/- 0.1 NTU. 'Raw' and 'preserved' samples containing bacteriophage MS2 were exposed to 254-nm UV light at doses of 20, 40, or 60 mJ (cm(2))(-1), while samples containing bacteriophage T4 were exposed to 2 or 5 mJ (cm(2))(-1), using a low pressure UV collimated beam. The UV inactivation of both phages in the 'raw' groundwater was lower than in the EDTA-'preserved' groundwater to a statistically significant degree (alpha = 0.05), due to the association of phage with the UV-absorbing iron precipitate particles. A phage elution technique confirmed that a large fraction of the phage that survived the UV exposures were particle-associated. Phages that are associated with iron oxide particles in groundwater are shielded from UV light to a measurable and statistically significant degree at a turbidity level of 2.7 NTU when the phage particle association is induced under experimental conditions. While the particle association of the phage in this study was induced experimentally, the findings provide further evidence that certain particles in natural waters and wastewaters (e.g. iron oxide particles) may have the potential to shield viruses from UV light.
Multicomponent Calibration and Quantitation Methods.
1984-11-01
liquid chromatographic peaks (45). Applying rank annihilation to LC /UV data requires that the elution profiles of each individual component in the...measurements, e.g. LC /UV, CC/MS, or GC/FTIR analyses. The response of a single component can be described as M = a x y’ (45) 0 where M contains the...in the second dimension. For example, a GC/MS peak consisting - 3 of 50 mass spectra each composed of 20 distinct m/e ratios would result in a matrix
Labdane diterpenes from Juniperus communis L. berries.
Martin, Anne Marie; Queiroz, Emerson Ferreira; Marston, Andrew; Hostettmann, Kurt
2006-01-01
A phytochemical study of the methanol extract of Juniperus communis berries was undertaken. The crude extract was analysed by HPLC-UV and the isolation of the minor compounds was performed by centrifugal partition chromatography. By this means, five diterpenes were isolated, one of which was a new labdane diterpene 15,16-epoxy-12-hydroxy-8(17),13(16),14-labdatrien-19-oic acid. The structures of the isolated compounds were elucidated by spectroscopic methods, including UV, NMR, MS and HR-MS.
Compact erbium lasers in the IR photorefractive keratectomy (PRK)
NASA Astrophysics Data System (ADS)
Liu, Baining; Eichler, Hans J.; Sperlich, O.; Holschbach, A.; Kayser, M.
1996-09-01
Erbium lasers deliver laser radiation near 3 micrometers and are a promising alternative to excimer laser photorefractive keratectomy (UV-PRK). In addition to easier handling due to all solid state technology, especially when operated in the fundamental mode, IR-PRK eliminates the potential of mutagenic side effects associated with UV-PRK. However, a successful IR-PRK for the clinic treatment in the near future demands both technological development of erbium lasers in different operation modes and clinical investigation of interaction between 3 micrometers radiation and human corneas. The excellent cooperation between university, company and hospital makes this possible. Uncoated thin plates made from infrared materials were found to be effective etalon reflectors with high damage threshold as high as 1 GW/cm2 for erbium lasers. Four kinds of such reflectors were successfully tested in Q-switched Er:YAG-laser at 2.94 micrometers and Er:Cr:YSGG-laser at 2.80 micrometers. Very stable operation of our erbium lasers with high output energy both in free-running and Q-switched modes is realized. First infrared photorefractive keratectomy (IR-PRK) for myopic correction in human corneas by a free-running erbium laser based on our new construction concepts was achieved.
Deriving Stellar Masses for the ALFALFA α.100 Sample
NASA Astrophysics Data System (ADS)
Hess, Logan; Cornell 2017 Summer REU
2018-01-01
For this project, we explore different methods of deriving the stellar masses of galaxies in the ALFALFA (Arecibo Legacy Fast ALFA) α.100 survey. In particular, we measure the effectiveness of SED (Spectral Energy Distribution) on the sample. SED fitting was preformed by MAGPHYS (Multi-wavelength Analysis of Galaxy Physical Properties), utilizing a wide range of photometry in the UV, optical, and IR bands. Photometry was taken from GALAX GR6/7 (UV), SDSS DR13 (optical), WISE All-Sky (near-IR), and Herschel PACS/SPIRE (far-IR). The efficiency of SED fitting increases with a broader range of photometry, however detection rates varied significantly across the different bands. Using a more “comprehensive” sample of galaxies, the GSWLC-A (GALAX, SDSS, WISE Legacy Catalog All-Sky Survey), we aimed to measure which combination of bands provided the largest sample return with the lowest amount of uncertainty, which could then be used to estimate the masses of the galaxies in the α.100 sample.
Renormalization group equations and the Lifshitz point in noncommutative Landau-Ginsburg theory
NASA Astrophysics Data System (ADS)
Chen, Guang-Hong; Wu, Yong-Shi
2002-02-01
A one-loop renormalization group (RG) analysis is performed for noncommutative Landau-Ginsburg theory in an arbitrary dimension. We adopt a modern version of the Wilsonian RG approach, in which a shell integration in momentum space bypasses the potential IR singularities due to UV-IR mixing. The momentum-dependent trigonometric factors in interaction vertices, characteristic of noncommutative geometry, are marginal under RG transformations, and their marginality is preserved at one loop. A negative Θ-dependent anomalous dimension is discovered as a novel effect of the UV-IR mixing. We also found a noncommutative Wilson-Fisher (NCWF) fixed point in less than four dimensions. At large noncommutativity, a momentum space instability is induced by quantum fluctuations, and a consequential first-order phase transition is identified together with a Lifshitz point in the phase diagram. In the vicinity of the Lifshitz point, we introduce two critical exponents νm and βk, whose values are determined to be 1/4 and 1/2, respectively, at mean-field level.
Modified gravity in Arnowitt-Deser-Misner formalism
NASA Astrophysics Data System (ADS)
Gao, Changjun
2010-02-01
Motivated by Hořava-Lifshitz gravity theory, we propose and investigate two kinds of modified gravity theories, the f(R) kind and the K-essence kind, in the Arnowitt-Deser-Misner (ADM) formalism. The f(R) kind includes one ultraviolet (UV) term and one infrared (IR) term together with the Einstein-Hilbert action. We find that these two terms naturally present the ultraviolet and infrared modifications to the Friedmann equation. The UV and IR modifications can avoid the past Big-Bang singularity and the future Big-Rip singularity, respectively. Furthermore, the IR modification can naturally account for the current acceleration of the Universe. The Lagrangian of K-essence kind modified gravity is made up of the three-dimensional Ricci scalar and an arbitrary function of the extrinsic curvature term. We find the cosmic acceleration can also be naturally interpreted without invoking any kind of dark energy. The static, spherically symmetry and vacuum solutions of both theories are Schwarzschild or Schwarzschild-de Sitter solution. Thus these modified gravity theories are viable for solar system tests.
Pigment from Streptomyces bellus MSA1 isolated from marine sediments
NASA Astrophysics Data System (ADS)
Srinivasan, M.; Merlyn Keziah, S.; Hemalatha, M.; Subathra Devi, C.
2017-11-01
The existing study is purposeful on the intracellular pigment extraction from actinomycetes isolated from Kovalam Beach regions of Chennai, Tamil Nadu, India. Only one actinobacterial isolate showed pigmented growth out of total 4 isolates. Ethyl acetate as the solvent was used in cell disruption technique for the extraction of intracellular pigments. UV-Visible spectrophotometry, FT-IR spectroscopy, HPLC and GC-MS were used for the partial characterization of the pigment. The extracted pigment was applied for the preparation of lip balm and assessing its textile dyeing property. In addition, the extracted pigment was analysed for antioxidant, antibacterial activity, MTT assay and haemolytic activity. On optimization, dextrose and maltose were the best carbon sources. The finest nitrogen sources were found to be casein and peptone. The optimum temperature range was 35°C -40°C and optimal pH was found to be between 6.0 and 8.0. The obtained results showed potent antioxidant activity and found to be non-toxic to human erythrocytes.
Chen, Zhimin; Wu, Yiqun; Gu, Donghong; Gan, Fuxi
2007-11-01
A new chelating ligand, 2-(2-(5-tert-butylisoxazol-3-yl)hydrazono)-N-(2,4-dimethylphenyl)-3-oxobutanamide (HL), and its four binuclear transition metal complexes, M(2)(L)(2) (micro-OCH(3))(2) [M=Ni(II), Co(II), Cu(II), Zn(II)], were synthesized using the procedure of diazotization, coupling and metallization. Their structures were postulated based on elemental analysis, (1)H NMR, MALDI-MS, FT-IR spectra and UV-vis electronic absorption spectra. Smooth films of these complexes on K9 glass substrates were prepared using the spin-coating method and their absorption properties were evaluated. The thermal properties of the metal(II) complexes were investigated by thermogravimetry (TG) and differential scanning calorimetry (DSC). Different thermodynamic and kinetic parameters namely activation energy (E*), enthalpy of activation (DeltaH*), entropy of activation (DeltaS*) and free energy change of activation (DeltaG*) are calculated using Coats-Redfern (CR) equation.
Identification, preparation and UHPLC determination of process-related impurity in zolmitriptan.
Douša, Michal; Gibala, Petr; Rádl, Stanislav; Klecán, Ondřej; Mandelová, Zuzana; Břicháč, Jiří; Pekárek, Tomáš
2012-01-25
A new impurity was detected and determined using gradient ion-pair UHPLC method with UV detection in zolmitriptan (ZOL). Using MS, NMR and IR study the impurity was identified as (4S,4'S)-4,4'-(2,2'-(4-(dimethylamino)butane-1,1-diyl)bis(3-(2-(dimethylamino) ethyl)-1H-indole-5,2-diyl))bis(methylene)di(oxazolidin-2-one) (ZOL-dimer). The standard of ZOL-dimer was consequently prepared via organic synthesis followed by semipreparative HPLC purification. The UHPLC method was optimized in order to selectively detect and quantify other known and unknown process-related impurities and degradation products of ZOL as well. The presented method which was validated with respect to linearity, accuracy, precision and selectivity has an advantage of a very quick UHPLC chromatographic separation (less than 7 min including re-equilibration time) and therefore is highly suitable for routine analysis of related substances and stability studies of ZOL. Copyright © 2011 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Zalaru, Christina; Dumitrascu, Florea; Draghici, Constantin; Tarcomnicu, Isabela; Tatia, Rodica; Moldovan, Lucia; Chifiriuc, Mariana-Carmen; Lazar, Veronica; Marinescu, Maria; Nitulescu, Mihai George; Ferbinteanu, Marilena
2018-03-01
A new series of substituted N,N-bis-[(1H-pyrazol-1-yl)methyl]-aminohexadecane Mannich bases were synthesized, characterized by IR, 1H NMR 13C NMR, UV-Vis, MS and elemental analysis, and tested for their biological activity. All the synthesized compounds were tested for in vitro antimicrobial activity against a panel of selected bacterial and fungal strains using erythromycin and clotrimazole as standards. Most of the synthesized compounds demonstrated very good activity at minimum inhibitory concentrations (MICs). Compound 3b with an halogen atom into the pharmacophore structure exhibited the most significant activity against Bacillus subtilis (MIC = 0.007 μgmLL-1) versus erythromycin as standard. In vitro cytotoxicity of the new compounds was studied using MTT assay. The analysis of the test cells showed that the newly synthesized alkylaminopyrazoles derivatives were biocompatible until a concentration of 5 μgmL-1; two compounds presented a high degree of biocompatibility on the studied concentration range.
Yang, Jun Li; Ha, Thi Kim Quy; Lee, Ba Wool; Kim, Jinwoong; Oh, Won Keun
2017-11-15
To find PTP1B inhibitors from natural products, two new compounds (1 and 2), along with nine known compounds (3-11), were isolated from a methanol-soluble extract of Iris sanguinea seeds. The structures of compounds 1 and 2 were determined based on extensive spectroscopic data analysis including UV, IR, NMR, and MS. The IC 50 value of compound 5 on protein tyrosine phosphatase 1B (PTP1B) inhibitory activity is 7.30±0.88µM with a little activity compared to the IC 50 values of the tested positive compound. Compound 5 significantly enhanced glucose uptake and activation of pACC, pAMPK and partially Erk1/2 signaling. These results suggest that compound 5 from Iris sanguinea seeds are utilized as both PTP1B inhibitors and regulators of glucose uptake. These beneficial effects could be applied to treat metabolic diseases such as diabetes and obesity. Copyright © 2017 Elsevier Ltd. All rights reserved.
Yan, Xiaoli; Tang, Jiajing; dos Santos Passos, Carolina; Nurisso, Alessandra; Simões-Pires, Claudia Avello; Ji, Mei; Lou, Hongxiang; Fan, Peihong
2015-12-16
Hemp seed is known for its content of fatty acids, proteins, and fiber, which contribute to its nutritional value. Here we studied the secondary metabolites of hemp seed aiming at identifying bioactive compounds that could contribute to its health benefits. This investigation led to the isolation of 4 new lignanamides, cannabisin M (2), cannabisin N (5), cannabisin O (8), and 3,3'-demethyl-heliotropamide (10), together with 10 known lignanamides, among which 4 was identified for the first time from hemp seed. Structures were established on the basis of NMR, HR-MS, UV, and IR as well as by comparison with the literature data. Lignanamides 2, 7, and 9-14 showed good antioxidant activity, among which 7, 10, and 13 also inhibited acetylcholinesterase in vitro. The newly identified compounds in this study add to the diversity of hemp seed composition, and the bioassays implied that hemp seed, with lignanamides as nutrients, may be a good source of bioactive and protective compounds.
Optimization and antioxidant activity of polysaccharides from Plantago depressa.
Han, Na; Wang, Lin; Song, Zehai; Lin, Junyu; Ye, Chun; Liu, Zhihui; Yin, Jun
2016-12-01
Polysaccharide from the herb of Plantago depressa (PDP) was obtained through ethanol precipitation preceded by a water extraction step. The optimum extraction yield of 5.68±0.46% was obtained with the treatment of raw material in water (w/v, 1:25.34) at 80.44°C during 1.97h, 3.28 times. Under these conditions, obtained yield value was in total agreement with value predicted by the model executed by Box-Behnken design (BBD). Following analysis by IR, HPLC-UV, MS and 1 H NMR, the composition of PDP was found to be l-rhamnose, galactose, arabinose, glucose and d-galacturonic acid. The maximum tolerated dose of PDP was 10g/kg. The antioxidant activity of PDP was investigated using five tests and it was found that PDP was able to scavenge hydroxyl, DPPH and ABTS radicals, besides their β-carotene bleaching inhibitory activity. In particular, in the test of β-carotene bleaching inhibition, PDP displayed higher activity than Vitamin C. Copyright © 2016 Elsevier B.V. All rights reserved.
Savic, Ivan M.; Nikolic, Vesna D.; Savic-Gajic, Ivana M.; Nikolic, Ljubisa B.; Ibric, Svetlana R.; Gajic, Dragoljub G.
2015-01-01
The process of amygdalin extraction from plum seeds was optimized using central composite design (CCD) and multilayer perceptron (MLP). The effect of time, ethanol concentration, solid-to-liquid ratio, and temperature on the amygdalin content in the extracts was estimated using both mathematical models. The MLP 4-3-1 with exponential function in hidden layer and linear function in output layer was used for describing the extraction process. MLP model was more superior compared with CCD model due to better prediction ability. According to MLP model, the suggested optimal conditions are: time of 120 min, 100% (v/v) ethanol, solid-to liquid ratio of 1:25 (m/v) and temperature of 34.4°C. The predicted value of amygdalin content in the dried extract (25.42 g per 100 g) at these conditions was experimentally confirmed (25.30 g per 100 g of dried extract). Amygdalin (>90%) was isolated from the complex extraction mixture and structurally characterized by FT-IR, UV, and MS methods. PMID:25972881
[Antitumoral bibenzyl derivatives from tuber of Arundina graminifolia].
Liu, Meifeng; Lv, Haoran; Ding, Yi
2012-01-01
To isolate the bibenzyl derivatives from the tuber of Arundina graminifolia and evaluate the anti-tumor activity of these compounds in vitro. The constituents have been extracted by 95% alcohol and then isolated by column chromatography on silica gel and Sephedax LH-20. The structures were determined by UV, IR, NMR and MS spectral analysis. Six constituents have been isolated, and their structures have been established as 2,7-dihydroxy-1-(p-hydroxylbenzyl)-4-methoxy-9, 10-dihydrophenanthrene (1), 4,7-dihydroxy-1- (p-hydroxylbenzyl)-2-methoxy-9,10-dihydrophenanthrene (2), 3, 3'-dihydroxy-5-methoxybibenzyl (3), (2E) -2- propenoic acid-3-(4-hydroxy-3-methoxyphenyl) -tetracosyl ester (4), (2E) -2-propenoic acid-3- (4-hydroxy-3- methoxyphenyl) -pentacosyl ester (5) and pentadecyl acid (6), respectively. All compounds except for 3 were isolated from the tuber of A. graminifolia for the first time. Compound 3 with bibenzyl ring opening exhibits stronger anti-tumor activity than that of compounds 1 and 2 with bibenzyl ring closing.
New C16-noriridals and formyl-monocycloiridals from the rhizomes of Iris pseudoacorus.
Chen, Xinglong; Zhang, Xiuqiong; Geng, Changan; Li, Tianze; Chen, Jijun
2018-01-01
Four new C 16 -noriridals (1-4) and two reported C 16 -noriridals (5-6), together with two new formyl-monocycloiridals (7-8) and three known monocycloiridals (9-11) were isolated from the rhizomes of Iris pseudoacorus. Irispseudoacorins A-D (1-4) and iridojaponals A-B (5-6) were C 16 -noriridals which shared a 6/5/7 tricyclic ring system (1-2, 5-6) or 6/5 tricyclic ring system (3-4). The formyl-monocycloiridals (7-8) were detected in the crude extracts of I. pseudoacorus by LC-MS analysis which suggested they were originated from natural sources rather than artificial products during the isolation. Their structures were determined by UV, IR, extensive NMR spectra and X-ray diffraction analyses. The known monocycloiridals 9-10 displayed pronounced cytotoxic effects against five human tumor cell lines. The IC 50 values of 9 were ranging from 12.63 to 24.69μM. Copyright © 2017 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Özdemir, Ümmühan Özmen; Arslan, Fatma; Hamurcu, Fatma
2010-01-01
Ethane sulfonic acide hydrazide ( esh: CH 3CH 2SO 2NHNH 2) derivatives as 5-methylsalicyl-aldehydeethanesulfonylhydrazone ( 5msalesh), 5-methyl-2-hydroxyacetophenoneethane sulfonylhydrazone ( 5mafesh) and their Ni(II), Co(II) complexes have been synthesized for the first time. The structure of these compounds has been investigated by elemental analysis, FT-IR, 1H NMR, 13C NMR, LC/MS, UV-vis spectrophotometric method, magnetic susceptibility, thermal studies and conductivity measurements. The antibacterial activities of synthesized compounds were studied against Gram positive bacteria; Staphylococcus aureus, Bacillus subtilis, Bacillus magaterium and Gram negative bacteria; Salmonella enteritidis, Escherichia coli by using the microdilution broth method. The biological activity screening showed that ligands have more activity than complexes against the tested bacteria. The inhibition activities of these compounds on carbonic anhydrase II (CA II) have been investigated by comparing IC 50 and Ki values and it has been found that 5msalesh and its complexes have more enzyme inhibition efficiency than other compounds.
New immobilisation protocol for the template used in solid-phase synthesis of MIP nanoparticles
NASA Astrophysics Data System (ADS)
Chen, Lu; Muhammad, Turghun; Yakup, Burabiye; Piletsky, Sergey A.
2017-06-01
As a novel imprinting method, solid-phase synthesis has proven to be a promising approach to prepare polymer nanoparticles with specific recognition sites for a template molecule. In this method, imprinted polymer nanoparticles were synthesized using template immobilized on a solid support. Herein, preparation of immobilized templates on quartz chips through homogeneous route was reported as an efficient alternative strategy to heterogeneous one. The template molecule indole-3-butyric acid (IBA) was reacted with 3-aminopropyltriethoxysilane (APTES) to produce silylated template (IBA-APTES), and it was characterized by IR, 1H NMR and GC-MS. Then, the silylated template molecule was grafted onto the activated surfaces of quartz chip to prepare immobilized template (SiO2@IBA-APTES). The immobilization was confirmed by contact angle, XPS, UV and fluorescence measurement. Immobilization protocol has shown good reproducibility and stability of the immobilized template. MIP nanoparticles were prepared with high selectivity toward the molecule immobilized onto the solid surface. This provides a new approach for the development of molecularly imprinted nanoparticles.
A new pentacyclic phenol and other constituents from the root bark of Bauhinia racemosa Lamk.
Jain, Renuka; Yadav, Namita; Bhagchandani, Teena; Jain, Satish C
2013-10-01
This work reported the isolation of one unknown (1) and 10 known compounds (2-11) from the root bark of Bauhinia racemosa Lamk. (family: Caesalpiniaceae). Racemosolone (1) was characterised as a pentacyclic phenolic compound possessing an unusual skeleton with a cycloheptane ring and a rare furopyran moiety. The structure elucidation was carried out on the basis of UV, infrared (IR), HR-ESI-MS, 1D and 2D NMR spectra and finally confirmed by the single crystal X-ray analysis. The known compounds were characterised as n-tetracosane, β-sitosteryl stearate, eicosanoic acid, stigmasterol, β-sitosterol, racemosol, octacosyl ferulate, de-O-methyl racemosol, lupeol and 1,7,8,12b-tetrahydro-2,2,4-trimethyl-2H-benzo[6,7]cyclohepta [1,2,3-de] [1] benzopyran-5,10,11 triol on the basis of spectroscopic data comparison with the literature value. Compounds with skeleton similar to 1 have never been reported from any natural or other source.
Gad, Haidy A; Bouzabata, Amel
2017-12-15
Turmeric (Curcuma longa L.) belongs to the family Zingiberaceae that is widely used as a spice in food preparations in addition to its biological activities. UV, FT-IR, 1 H NMR in addition to HPLC were applied to construct a metabolic fingerprint for Turmeric in an attempt to assess its quality. 30 samples were analyzed, and then principal component analysis (PCA) and hierarchical clustering analysis (HCA) were utilized to assess the differences and similarities between collected samples. PCA score plot based on both HPLC and UV spectroscopy showed the same discriminatory pattern, where the samples were segregated into four main groups depending on their total curcuminoids content. The results revealed that UV could be utilized as a simple and rapid alternative for HPLC. However, FT-IR failed to discriminate between the same species. By applying 1 H NMR, the metabolic variability between samples was more evident in the essential oils/fatty acid region. Copyright © 2017 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Pandeeswaran, M.; Elango, K. P.
2010-05-01
Spectroscopic studies revealed that the interaction of cimetidine drug with electron acceptors iodine and 2,3-dichloro-5,6-dicyano-1,4-benzoquinone (DDQ) resulted through the initial formation of ionic intermediate to charge transfer (CT) complex. The CT-complexes of the interactions have been characterized using UV-vis, 1H NMR, FT-IR and GC-MS techniques. The formation of triiodide ion, I 3-, is further confirmed by the observation of the characteristic bands in the far IR spectrum for non-linear I 3- ion with C s symmetry at 156 and 131 cm -1 assigned to νas(I-I) and νs(I-I) of the I-I bond and at 73 cm -1 due to bending δ(I 3-). The rate of formation of the CT-complexes has been measured and discussed as a function of relative permittivity of solvent and temperature. The influence of relative permittivity of the medium on the rate indicated that the intermediate is more polar than the reactants and this observation was further supported by spectral studies. Based on the spectroscopic results plausible mechanisms for the interaction of the drug with the chosen acceptors were proposed and discussed and the point of attachment of the multifunctional cimetidine drug with these acceptors during the formation of CT-complex has been established.
NASA Astrophysics Data System (ADS)
Jawoor, Shailaja S.; Patil, Sangamesh A.; Kumbar, Mahantesh; Ramawadgi, Prashant B.
2018-07-01
In the current involvement of our research work in coordination chemistry, novel transition metal complexes were synthesized from regular reflux method and hydrothermal method using Schiff base prepared via condensation of ethyl 2-amino-4,5,6,7-tetrahydrobenzo[b]thiophene-3-carboxylate with 8-carbaldehyde-7-hydroxy-4-methylcoumarin. All the synthesized compounds were interpreted using different analytical, physicochemical and spectral methods such as magnetic moment measurement, FT-IR, 1H and 13C NMR, GCMS/ESI-MS, UV/Vis spectroscopy and TGA. The size and morphology of the nano metal complexes were determined using atomic force microscope (AFM), field emission scanning electron spectroscopy (FE-SEM) and X-ray powder diffraction (PXRD). The non-electrolytic nature of the metal complexes was confirmed by molar conductance studies. The obtained FT-IR data supports the binding of metal ion to Schiff base. Elemental analysis study suggests [ML2(H2O)2] stoichiometry, here M = Co(II), Ni(II) and Cu(II), L = deprotonated ligand. Electronic spectral results reveal six-coordinated geometry for the synthesized metal complexes. All the tested compounds show good DNA cleavage (Calf Thymus DNA) and in vitro anticancer activity (PA-I cell line), the activity results for the tested compounds are prominent and compound 9 exhibited a little enhanced activity than the other tested compounds.
NASA Astrophysics Data System (ADS)
Jagadeesh, M.; Rashmi, H. K.; Subba Rao, Y.; Sreenath Reddy, A.; Prathima, B.; Uma Maheswari Devi, P.; Reddy, A. Varada
2013-11-01
A new cis-palladium(II)diaqua(3,4-difluoroacetophenonethiosemicarbazone complex (Pd(II) complex) is synthesized using 3,4-difluoroacetophenonethiosemicarbazone(L). The L and its Pd(II) complex are characterized and confirmed by elemental analyses, electrochemical analyses, FT-IR, FT-Raman, UV-Vis, HRMS and LC-MS techniques. Ligand L is further characterized by 1H, 13C and 19F NMR spectroscopy. The crystal structure of L is unambiguously characterized by single X-ray crystallography. The ligand (L) belongs to monoclinic system with P2(1)/C space group and the unit cell parameters are a(Å) = 9.1144(7), b(Å) = 13.7928(7), c(Å) = 8.4174(5), α(°) = 90, β(°) = 100.715, γ(°) = 90 and volume V(A3) = 1039.73(11). The Raman bands observed for the L and its Pd(II) complex are in good agreement with the FT-IR spectral data. The Pd(II) complex is found to be highly efficient in inhibiting the growth of human pathogens like Salmonella typhimurium and Klebsiella pneumonia with MIC value 10.0 μg/mL whose inhibition zones are almost comparable with the standard antibiotic. The synthesized compounds have shown antiproliferative activity against the human breast cancer cell lines MDA-MB231 by intermitting the regular pathway of ribonucleotidereductase.
Two-step recording of visible holographic elements in photo-thermo-refractive glass
NASA Astrophysics Data System (ADS)
Kompan, Fedor; Divliansky, Ivan; Smirnov, Vadim; Glebov, Leonid B.
2018-02-01
Photo-thermo-refractive (PTR) glass) is a photosensitive silicate glass doped with Ce3+ where a permanent refractive index decrement is produced by UV exposure followed by thermal development. This material provides high efficiency and low losses combined with high thermal, ionizing and laser tolerance of holographic optical elements (HOEs). This is why PTR glass is widely used for holographic recording of volume Bragg gratings (trivial holograms produced by interference of two collimated beams) and phase plates operating in near UV, visible, and near IR spectral regions. It would be very beneficial though to record also complex HOEs (lenses and curved mirrors) for those spectral regions. However, PTR is not sensitive to visible or IR radiation and therefore does not allow the recording of nonplanar holograms for these regions. The present paper describes a technique for recording complex HOEs using visible radiation in Ce3+ doped PTR glass. This two-step technique includes a blank exposure to UV radiation followed by structured exposure to a visible beam. It was found that the second exposure decreases the refractive index decrement induced in the UV exposed glass after thermal development. This means that areas, which underwent double exposure, have refractive index lower than in unexposed areas but higher than in just UV exposed ones. Thus, this technique provides refractive index increment after visible irradiation of UV exposed PTR glass. Using this approach, complex holograms (curved mirrors and lenses) operating in the visible region, were recorded in PTR glass.
From Laser Desorption to Laser Ablation of Biopolymers
NASA Astrophysics Data System (ADS)
Franz, Hillenkamp
1998-03-01
For selected indications laser ablation and cutting of biological tissues is clinical practice. Preferentially lasers with emission wavelengths in the far UV and the mid IR are used, for which tissue absorption is very high. Morphologically the ablation sites look surprisingly similar for the two wavelength ranges, despite of the very different prim y putative interaction mechanisms. Ablation depth as a function of fluence follows a sigmoidal curve. Even factors below the nominal ablation threshold superficial layers of material get removed from the surface. This is the fluence range for Matrix-Assisted Laser Desorption/Ionization (MALDI). Evidence will be presented which suggest that strong similarities exist between the desorption and ablation processes both for UV- as well as for IR-wavelengths.
Cryogenic radiometers and intensity-stabilized lasers for Eos radiometric calibrations
NASA Technical Reports Server (NTRS)
Foukal, P.; Hoyt, C.; Jauniskis, L.
1991-01-01
Liquid helium-cooled electrical substitution radiometers (ESRs) provide irradiance standards with demonstrated absolute accuracy at the 0.01 percent level, spectrally flat response between the UV and IR, and sensitivity down to 0.1 nW/sq cm. We describe an automated system developed for NASA - Goddard Space Flight Center, consisting of a cryogenic ESR illuminated by servocontrolled laser beams. This system is designed to provide calibration of single-element and array detectors over the spectral range between 257nm in the UV to 10.6 microns in the IR. We also describe a cryogenic ESR optimized for black body calibrations that has been installed at NIST, and another that is under construction for calibrations of the CERES scanners planned for Eos.
NASA Astrophysics Data System (ADS)
Ahn, Ahreum; Min, Ahreum; Moon, Cheol Joo; Lee, Ji Hoon; Lee, Seung Jun; Warashina, Taichi; Ishiuchi, Shun-ichi; Fujii, Masaaki; Choi, Myong Yong
2015-10-01
The conformational structure of indole-3-carbinol (I3C) has been investigated in the gas phase for the first time using a laser desorption technique. A UV-UV hole-burning technique revealed the presence of a single conformer of I3C in the mass-selected resonant two-photon ionization spectrum. The assignment of the observed IR spectrum of I3C is inconclusive due to almost identically predicted IR frequencies of the two lowest energy conformers from harmonic calculations. A conclusive assignment for the conformer of I3C has been reported with an aid of performing anharmonic calculations and Franck-Condon simulations on the two lowest-energy conformers.
NASA Astrophysics Data System (ADS)
Robertson, Patrick A.; Lobo, Isabella A.; Wilson, David J. D.; Robertson, Evan G.
2016-09-01
Benzenepropanenitrile (BPN) and its hydrate clusters are studied by R2PI and IR-UV ion-depletion spectroscopy in the CH/OH stretch regions, aided by theoretical calculations. A single water molecule binds to the terminal nitrile 'lone-pair' of the anti-BPN host, but there is also evidence for a side-type structure with OH donating to the nitrile π-electrons. In the gauche-BPN cluster, water is located at an intermediate angle that facilitates O⋯HC(ortho) interaction. A wide range of attachment angles is possible, as the intrinsic preference for linear hydrogen bonding is mediated by additional CH⋯O interactions that depend on molecular geometry near the nitrile group.
Lacker, T; Strohschein, S; Albert, K
1999-08-27
In this paper the application of on-line HPLC-UV-APCI (atmospheric pressure chemical ionization) mass spectrometry (MS) coupling for the separation and determination of different carotenoids as well as cis/trans isomers of beta-carotene is reported. All HPLC separations were carried out under RP conditions on self-synthesized polymeric C30 phases. The analysis of a carotenoid mixture containing astaxanthin, canthaxanthin, zeaxanthin, echinenone and beta-carotene by HPLC-APCI-MS was achieved by scanning the mass range from m/z 200 to 700. For the characterization of a sample containing cis/trans isomers of beta-carotene as well as their oxidation products, a photodiode-array UV-visible absorbance detector was used in addition between the column and the mass spectrometer for structural elucidation of the geometrical isomers. The detection limit for beta-carotene in positive-ion APCI-MS was determined to be 1 pmol. In addition, an extract of non-polar substances in vegetable juice has been analyzed by HPLC-APCI-MS. The included carotenoids could be identified by their masses and their retention times.
NASA Astrophysics Data System (ADS)
Singh, Archana; Trivedi, Darshak R.
2017-05-01
A colorimetric receptor R 2-[(2-Hydroxy-naphthalen-1-ylmethylene)-hydrazonomethyl]-quinolin-8-ol has been designed and synthesized with good yield and characterized by the standard spectroscopic techniques such as FT-IR, UV-Visible, 1H NMR, 13C NMR and ESI-MS. The receptor R showed naked-eye detection and spectral change in the presence of F-, AcO- and H2PO4- over other anions. Interestingly, receptor R displaying high selective recognition towards F-, AcO- ion with a drastic color change from pale yellow to red in dry DMSO solvent and orange in mixed solvent DMSO/H2O (9:1, v/v). The behavior of receptor R towards F-, AcO- ion was investigated using UV-Vis and 1H NMR experiment. The detailed 1H NMR experiment result revealed that the receptor R is forming the hydrogen bonding between imine nitrogen and phenolic sbnd OH proton towards anions. The receptor R is able to detect sodium salts of flouride (NaF) and acetate (NaAcO) in aqueous medium and it exhibited dramatic color change from pale yellow to red. The receptor R demonstrated itself to be useful for real life application by detecting flouride and acetate ion in sea-water and commercially available product such as toothpaste, mouthwash and vinegar solution.
Zhang, Shui-Han; Hu, Xin; Shi, Shu-Yun; Huang, Lu-Qi; Chen, Wei; Chen, Lin; Cai, Ping
2016-05-01
A major challenge of profiling chlorogenic acids (CGA) in natural products is to effectively detect unknown or minor isomeric compounds. Here, we developed an effective strategy, typical ultraviolet (UV) spectra in combination with diagnostic mass fragmentation analysis based on HPLC-DAD-QTOF-MS/MS, to comprehensively profile CGA in the buds of Lonicera macranthoides. First, three CGA UV patterns were obtained by UV spectra screening. Second, 13 types of CGA classified by molecular weights were found by thorough analysis of CGA peaks using high-resolution MS. Third, selected ion monitoring (SIM) was carried out for each type of CGA to avoid overlooking of minor ones. Fourth, MS/MS spectra of each CGA were investigated. Then 70 CGA were identified by matching their UV spectra, accurate mass signals and fragmentation patterns with standards or previously reported compounds, including six caffeoylquinic acids (CQA), six diCQA, one triCQA, three caffeoylshikimic acids (CSA), six diCSA, one triCSA, three p-coumaroylquinic acids (pCoQA), four p-coumaroylcaffeoylquinic acids (pCoCQA), four feruloylquinic acids (FQA), five methyl caffeoylquinates (MCQ), three ethyl caffeoylquinates (ECQ), three dimethoxycinnamoylquinic acids (DQA), six caffeoylferuloylquinic acids (CFQA), six methyl dicaffeoylquinates (MdiCQ), four FQA glycosides (FQAG), six MCQ glycosides (MCQG), and three ethyl dicaffeoylquinates (EdiCQ). Forty-five of them were discovered from Lonicera species for the first time, and it is noted that CGA profiles were investigated for the first time in L. macranthoides. Results indicated that the developed method was a useful approach to explore unknown and minor isomeric compounds from complex natural products.
Russell, Jason D.; Scalf, Mark; Book, Adam J.; Ladror, Daniel T.; Vierstra, Richard D.; Smith, Lloyd M.; Coon, Joshua J.
2013-01-01
Quantification of gas-phase intact protein ions by mass spectrometry (MS) is impeded by highly-variable ionization, ion transmission, and ion detection efficiencies. Therefore, quantification of proteins using MS-associated techniques is almost exclusively done after proteolysis where peptides serve as proxies for estimating protein abundance. Advances in instrumentation, protein separations, and informatics have made large-scale sequencing of intact proteins using top-down proteomics accessible to the proteomics community; yet quantification of proteins using a top-down workflow has largely been unaddressed. Here we describe a label-free approach to determine the abundance of intact proteins separated by nanoflow liquid chromatography prior to MS analysis by using solution-phase measurements of ultraviolet light-induced intrinsic fluorescence (UV-IF). UV-IF is measured directly at the electrospray interface just prior to the capillary exit where proteins containing at least one tryptophan residue are readily detected. UV-IF quantification was demonstrated using commercially available protein standards and provided more accurate and precise protein quantification than MS ion current. We evaluated the parallel use of UV-IF and top-down tandem MS for quantification and identification of protein subunits and associated proteins from an affinity-purified 26S proteasome sample from Arabidopsis thaliana. We identified 26 unique proteins and quantified 13 tryptophan-containing species. Our analyses discovered previously unidentified N-terminal processing of the β6 (PBF1) and β7 (PBG1) subunit - such processing of PBG1 may generate a heretofore unknown additional protease active site upon cleavage. In addition, our approach permitted the unambiguous identification and quantification both isoforms of the proteasome-associated protein DSS1. PMID:23536786
Russell, Jason D; Scalf, Mark; Book, Adam J; Ladror, Daniel T; Vierstra, Richard D; Smith, Lloyd M; Coon, Joshua J
2013-01-01
Quantification of gas-phase intact protein ions by mass spectrometry (MS) is impeded by highly-variable ionization, ion transmission, and ion detection efficiencies. Therefore, quantification of proteins using MS-associated techniques is almost exclusively done after proteolysis where peptides serve as proxies for estimating protein abundance. Advances in instrumentation, protein separations, and informatics have made large-scale sequencing of intact proteins using top-down proteomics accessible to the proteomics community; yet quantification of proteins using a top-down workflow has largely been unaddressed. Here we describe a label-free approach to determine the abundance of intact proteins separated by nanoflow liquid chromatography prior to MS analysis by using solution-phase measurements of ultraviolet light-induced intrinsic fluorescence (UV-IF). UV-IF is measured directly at the electrospray interface just prior to the capillary exit where proteins containing at least one tryptophan residue are readily detected. UV-IF quantification was demonstrated using commercially available protein standards and provided more accurate and precise protein quantification than MS ion current. We evaluated the parallel use of UV-IF and top-down tandem MS for quantification and identification of protein subunits and associated proteins from an affinity-purified 26S proteasome sample from Arabidopsis thaliana. We identified 26 unique proteins and quantified 13 tryptophan-containing species. Our analyses discovered previously unidentified N-terminal processing of the β6 (PBF1) and β7 (PBG1) subunit - such processing of PBG1 may generate a heretofore unknown additional protease active site upon cleavage. In addition, our approach permitted the unambiguous identification and quantification both isoforms of the proteasome-associated protein DSS1.
[Current options of insulin resistence correction in patients with metabolic syndrome].
Demidova, T Iu; Ametov, A S; Titova, O I
2006-01-01
To study thiasolidindion drug pioglitazone for efficacy in metabolic syndrome (MS). Twenty patients with MS were examined at baseline and after 12 week therapy with pioglitazone. The examination included estimation of fasting and postprandial glycemia, insulin resistance index, HOMA-IR index, HbAlc, lipid profile, microalbuminuria (MAU), blood pressure, endothelium-related vasodilation. Pioglitazone therapy for 12 weeks significantly reduced HbAlc, fasting and postprandial glycemia, insulinemia, HOMA-IR, improved blood lipid spectrum, reduced visceral obesity. Positive effects were also achieved on blood pressure, MAU and endothelium-related vasodilation.
Guo, Hui; Li, Huan; Liu, Xiao; Cai, Hao; Wu, Li; Cai, Bao-Chang
2014-12-01
To develop a high performance liquid chromatography (HPLC) coupled with electrospray ionization mass spectrometry (ESI-MS) and ultraviolet (UV) detector method for the acid-alkaline simultaneous determination of ten bioactive compounds, and analyze the effect of compatible medicinal plants on the concentration of components in Dahuang Fuzi Tang (DFT). The chromatographic separation was performed on a Hypersil BDS C18 analytical column by gradient elution with acetonitrile and formate buffer (containing 0.15% formic acid, V/V) at 25 °C with a flow rate of 1.0 mL·min(-1) and UV detection at 280 nm. Four of the ten compounds in DFT were identified and their MS fragments were elucidated by HPLC-ESI-MS, and the contents of the six compounds were determined by HPLC-UV. All calibration curves showed good linear regression (r(2) ≥ 0.9990). The limits of detection and limits of quantification were 0.021-0.155 -g·mL(-1) and 0.076-0.520 -g·mL(-1), respectively. Overall precision RSD (intra-day and inter-day) were less than 2.96%, and the average recoveries were 98.35%-101.45%, with RSD ranging from 1.54% to 3.01% for the analytes. The developed method can be applied for the quality control and provide analytical evidence on the chemical basis and combinational principles of DFT. Copyright © 2014 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.
Matrix Optical Absorption in UV-MALDI MS
NASA Astrophysics Data System (ADS)
Robinson, Kenneth N.; Steven, Rory T.; Bunch, Josephine
2018-03-01
In ultraviolet matrix-assisted laser desorption/ionization mass spectrometry (UV-MALDI MS) matrix compound optical absorption governs the uptake of laser energy, which in turn has a strong influence on experimental results. Despite this, quantitative absorption measurements are lacking for most matrix compounds. Furthermore, despite the use of UV-MALDI MS to detect a vast range of compounds, investigations into the effects of laser energy have been primarily restricted to single classes of analytes. We report the absolute solid state absorption spectra of the matrix compounds α-cyano-4-hydroxycinnamic acid (CHCA), para-nitroaniline (PNA), 2-mercaptobenzothiazole (MBT), 2,5-dihydroxybenzoic acid (2,5-DHB), and 2,4,6-trihydroxyacetophenone (THAP). The desorption/ionization characteristics of these matrix compounds with respect to laser fluence was investigated using mixed systems of matrix with either angiotensin II, PC(34:1) lipid standard, or haloperidol, acting as representatives for typical classes of analyte encountered in UV-MALDI MS. The first absolute solid phase spectra for PNA, MBT, and THAP are reported; additionally, inconsistencies between previously published spectra for CHCA are resolved. In light of these findings, suggestions are made for experimental optimization with regards to matrix and laser wavelength selection. The relationship between matrix optical cross-section and wavelength-dependant threshold fluence, fluence of maximum ion yield, and R, a new descriptor for the change in ion intensity with fluence, are described. A matrix cross-section of 1.3 × 10-17 cm-2 was identified as a potential minimum for desorption/ionization of analytes.
Matrix Optical Absorption in UV-MALDI MS.
Robinson, Kenneth N; Steven, Rory T; Bunch, Josephine
2018-03-01
In ultraviolet matrix-assisted laser desorption/ionization mass spectrometry (UV-MALDI MS) matrix compound optical absorption governs the uptake of laser energy, which in turn has a strong influence on experimental results. Despite this, quantitative absorption measurements are lacking for most matrix compounds. Furthermore, despite the use of UV-MALDI MS to detect a vast range of compounds, investigations into the effects of laser energy have been primarily restricted to single classes of analytes. We report the absolute solid state absorption spectra of the matrix compounds α-cyano-4-hydroxycinnamic acid (CHCA), para-nitroaniline (PNA), 2-mercaptobenzothiazole (MBT), 2,5-dihydroxybenzoic acid (2,5-DHB), and 2,4,6-trihydroxyacetophenone (THAP). The desorption/ionization characteristics of these matrix compounds with respect to laser fluence was investigated using mixed systems of matrix with either angiotensin II, PC(34:1) lipid standard, or haloperidol, acting as representatives for typical classes of analyte encountered in UV-MALDI MS. The first absolute solid phase spectra for PNA, MBT, and THAP are reported; additionally, inconsistencies between previously published spectra for CHCA are resolved. In light of these findings, suggestions are made for experimental optimization with regards to matrix and laser wavelength selection. The relationship between matrix optical cross-section and wavelength-dependant threshold fluence, fluence of maximum ion yield, and R, a new descriptor for the change in ion intensity with fluence, are described. A matrix cross-section of 1.3 × 10 -17 cm -2 was identified as a potential minimum for desorption/ionization of analytes. Graphical Abstract ᅟ.
Conformationally resolved spectroscopy of jet-cooled methacetin
NASA Astrophysics Data System (ADS)
Moon, Cheol Joo; Ahn, Ahreum; Min, Ahreum; Seong, Yeon Guk; Kim, Ju Hyun; Choi, Myong Yong
2017-11-01
The excitation spectra of jet-cooled methacetin (MA) have been measured using a combination of mass-selected resonant two-photon ionization and ultraviolet-ultraviolet hole-burning (UV-UV HB) spectroscopy in the gas phase. Four different UV-UV HB spectra originating from two conformers of MA (syn- and anti-MA) with their fundamental and hot transitions have been obtained. IR-dip spectroscopy has conclusively confirmed the coexistence of the two conformers with the aid of theoretical calculations. Vibronic band assignments in the low frequency region caused by internal methyl group rotation in the methyl-capped peptide group, which originate from the 1e rotational level, are presented.
[The UV-Vis spectra and substituent effect of organoimido derivatives of polyoxometalates].
Li, Qiang; Wei, Yong-ge; Wang, Yuan; Guo, Hong-you
2005-06-01
In the presence of a carbodiimine, i.e. DCC, a series of organoimido derivatives of polyoxometalates have been synthesized via the reaction of [alpha-Mo8O26]4- with aromatic amines and its hydrochloride salt. Elemental analysis, IR, 1H-NMR and UV-Vis spectra were used to characterize those hybrids, in particular their UV-Vis spectra have been studied. The results show that typical metal-ligand charge transfer (MLCT) transitions occur in the organic-inorganic hybrid molecules. There is a good linear relationship between the shift of UV-Vis absorptions (delta lamda max) and conjugation effect of the p-substituted group (sigmaR).
NASA Astrophysics Data System (ADS)
Pena, Alvaro J.; Pacheco-Londono, Leonardo; Figueroa, Javier; Rivera-Montalvo, Luis A.; Roman-Velazquez, Felix R.; Hernandez-Rivera, Samuel P.
2005-05-01
The characterization of Tetracetone Tetraperoxide (TRATRP), Triacetone Triperoxide (TATP), Diacetone Diperoxide (DADP), Tricyclohexylidene Triperoxide and Dibenzo Diperoxide using GC-MS, GC-FTIR, FTIR, FT-NMR and Raman Spectroscopy is reported. These compounds were synthesized, purified and characterized in the laboratory in order to develop methodologies for their trace detection. During this study, TATP has been synthesized by different methods obtaining high purity and good yields, even using common household products. DADP synthetic routes reported in the literature were verified. The methods described, including those that produce mixtures with TATP and other peroxides forms were also tested. This study will also focused in the preparation of other cyclic peroxides, including Hexamethelene Triperoxide Diamine (HMTD) and different forms of cyclic peroxides from ketones. This issue of thermodynamic versus kinetic control of secondary products of all syntheses and the effect of temperature in the distribution sub products of the syntheses was also addressed. A vibrational differentiation study of was carried out. Differences were found computationally in the υ(O-O), υ(C-O), δ(CH3-C) and δ(C-O) for Raman and IR bands and retention time and fragment patron for GC-MS and GC-FT-IR.
The mid-IR and near-IR interferometry of AGNs: key results and their implications
NASA Astrophysics Data System (ADS)
Kishimoto, M.
2015-09-01
Infrared interferometry has been very productive in directly probing the structure of AGNs at sub-pc scales. With tens of objects already probed in the mid-IR and near-IR, I will summarize the key results and im- plications from this direct exploration. The Keck interferometry in the near-IR and VLTI in the mid-IR shaped the luminosity dependence of the torus size and structure, while the latter also revealed an equatorial structure at several Rsub (dust sublimation radius), and a polar-elongated region at a few tens of Rsub. Notably, this polar component seems to dominate the compact mid-IR flux. This component can persuasively be attributed to a polar outflow. However, interferometry, through emissivity estimations, also indicates that it is not a UV-optically-thin cloud but participating in the obscuration of the nucleus. I will discuss how to accommodate all these facts to build a consistent picture.
VizieR Online Data Catalog: NIR spectral analysis of star-forming galaxies (Genzel+, 2014)
NASA Astrophysics Data System (ADS)
Genzel, R.; Forster Schreiber, N. M.; Rosario, D.; Lang, P.; Lutz, D.; Wisnioski, E.; Wuyts, E.; Wuyts, S.; Bandara, K.; Bender, R.; Berta, S.; Kurk, J.; Mendel, J. T.; Tacconi, L. J.; Wilman, D.; Beifiori, A.; Brammer, G.; Burkert, A.; Buschkamp, P.; Chan, J.; Carollo, C. M.; Davies, R.; Eisenhauer, F.; Fabricius, M.; Fossati, M.; Kriek, M.; Kulkarni, S.; Lilly, S. J.; Mancini, C.; Momcheva, I.; Naab, T.; Nelson, E. J.; Renzini, A.; Saglia, R.; Sharples, R. M.; Sternberg, A.; Tacchella, S.; van Dokkum, P.
2017-02-01
For the analysis in this paper, we included a total of 110 SFGs at z~1-3 with near-IR integral field or slit spectroscopy covering the Hα+[NII] line emission from surveys carried out with SINFONI, KMOS, LUCI, and GNIRS. The targets for these surveys were originally drawn from rest-frame optical, UV, and near-IR selected samples in broadband imaging surveys with optical spectroscopic redshifts, and from stellar mass-selected samples with near-IR or optical spectroscopic redshifts. (2 data files).
2006-07-01
detector that operated at the mid-infrared made of InSb and another detector that operated at the near ultraviolet (UV) made of cadmium sulphide .26 The IR... mercury cadmium telluride (MCT) detectors, operating in the long-wave IR region of 8– 12 microns. The detectors were scanned at 30Hz in a bi-directional...of cadmium-tellurium and mercury -tellurium (termed mercury cadmium telluride or HgCdTe). Note the contrast with the CLU’s IR system,76 which is a
Advances in low-cost long-wave infrared polymer windows
NASA Astrophysics Data System (ADS)
Weimer, Wayne A.; Klocek, Paul
1999-07-01
Recent improvements in engineered polymeric material compositions and advances in processing methodologies developed and patented at Raytheon Systems Company have produced long wave IR windows at exceptionally low costs. These UV stabilized, high strength windows incorporating subwavelength structured antireflection surfaces are enabling IR imaging systems to penetrate commercial markets and will reduce the cost of systems delivered to the military. The optical and mechanical properties of these windows will be discussed in detail with reference to the short and long-term impact on military IR imaging systems.
Park, Hye Min; Shon, Jong Cheol; Lee, Mee Youn; Liu, Kwang-Hyeon; Kim, Jeong Kee; Lee, Sang Jun; Lee, Choong Hwan
2014-01-01
Although many studies have been performed on the effects of ultraviolet (UV) radiation on the skin, only a limited number of reports have investigated these effects on non-skin tissue. This study aimed to describe the metabolite changes in the liver of hairless mice following chronic exposure to UVB radiation. We did not observe significant macroscopic changes or alterations in hepatic cholesterol and triglyceride levels in the liver of UVB-irradiated mice, compared with those for normal mice. In this study, we detected hepatic metabolite changes by UVB exposure and identified several amino acids, fatty acids, nucleosides, carbohydrates, phospholipids, lysophospholipids, and taurine-conjugated cholic acids as candidate biomarkers in response to UVB radiation in the mouse liver by using various mass spectrometry (MS)-based metabolite profiling including ultra-performance liquid chromatography-quadrupole time-of-flight (TOF)-MS, gas chromatography-TOF-MS and nanomate LTQ-MS. Glutamine exhibited the most dramatic change with a 5-fold increase in quantity. The results from altering several types of metabolites suggest that chronic UVB irradiation may impact significantly on major hepatic metabolism processes, despite the fact that the liver is not directly exposed to UVB radiation. MS-based metabolomic approach for determining regulatory hepatic metabolites following UV irradiation will provide a better understanding of the relationship between internal organs and UV light.
Exarchou, Vassiliki; Godejohann, Markus; van Beek, Teris A; Gerothanassis, Ioannis P; Vervoort, Jacques
2003-11-15
Structure elucidation of natural products usually relies on a combination of NMR spectroscopy with mass spectrometry whereby NMR trails MS in terms of the minimum sample amount required. In the present study, the usefulness of on-line solid-phase extraction (SPE) in LC-NMR for peak storage after the LC separation prior to NMR analysis is demonstrated. The SPE unit allows the use of normal protonated solvents for the LC separation and fully deuterated solvents for flushing the trapped compounds to the NMR probe. Thus, solvent suppression is no longer necessary. Multiple trapping of the same analyte from repeated LC injections was utilized to solve the problem of low concentration and to obtain 2D heteronuclear NMR spectra. In addition, a combination of the SPE unit with a recently developed cryoflow NMR probe and an MS was evaluated. This on-line LC-UV-SPE-NMR-MS system was used for the automated analysis of a Greek oregano extract. Combining the data provided by the UV, MS, and NMR spectra, the flavonoids taxifolin, aromadendrin, eriodictyol, naringenin, and apigenin, the phenolic acid rosmarinic acid, and the monoterpene carvacrol were identified. This automated technique is very useful for natural product analysis, and the large sensitivity improvement leads to significantly reduced NMR acquisition times.
Yao, Dezhong; Wang, Li; Arendt-Nielsen, Lars; Chen, Andrew C N
2007-11-01
Reference is a very virtual issue in EEG and ERP. Understanding the difference of various references will make the applications more confident. In this work, somatosensory evoked potential (SEP) with stimulation on the right hand was studied. The SEP spatio-temporal analysis was conducted comparatively on six references, left mastoid (contralateral mastoid reference, CM), right mastoid (ipsilateral mastoid reference, IM), linked mastoids (LM), average reference (AR), vertex reference (Cz) and the infinity reference (IR) newly proposed in 2001. Among the six, CM is the one used in actual recordings, and the other five are obtained by off-line re-referencing. The comparison is conducted on four selected components (P30 ms, P40 ms, N90 ms and P230 ms) in both temporal and spatial aspects. The results show that references may have a distinct influence on the amplitudes of the scalp potentials, with relative error at some electrodes larger than 500%, and for some electrodes it may even change the polarity. Pair-wise multiple comparison (Tukey test) shows that the differences of peak values among various references are very significant (P<0.001) between Cz and IR\\CM\\IM\\LM, and significant (P<0.01) between Cz and AR for component N90 ms; very significant (P<0.001) between Cz and IR\\CM\\IM\\LM\\AR, significant between IMLM and AR (P<0.01), CM and AR (P<0.05) for component P230 ms. The amplitude value order is CM/IM> or =LM>IR>AR>Cz. The two-ways (the six references vs. the four Peaks) repeated measures ANOVA test shows the effect of different references depends on various components; there is a statistically significant interaction between reference and the peak (P=<0.001). While for the spatial map of the potential amplitude, references will not affect the amplitude map shape if the color-bar is selected automatically, but if a fixed color-bar is chosen for data of various references, they may show some differences. These results mean a common reference is important for producing a comparable result between labs. As IR is theoretically a constant reference, we recommend it as the common choice in the future.
Simithy, Johayra; Gill, Gobind; Wang, Yu; Goodwin, Douglas C; Calderón, Angela I
2015-02-17
A simple and reliable liquid chromatography-mass spectrometry (LC-MS) assay has been developed and validated for the kinetic characterization and evaluation of inhibitors of shikimate kinase from Mycobacterium tuberculosis (MtSK), a potential target for the development of novel antitubercular drugs. This assay is based on the direct determination of the reaction product shikimate-3-phosphate (S3P) using electrospray ionization (ESI) and a quadrupole time-of-flight (Q-TOF) detector. A comparative analysis of the kinetic parameters of MtSK obtained by the LC-MS assay with those obtained by a conventional UV-assay was performed. Kinetic parameters determined by LC-MS were in excellent agreement with those obtained from the UV assay, demonstrating the accuracy, and reliability of this method. The validated assay was successfully applied to the kinetic characterization of a known inhibitor of shikimate kinase; inhibition constants and mode of inhibition were accurately delineated with LC-MS.
Announcment: Conference on Obscured AGN Across Cosmic Time
NASA Astrophysics Data System (ADS)
2006-12-01
Current deep surveys, notably in X-rays and the mid-IR, are making it possible to carry out a census of essentially all the luminous AGN in the Universe. By pene-trating the obscuration that, in Type 2 sources, hides the nuclear regions in the UV to the near-IR spectrum, these new surveys are finding the radio quiet coun-terparts of the powerful radio galaxies.
Al-Azzam, Wasfi; Pastrana, Emil A; Ferrer, Yancy; Huang, Qing; Schweitzer-Stenner, Reinhard; Griebenow, Kai
2002-01-01
Fourier transform infrared (FTIR) spectroscopy has emerged as a powerful tool to guide the development of stable lyophilized protein formulations by providing information on the structure of proteins in amorphous solids. The underlying assumption is that IR spectral changes in the amide I and III region upon protein dehydration are caused by protein structural changes. However, it has been claimed that amide I IR spectral changes could be the result of water removal per se. Here, we investigated whether such claims hold true. The structure of horseradish peroxidase (HRP) and poly(ethylene glycol)-modified HRP (HRP-PEG) has been investigated under various conditions (in aqueous solution, the amorphous dehydrated state, and dissolved/suspended in toluene and benzene) by UV-visible (UV-Vis), FTIR, and resonance Raman spectroscopy. The resonance Raman and UV-Vis spectra of dehydrated HRP-PEG dissolved in neat toluene or benzene were very similar to that of HRP in aqueous buffer, and thus the heme environment (heme iron spin, coordination, and redox state) was essentially the same under both conditions. Therefore, the three-dimensional structure of HRP-PEG dissolved in benzene and toluene was similar to that in aqueous solution. The amide I IR spectra of HRP-PEG in aqueous buffer and of dehydrated HRP-PEG dissolved in neat benzene and toluene were also very similar, and the secondary structure compositions (percentages of alpha-helices and beta-sheets) were within the standard error the same. These results are irreconcilable with recent claims that water removal per se could cause substantial amide I IR spectral changes (M. van de Weert, P.I. Haris, W.E. Hennink, and D.J. Crommelin. 2001. Anal. Biochem. 297:160-169). On the contrary, amide I IR spectral changes upon protein dehydration are caused by perturbations in the secondary structure. PMID:12496131
Kim, Anhye; Lim, Kyoung Soo; Lee, Howard; Chung, Hyewon; Yoon, Seo Hyun; Yu, Kyung-Sang; Cho, Joo-Youn; Jang, In-Jin; Chung, Jae-Yong
2016-07-01
Prolongation of the QT interval on an ECG is a surrogate marker for predicting the proarrhythmic potential of a drug under development. The aim of this study was to evaluate the QTc prolongation potential of two neuropsychiatric drugs, quetiapine immediate release (IR) and escitalopram, in healthy individuals. This was a randomized, open-label, 4×4 Williams crossover study, with four single-dose treatments [placebo, 400 mg moxifloxacin (positive control), 20 mg escitalopram, and 100 mg quetiapine IR], conducted in 40 healthy volunteers. Serial blood samples for pharmacokinetics and ECG were collected. Individually, RR-corrected QTc intervals (QTcI) and placebo-adjusted changes from baseline values of QTcI (ΔΔQTcI) were evaluated. Lower-bound values of the one-sided 95% confidence interval for ΔΔQTcI of moxifloxacin with more than 5 ms confirmed the sensitivity of the assay. The maximum upper bound 95% confidence interval for the ΔΔQTcI of quetiapine IR and escitalopram was 13.7 and 10.5 ms, with mean estimates of 10.2 and 6.9 ms, respectively. Peak effects of moxifloxacin and quetiapine IR on ΔΔQTcI were observed at approximately time to maximum concentration (Tmax), whereas that of escitalopram was observed 3 h after Tmax. The concentration-ΔΔQTcI relationships of quetiapine IR and escitalopram were relatively flat, as compared with that of moxifloxacin. The results demonstrated the validity of trial methodology and that quetiapine IR and escitalopram caused QT prolongation in healthy individuals. In addition, hysteresis of escitalopram-induced QTc prolongation. These results indicate that higher doses of these drugs could lead to greater QT prolongation in a dose-response manner.
NASA Astrophysics Data System (ADS)
Ganesh Kumar, C.; Poornachandra, Y.; Chandrasekhar, Cheemalamarri
2015-11-01
The physiochemical and biological properties of microbial derived gold nanoparticles have potential applications in various biomedical domains as well as in cancer therapy. We have fabricated anti-proliferative bacterial mediated gold nanoparticles (b-Au NPs) using a culture supernatant of Streptomyces clavuligerus and later characterized them by UV-visible, TEM, DLS, XRD and FT-IR spectroscopic techniques. The capping agent responsible for the nanoparticle formation was characterized based on SDS-PAGE and MALDI-TOF-MS analyses. They were tested for anticancer activity in A549, HeLa and DU145 cell lines. The biocompatibility and non-toxic nature of the nanoparticles were tested on normal human lung cell line (MRC-5). The b-Au NPs induced the cell cycle arrest in G2/M phase and also inhibited the microtubule assembly in DU145 cells. Mechanistic studies, such as ROS, MMP, Cyt-c, GSH, caspases 9, 8 and 3 activation and the Annexin V-FITC staining, along with the above parameters tested provided sufficient evidence that the b-Au NPs induced apoptosis through the intrinsic pathway. The results supported the use of b-Au NPs for future therapeutic application in cancer therapy and other biomedical applications.The physiochemical and biological properties of microbial derived gold nanoparticles have potential applications in various biomedical domains as well as in cancer therapy. We have fabricated anti-proliferative bacterial mediated gold nanoparticles (b-Au NPs) using a culture supernatant of Streptomyces clavuligerus and later characterized them by UV-visible, TEM, DLS, XRD and FT-IR spectroscopic techniques. The capping agent responsible for the nanoparticle formation was characterized based on SDS-PAGE and MALDI-TOF-MS analyses. They were tested for anticancer activity in A549, HeLa and DU145 cell lines. The biocompatibility and non-toxic nature of the nanoparticles were tested on normal human lung cell line (MRC-5). The b-Au NPs induced the cell cycle arrest in G2/M phase and also inhibited the microtubule assembly in DU145 cells. Mechanistic studies, such as ROS, MMP, Cyt-c, GSH, caspases 9, 8 and 3 activation and the Annexin V-FITC staining, along with the above parameters tested provided sufficient evidence that the b-Au NPs induced apoptosis through the intrinsic pathway. The results supported the use of b-Au NPs for future therapeutic application in cancer therapy and other biomedical applications. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr04577k
Occurrence of organic UV filters and metabolites in lebranche mullet (Mugil liza) from Brazil.
Molins-Delgado, Daniel; Muñoz, Ramón; Nogueira, Sylvia; Alonso, Mariana B; Torres, João Paulo; Malm, Olaf; Ziolli, Roberta Lourenço; Hauser-Davis, Rachel Ann; Eljarrat, Ethel; Barceló, Damià; Díaz-Cruz, M Silvia
2018-03-15
UV filters (UV-Fs) constitute a heterogeneous group of chemicals used as protection against the effects of UV radiation, widely used in all sort of goods and ubiquitous in the environment. The presence of these chemicals in fish is a matter of concern, because many UV-Fs display hormonal activity. In this study, muscle, gills, and liver from 11 Mugil liza individuals from the highly urbanized Guanabara Bay (Rio de Janeiro, Brazil) were analysed in order to detect eight UV-Fs and metabolites (4-dihydroxybenzophenone [BP1] (2-hydroxy-4-methoxybenzophenone [BP3], 4-methylbenzylidiene camphor [4MBC], ethylhexyl methoxycinnamate [EHMC], ethylhexyl dimethyl p-aminobenzoic acid [ODPABA], octocrylene [OC], 4-hydroxybenzophenone [4HB], and 4,4'-dihydroxybenzophenone [4DHB]) using liquid chromatography-tandem mass spectrometry (HPLC-MS/MS). Results showed that both target UV-Fs and metabolites were ubiquitous in the analysed tissues. Lower concentrations were observed in muscle and gills (3.07-31.6ngg -1 dry weight (dw)), whereas in liver significant amounts of metabolites (5.47-451ngg -1 dw) were present. With the concentrations determined in the fish, an estimation of the daily intake revealed that consumption of muscle in the diet represent from 0.3 to 15.2ng UV-Fs (kg body weight -1 ) d -1 , higher than those reported in fish for selected persistent organic pollutants (POPs). Copyright © 2017 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Buat, V.; Giovannoli, E.; Burgarella, D.; Altieri, B.; Amblard, A.; Arumugam, V.; Aussel, H.; Babbedge, T.; Blain, A.; Bock, J.; Boselli, A.; Castro-Rodríguez, N.; Cava, A.; Chanial, P.; Clements, D. L.; Conley, A.; Conversi, L.; Cooray, A.; Dowell, C. D.; Dwek, E.; Eales, S.; Elbaz, D.; Fox, M.; Franceschini, A.; Gear, W.; Glenn, J.; Griffin, M.; Halpern, M.; Hatziminaoglou, E.; Heinis, S.; Ibar, E.; Isaak, K.; Ivison, R. J.; Lagache, G.; Levenson, L.; Lonsdale, C. J.; Lu, N.; Madden, S.; Maffei, B.; Magdis, G.; Mainetti, G.; Marchetti, L.; Morrison, G. E.; Nguyen, H. T.; O'Halloran, B.; Oliver, S. J.; Omont, A.; Owen, F. N.; Page, M. J.; Pannella, M.; Panuzzo, P.; Papageorgiou, A.; Pearson, C. P.; Pérez-Fournon, I.; Pohlen, M.; Rigopoulou, D.; Rizzo, D.; Roseboom, I. G.; Rowan-Robinson, M.; Sánchez Portal, M.; Schulz, B.; Seymour, N.; Shupe, D. L.; Smith, A. J.; Stevens, J. A.; Strazzullo, V.; Symeonidis, M.; Trichas, M.; Tugwell, K. E.; Vaccari, M.; Valiante, E.; Valtchanov, I.; Vigroux, L.; Wang, L.; Ward, R.; Wright, G.; Xu, C. K.; Zemcov, M.
2010-11-01
The reliability of infrared (IR) and ultraviolet (UV) emissions to measure star formation rates (SFRs) in galaxies is investigated for a large sample of galaxies observed with the Spectral and Photometric Imaging Receiver (SPIRE) and the Photodetector Array Camera and Spectrometer (PACS) instruments on Herschel as part of the Herschel Multi-Tiered Extragalactic Survey (HerMES) project. We build flux-limited 250-μm samples of sources at redshift z < 1, cross-matched with the Spitzer/MIPS and GALEX catalogues. About 60 per cent of the Herschel sources are detected in UV. The total IR luminosities, LIR, of the sources are estimated using a spectral energy distribution (SED) fitting code that fits to fluxes between 24 and 500 μm. Dust attenuation is discussed on the basis of commonly used diagnostics: the LIR/LUV ratio and the slope, β, of the UV continuum. A mean dust attenuation AUV of mag is measured in the samples. LIR/LUV is found to correlate with LIR. Galaxies with and 0.5 < z < 1 exhibit a mean dust attenuation AUV of about 0.7 mag lower than that found for their local counterparts, although with a large dispersion. Our galaxy samples span a large range of β and LIR/LUV values which, for the most part, are distributed between the ranges defined by the relations found locally for starburst and normal star-forming galaxies. As a consequence the recipe commonly applied to local starbursts is found to overestimate the dust attenuation correction in our galaxy sample by a factor of ~2-3. The SFRs deduced from LIR are found to account for about 90 per cent of the total SFR; this percentage drops to 71 per cent for galaxies with (or ). For these faint objects, one needs to combine UV and IR emissions to obtain an accurate measure of the SFR.
The SOLAR-C Mission: Plan B Payload Concept
NASA Astrophysics Data System (ADS)
Shimizu, T.; Sakao, T.; Katsukawa, Y.; Group, J. S. W.
2012-08-01
The telescope concepts for the SOLAR-C Plan B mission as of the time of the Hinode-3 meeting were briefly presented for having comments from the international solar physics community. The telescope candidates are 1) near IR-visible-UV telescope with 1.5m aperture and enhanced spectro-polarimetric capability, 2) UV/EUV high throughput spectrometer, and 3) next generation X-ray telescope.
NASA Technical Reports Server (NTRS)
Christensen, L. E.; Okumura, M.; Sander, S. P.; Friedl, R. R.; Miller, C. E.; Sloan, J. J.
2004-01-01
Rate coefficients for the reaction HO(sub 2)+ NO(sub 2) + N(sub 2) --> HO(sub 2)NO(sub 2) + N(sub 2) (reaction 1) were measured using simultaneous near-IR and UV spectroscopy from 220 to 298 K and from 45 to 200 Torr.
High performance UV and thermal cure hybrid epoxy adhesive
NASA Astrophysics Data System (ADS)
Chen, C. F.; Iwasaki, S.; Kanari, M.; Li, B.; Wang, C.; Lu, D. Q.
2017-06-01
New type one component UV and thermal curable hybrid epoxy adhesive was successfully developed. The hybrid epoxy adhesive is complete initiator free composition. Neither photo-initiator nor thermal initiator is contained. The hybrid adhesive is mainly composed of special designed liquid bismaleimide, partially acrylated epoxy resin, acrylic monomer, epoxy resin and latent curing agent. Its UV light and thermal cure behavior was studied by FT-IR spectroscopy and FT-Raman spectroscopy. Adhesive samples cured at UV only, thermal only and UV + thermal cure conditions were investigated. By calculated conversion rate of double bond in both acrylic component and maleimide compound, satisfactory light curability of the hybrid epoxy adhesive was confirmed quantitatively. The investigation results also showed that its UV cure components, acrylic and bismalimide, possess good thermal curability too. The initiator free hybrid epoxy adhesive showed satisfactory UV curability, good thermal curability and high adhesion performance.
FT-IR, FT-Raman and UV-visible spectra of potassium 3-furoyltrifluoroborate salt
NASA Astrophysics Data System (ADS)
Iramain, Maximiliano A.; Davies, Lilian; Brandán, Silvia Antonia
2018-04-01
The potassium 3-furoyltrifluoroborate salt has been experimentally characterized by means of FT-IR, FT-Raman and UV-Visible spectroscopies. Here, the predicted FT-IR, FT-Raman and UV-visible spectra by using theoretical B3LYP/6-31G* and 6-311++G** calculations show very good correlations with the corresponding experimental ones. The solvation energies were predicted by using both levels of calculations. The NBO analyses reveal the high stability of the salt by using the B3LYP/6-31G* level of theory while the AIM studies evidence the ionic characteristics of the salt in both media. The strong blue colour observed on the K atom by using the molecular electrostatic potential mapped suggests that this region act as typical electrophilic site. The gap values have revealed that the salt in gas phase is more reactive than in solution, as was reported in the literature while, the F13⋯H6 interaction together with the Ksbnd O bond observed by the studies of their charges could probably modulate the reactivities of this salt in aqueous solution. The force fields were computed with the SQMFF methodology and the Molvib program to perform the complete vibrational analysis. Then, the 39 vibration normal modes classified as 26 A'+ 13 A″ were completely assigned and their force constants are also reported.
Cavitation induced Becquerel effect.
Prevenslik, T V
2003-06-01
The observation of an electrical current upon the ultraviolet (UV) illumination of one of a pair of identical electrodes in liquid water, called the Becquerel effect, was made over 150 years ago. More recently, an electrical current was found if the water surrounding one electrode was made to cavitate by focused acoustic radiation, the phenomenon called the cavitation induced Becquerel effect. Since cavitation is known to produce UV light, the electrode may simply absorb the UV light and produce the current by the photo-emission theory of photoelectrochemistry. But the current was found to be semi-logarithmic with the standard electrode potential which is characteristic of the oxidation of the electrode surface in the photo-decomposition theory, and not the photo-emission theory. High bubble collapse temperatures may oxidize the electrode, but this is unlikely because melting was not observed on the electrode surfaces. At ambient temperature, oxidation may proceed by chemical reaction provided a source of vacuum ultraviolet (VUV) radiation is available to produce the excited OH* states of water to react with the electrode. The source of VUV radiation is shown to be the spontaneous emission of coherent infrared (IR) radiation from water molecules in particles that form in bubbles because of surface tension, the spontaneous IR emission induced by cavity quantum electrodynamics. The excited OH* states are produced as the IR radiation accumulates to VUV levels in the bubble wall molecules.
SLR digital camera for forensic photography
NASA Astrophysics Data System (ADS)
Har, Donghwan; Son, Youngho; Lee, Sungwon
2004-06-01
Forensic photography, which was systematically established in the late 19th century by Alphonse Bertillon of France, has developed a lot for about 100 years. The development will be more accelerated with the development of high technologies, in particular the digital technology. This paper reviews three studies to answer the question: Can the SLR digital camera replace the traditional silver halide type ultraviolet photography and infrared photography? 1. Comparison of relative ultraviolet and infrared sensitivity of SLR digital camera to silver halide photography. 2. How much ultraviolet or infrared sensitivity is improved when removing the UV/IR cutoff filter built in the SLR digital camera? 3. Comparison of relative sensitivity of CCD and CMOS for ultraviolet and infrared. The test result showed that the SLR digital camera has a very low sensitivity for ultraviolet and infrared. The cause was found to be the UV/IR cutoff filter mounted in front of the image sensor. Removing the UV/IR cutoff filter significantly improved the sensitivity for ultraviolet and infrared. Particularly for infrared, the sensitivity of the SLR digital camera was better than that of the silver halide film. This shows the possibility of replacing the silver halide type ultraviolet photography and infrared photography with the SLR digital camera. Thus, the SLR digital camera seems to be useful for forensic photography, which deals with a lot of ultraviolet and infrared photographs.
NASA Astrophysics Data System (ADS)
Ahmadi, F.; Alizadeh, A. A.; Shahabadi, N.; Rahimi-Nasrabadi, M.
2011-09-01
In this work a complex of Al 3+ with curcumin ([Al(curcumin) (EtOH) 2](NO 3) 2) was synthesized and characterized by UV-vis, FT-IR, elemental analysis and spectrophotometric titration techniques. The mole ratio plot revealed a 1:1 complex between Al 3+ and curcumin in solution. For binding studies of this complex to calf thymus-DNA various methods such as: UV-vis, fluorescence, circular dichroism (CD), FT-IR spectroscopy and cyclic voltammetry were used. The intrinsic binding constant of ACC with DNA at 25 °C was calculated by UV-vis and cyclic voltammetry as 2.1 × 10 4 and 2.6 × 10 4, respectively. The thermodynamic studies showed that the reaction is enthalpy and entropy favored. The CD results showed that only the Δ-ACC interacts with DNA and the Δ-ACC form has not any tendency to interact with DNA, also the pure curcumin has not any stereoselective interaction with CT-DNA. Fluorimetric studies showed that fluorescence enhancement was initiated by a static process in the ground state. The cyclic voltammetry showed that ACC interact with DNA with a binding site size of 2. From the FT-IR we concluded that the Δ-ACC interacts with DNA via partial electrostatic and minor groove binding. In comparison with previous works it was concluded that curcumin significantly reduced the affinity of Al 3+ to the DNA.
Kajimoto, Shinji; Shirasawa, Daisuke; Horimoto, Noriko Nishizawa; Fukumura, Hiroshi
2013-05-14
Ultrafast phase separation of water and 2-butoxyethanol mixture was induced by nanosecond IR laser pulse irradiation. After a certain delay time, a UV laser pulse was introduced to induce photoreduction of aurate ions, which led to the formation of gold nanoparticles in dynamic phase-separating media. The structure and size of the nanoparticles varied depending on the delay time between the IR and UV pulses. For a delay time of 5 and 6 μs, gold square plates having edge lengths of 150 and 100 nm were selectively obtained, respectively. With a delay time of 3 μs, on the other hand, the size of the square plates varied widely from 100 nm to a few micrometers. The size of the gold square plates was also varied by varying the total irradiation time of the IR and UV pulses. The size distribution of the square plates obtained under different conditions suggests that the growth process of the square plates was affected by the size of the nanophases during phase separation. Electron diffraction patterns of the synthesized square plates showed that the square plates were highly crystalline with a Au(100) surface. These results showed that the nanophases formed during laser-induced phase separation can provide detergent-free reaction fields for size-controlled nanomaterial synthesis.
NASA Astrophysics Data System (ADS)
Arockia doss, M.; Rajarajan, G.; Thanikachalam, V.; Selvanayagam, S.; Sridhar, B.
2017-01-01
A piperidin-4-one containing picrate 3,5-diethyl -2,6-di(thiophen-2-yl)piperidin-4-on-1-ium picrate [3,5-DPPP] was synthesized. The molecular structure of 3,5-DPPP was confirmed by FT-IR, NMR, Uv-Vis, single crystal XRD analysis and DFT and HF methods with 6-31G(d,p) basis set. The XRD data confirm the transfer of protons from picric acid (O2) to piperidin-4-one ring (N1). The 3,5-DPPP compound is stabilized by the presence of intermolecular and intramolecular hydrogen bonds (N-H⋯O, C-H⋯S and C-H⋯O). Density functional theory and HF calculations have been used widely for calculating a wide variety of molecular properties such as optimized structure, FT-IR and Uv-Vis spectra, and provided reliable results which are in agreement with experimental data. The charge density data have been used to understand the properties of molecular systems. Furthermore, several quantum chemical insights have been obtained in the form of the total and partial density of states, the HOMO-LUMO energy gap and electrostatic potential map etc. In addition, the polarizability and first hyperpolarizability were calculated to show the potential applications of 3,5-DPPP in nonlinear optics.
Bokhart, Mark T.; Rosen, Elias; Thompson, Corbin; Sykes, Craig; Kashuba, Angela D. M.; Muddiman, David C.
2015-01-01
A quantitative mass spectrometry imaging (QMSI) technique using infrared matrix-assisted laser desorption electrospray ionization (IR-MALDESI) is demonstrated for the antiretroviral (ARV) drug emtricitabine in incubated human cervical tissue. Method development of the QMSI technique leads to a gain in sensitivity and removal of interferences for several ARV drugs. Analyte response was significantly improved by a detailed evaluation of several cationization agents. Increased sensitivity and removal of an isobaric interference was demonstrated with sodium chloride in the electrospray solvent. Voxel-to-voxel variability was improved for the MSI experiments by normalizing analyte abundance to a uniformly applied compound with similar characteristics to the drug of interest. Finally, emtricitabine was quantified in tissue with a calibration curve generated from the stable isotope-labeled analog of emtricitabine followed by cross-validation using liquid chromatography tandem mass spectrometry (LC-MS/MS). The quantitative IR-MALDESI analysis proved to be reproducible with an emtricitabine concentration of 17.2±1.8 μg/gtissue. This amount corresponds to the detection of 7 fmol/voxel in the IR-MALDESI QMSI experiment. Adjacent tissue slices were analyzed using LC-MS/MS which resulted in an emtricitabine concentration of 28.4±2.8 μg/gtissue. PMID:25318460
van der Heeft, E; Dijkman, E; Baumann, R A; Hogendoorn, E A
2000-05-19
The performance of mass spectrometric (MS) detection and UV detection in combination with reversed-phase liquid chromatography without and with the use of coupled column RPLC (LC-LC) has been compared for the trace analysis of phenylurea herbicides in environmental waters. The selected samples of this comparative study originated from an inter-laboratory study. For both detection modes, a 50 mm x 4.6 mm I.D. column and a 100 mm x 4.6 mm I.D. column packed with 3 microm C18 were used as the first (C-1) and second (C-2) column, respectively. Atmospheric pressure chemical ionization mass spectrometry was performed on a magnetic sector instrument. The LC-LC-MS analysis was carried out on-line by means of direct large volume (11.7 ml) injection (LVI). The performance of both on-line (LVI, 4 ml of sample) and off-line LC-LC-UV (244 nm) analysis was investigated. The latter procedure consisted of a solid-phase extraction (SPE) of 250 ml of water sample on a 500 mg C18 cartridge. The comparative study showed that LC-LC-MS is more selective then LC-LC-UV and, in most cases, more sensitive. The LVI-LC-LC-MS approach combines direct quantification and confirmation of most of the analytes down to a level of 0.01 microg/l in water samples in less then 30 min. As regards LC-LC-UV, the off-line method appeared to be a more viable approach in comparison with the on-line procedure. This method allows the screening of phenylurea's in various types of water samples down to a level of at least 0.05 microg/l. On-line analysis with LVI provided marginal sensitivity (limits of detection of about 0.1 microg/l) and selectivity was sometimes less in case of surface water samples. Both the on-line LVI-LC-LC-MS method and the LC-LC-UV method using off-line SPE were validated by analysing a series of real-life reference samples. These samples were part of an inter-laboratory test and contained residues of herbicides ranging from 0.02 to 0.8 microg/l. Beside good correlation between the methods the data agreed very well with the true values of the samples.
Biodesulphurization of gasoline by Rhodococcus erythropolis supported on polyvinyl alcohol.
Fatahi, A; Sadeghi, S
2017-05-01
A new biodesulphurization (BDS) method has been considered using Rhodococcus erythropolis supported on polyvinyl alcohol (PVA) for BDS of thiophene as a gasoline sulphur model compound in n-hexane as the solvent, subsequently this biocatalyst has been applied to BDS of gasoline samples. The obtained results according to UV-Spectrophotometer analysis at 240 nm showed that 97·41% of thiophene at the optimum condition of primary concentration 80 mg l -1 , pH = 7, by 0·1 g of biocatalyst in 30°C and after 20 h of contact time has been degraded. These optimum conditions have been applied to gasoline BDS and the biodegradation of gasoline thiophenic compounds have been investigated by gas chromatography-mass spectrometry (GC-MS). According to GC-MS, thiophene and its 2-methyl, 3-methyl and 2- ethyl derivatives had acceptable biodegradation efficiencies of about 26·67, 21·03, 23·62% respectively. Also, benzothiophene that has been detected in a gasoline sample had 38·89% biodegradation efficiency at optimum conditions, so biomodification of PVA by R. erythropolis produces biocatalysts with an active metabolism that facilitates the interaction of bacterial strain with gasoline thiophenic compounds. The morphology and surface functional groups of supported R. erythropolis on PVA have been investigated by scanning electron microscope (SEM) and FT-IR spectroscopy respectively. SEM images suggest some regular layered shape for the supported bacteria. FT-IR spectra indicate a desirable interaction between bacterial cells and polymer supports. Also, the recovery of biocatalyst has been investigated and after three times of using in BDS activity, its biocatalytic ability had no significant decreases. The biomodification of polyvinyl alcohol by Rhodococcus erythropolis described herein produces a new biocatalyst which can be used for significantly reducing the thiophenic compounds of gasoline and other fossil fuels. The immobilization process is to increase the biodegradation efficiency of cells and accelerating the biodesulphurization process. © 2017 The Society for Applied Microbiology.
Cinar, Mehmet; Coruh, Ali; Karabacak, Mehmet
2011-12-01
This study reports the characterization of disperse red 1 acrylate compound by spectral techniques and quantum chemical calculations. The spectroscopic properties were analyzed by FT-IR, UV-vis, (1)H NMR and (13)C NMR techniques. FT-IR spectrum in solid state was recorded in the region 4000-400 cm(-1). The UV-vis absorption spectrum of the compound that dissolved in methanol was recorded in the range of 200-800 nm. The (1)H and (13)C NMR spectra were recorded in CDCl(3) solution. The structural and spectroscopic data of the molecule in the ground state were calculated using density functional theory (DFT) employing B3LYP exchange correlation and the 6-311++G(d,p) basis set. The vibrational wavenumbers were calculated and scaled values were compared with experimental FT-IR spectrum. A satisfactory consistency between the experimental and theoretical spectra was obtained and it shows that the hybrid DFT method is very useful in predicting accurate vibrational structure, especially for high-frequency region. The complete assignments were performed on the basis of the experimental results and total energy distribution (TED) of the vibrational modes, calculated with scaled quantum mechanics (SQM) method. Isotropic chemical shifts were calculated using the gauge-invariant atomic orbital (GIAO) method. A study on the electronic properties were performed by timedependent DFT (TD-DFT) and CIS(D) approach. To investigate non linear optical properties, the electric dipole moment μ, polarizability α, anisotropy of polarizability Δα and molecular first hyperpolarizability β were computed. The linear polarizabilities and first hyperpolarizabilities of the studied molecule indicate that the compound can be a good candidate of nonlinear optical materials. Copyright © 2011 Elsevier B.V. All rights reserved.
Materials That Enhance Efficiency and Radiation Resistance of Solar Cells
NASA Technical Reports Server (NTRS)
Sun, Xiadong; Wang, Haorong
2012-01-01
A thin layer (approximately 10 microns) of a novel "transparent" fluorescent material is applied to existing solar cells or modules to effectively block and convert UV light, or other lower solar response waveband of solar radiation, to visible or IR light that can be more efficiently used by solar cells for additional photocurrent. Meanwhile, the layer of fluorescent coating material remains fully "transparent" to the visible and IR waveband of solar radiation, resulting in a net gain of solar cell efficiency. This innovation alters the effective solar spectral power distribution to which an existing cell gets exposed, and matches the maximum photovoltaic (PV) response of existing cells. By shifting a low PV response waveband (e.g., UV) of solar radiation to a high PV response waveband (e.g. Vis-Near IR) with novel fluorescent materials that are transparent to other solar-cell sensitive wavebands, electrical output from solar cells will be enhanced. This approach enhances the efficiency of solar cells by converting UV and high-energy particles in space that would otherwise be wasted to visible/IR light. This innovation is a generic technique that can be readily implemented to significantly increase efficiencies of both space and terrestrial solar cells, without incurring much cost, thus bringing a broad base of economical, social, and environmental benefits. The key to this approach is that the "fluorescent" material must be very efficient, and cannot block or attenuate the "desirable" and unconverted" waveband of solar radiation (e.g. Vis-NIR) from reaching the cells. Some nano-phosphors and novel organometallic complex materials have been identified that enhance the energy efficiency on some state-of-the-art commercial silicon and thin-film-based solar cells by over 6%.
Radiative transfer and radiative driving of outflows in active galactic nuclei and starbursts
NASA Astrophysics Data System (ADS)
Novak, G. S.; Ostriker, J. P.; Ciotti, L.
2012-12-01
To facilitate the study of black hole fuelling, star formation and feedback in galaxies, we outline a method for treating the radial forces on interstellar gas due to absorption of photons by dust grains. The method gives the correct behaviour in all of the relevant limits [dominated by the central point source; dominated by the distributed isotropic source; optically thin; optically thick to ultraviolet (UV)/optical; optically thick to infrared (IR)] and reasonably interpolates between the limits when necessary. The method is explicitly energy conserving so that UV/optical photons that are absorbed are not lost, but are rather redistributed to the IR where they may scatter out of the galaxy. We implement the radiative transfer algorithm in a two-dimensional hydrodynamical code designed to study feedback processes in the context of early-type galaxies. We find that the dynamics and final state of simulations are measurably but only moderately affected by radiative forces on dust, even when assumptions about the dust-to-gas ratio are varied from zero to a value appropriate for the Milky Way. In simulations with high gas densities designed to mimic ultraluminous IR galaxies with a star formation rate of several hundred solar masses per year, dust makes a more substantial contribution to the dynamics and outcome of the simulation. We find that, despite the large opacity of dust to UV radiation, the momentum input to the flow from radiation very rarely exceeds L/c due to two factors: the low opacity of dust to the re-radiated IR and the tendency for dust to be destroyed by sputtering in hot gas environments. We also develop a simplification of our radiative transfer algorithm that respects the essential physics but is much easier to implement and requires a fraction of the computational cost.
NASA Astrophysics Data System (ADS)
Imai, Rieko; Sugitani, Koji; Miao, Jingqi; Fukuda, Naoya; Watanabe, Makoto; Kusune, Takayoshi; Pickles, Andrew J.
2017-08-01
We carried out near-infrared (IR) observations to examine star formation toward the bright-rimmed cloud SFO 12, of which the main exciting star is O7V star in W5-W. We found a small young stellar object (YSO) cluster of six members embedded in the head of SFO 12 facing its exciting star, aligned along the UV radiation incident direction from the exciting star. We carried out high-resolution near-IR observations with the Subaru adaptive optics (AO) system and revealed that three of the cluster members appear to have circumstellar envelopes, one of which shows an arm-like structure in its envelope. Our near-IR and {L}\\prime -band photometry and Spitzer IRAC data suggest that formation of two members at the tip side occurred in advance of other members toward the central part, under our adopted assumptions. Our near-IR data and previous studies imply that more YSOs are distributed in the region just outside the cloud head on the side of the main exciting star, but there is little sign of star formation toward the opposite side. We infer that star formation has been sequentially occurring from the exciting star side to the central part. We examined archival data of far-infrared and CO (J=3-2) which reveals that, unlike in the optical image, SFO 12 has a head-tail structure that is along the UV incident direction. This suggests that SFO 12 is affected by strong UV from the main exciting star. We discuss the formation of this head-tail structure and star formation there by comparing with a radiation-driven implosion (RDI) model.
Nam, Jin-Ju; Min, Ji-Eun; Son, Min-Ho; Oh, Jin-Hwan; Kang, Seunghyun
2017-11-01
Sun irradiation is one of major extrinsic stressors responsible for premature skin aging through activation and expression of 11 beta-hydroxysteroid dehydrogenase type 1 (11β-HSD1), which converts inactive cortisone to active cortisol. The aim of this study was to evaluate the inhibitory effects of red ginseng extract containing high concentrations of ginsenoside Rg3 (S) (GERg3) on 11β-HSD1-induced skin photoaging. To evaluate the inhibitory effects of GERg3 on ultraviolet- (UV) or infrared (IR)-induced skin photoaging, human dermal fibroblasts or a normal human 3D skin model was exposed to UV or an IR. RT-PCR, ELISA, Western blot, and H&E staining were used for evaluations. GERg3 was isolated from crude red ginseng. GERg3 inhibited the increased expressions of 11β-HSD1, interleukin (IL)-6, and matrix metalloproteinase-1 (MMP-1) in UVB- or IR-exposed Hs68 cells. Additionally, the increased cortisol, IL-6, and MMP-1 expressions were effectively reduced by GERg3 in UVA-exposed 3D skin models. The photoinduced decrease in type 1 procollagen also recovered as a result of GERg3 treatment in Hs68 cells and the 3D skin model. In addition, the UVA-exposed dermal thickness was decreased in comparison with the UVA-protected 3D skin model, recovered with GERg3 treatment. GERg3 had antiphotoaging effects in UV- or IR-exposed human dermal fibroblasts and normal human 3D skin model. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
[Study on UPLC-UV-MS fingerprints of different medicinal parts of Poria cocos].
Li, Ke; Zhang, Li-Qun; Nie, Jing
2013-03-01
To establish an analytical method for the fingerprint of triterpenoid constituents of Poria cocos by UPLC-UV-MS and compare the fingerprints of different medicinal parts of Poria cocos. With dehydropachymic acid as reference substance, the separation was performed on Shim-pack XR-ODS II (75 mm x 2.0 mm, 2.2 microm) analytical column. The mobile phase was consisted of acetonitrile and 0.1% formic acid as gradient eluent. The UV detection wavelength was 242 nm. The flow rate was 0.5 mL/min. The column temperature was 30 degrees C. The cluster analysis was carried on by SPSS 16. 0. The UPLC-UV-MS fingerprints of triterpenoid constituents of Poria cocos were set up. The result showed that 22 peaks were found in different medicinal parts and 12 peaks of them were common. The results of method validation met technical requirement of fingerprints; Triterpenoid constituents in pared skin of Poria and peeled and sliced Poria were different, and the effect of habitat on the quality of peeled and sliced Poria was more obvious than that of pared skin of Poria. The method is stable and reliable with a good reproducibility and provides a reference standard for the quality control of Poria cocos.
Comparison of detection techniques for capillary electrophoresis analysis of gold nanoparticles.
Matczuk, Magdalena; Aleksenko, Svetlana S; Matysik, Frank-Michael; Jarosz, Maciej; Timerbaev, Andrei R
2015-05-01
As metallic nanoparticles are growing in importance as analytes in CE, increases an interest in appropriate detection methods for their quantification in various samples. For gold nanoparticles (AuNPs), the most common UV detection poses intricacy of inadequate sensitivity that hinders the applicability of CE. With the objective of resolving this challenge, UV detection was compared with C(4) D and ICP-MS as alternative modes of detection for AuNPs. A C(4) D detector, applied under pressure-driven conditions, exhibited better sensitivity than a UV detector. However, C(4) D turned to be unsatisfactory to differentiate the signal of AuNPs at common CE conditions despite varying the nature of BGE and detection conditions. Due to intrinsic sensitivity and low background levels typical to Au, ICP-MS greatly surpasses UV detection. After optimization trials, CE-ICP-MS gained the LOD of AuNPs as low as 2 × 10(-15) M, as well as an excellent performance in terms of signal stability and linearity. Also importantly, the optimized BGE appears to be well matched to explore the behavior of AuNPs in biologically relevant systems. This was demonstrated by probing the interaction between AuNPs and the main blood-transporting protein, HSA. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
NASA Astrophysics Data System (ADS)
Gord, Joseph R.; Hewett, Daniel M.; Kubasik, Matthew A.; Zwier, Timothy S.
2015-06-01
2-Aminoisobutyric acid (Aib) is an achiral, α-amino acid having two equivalent methyl groups attached to C_α. Extended Aib oligomers are known to have a strong preference for the adoption of a 310-helical structure in the condensed phase. Here, we have taken a simplifying step and focused on the intrinsic folding propensities of Aib by looking at a series of capped Aib oligomers in the gas phase, free from the influence of solvent molecules and cooled in a supersonic expansion. Resonant two-photon ionization and IR-UV holeburning have been used to record single-conformation UV spectra using the Z-cap as the UV chromophore. Resonant ion-dip infrared (RIDIR) spectroscopy provides single-conformation IR spectra in the OH stretch and NH stretch regions. Data have been collected on a set of Z-(Aib)n-X oligomers with n = 1, 2, 4, 6 and X = -OH and -OMethyl. The impacts of these capping groups and differences in backbone length have been found to dramatically influence the conformational space accessed by the molecules studied here. Oligomers of n=4 have sufficient backbone length for a full turn of the 310-helix to be formed. Early interpretation of the data collected shows clear spectroscopic markers signaling the onset of 310-helix formation as well as evidence of structures incorporating C7 and C14 hydrogen bonded rings. Toniolo, C.; Bonora, G. M.; Barone, V.; Bavoso, A.; Benedetti, E.; Di Blasio, B.; Grimaldi, P.; Lelj, F.; Pavone, V.; Pedone, C., Conformation of Pleionomers of α-Aminoisobutyric Acid. Macromolecules 1985, 18, 895-902.
NASA Astrophysics Data System (ADS)
Oi, Nagisa; Goto, Tomotsugu; Malkan, Matthew; Pearson, Chris; Matsuhara, Hideo
2017-08-01
The mass, metallicity, and star formation rate (SFR) of a galaxy are crucial parameters in understanding galaxy formation and evolution. However, the relation between these parameters, (i.e., the fundamental relation) is still a matter of debate for luminous infrared (IR) galaxies, which carry a bulk of the SFR budget of the universe at z ∼ 1. We have investigated the relation among stellar mass, gas-phase oxygen abundance, and SFR of the Japanese infrared satellite AKARI-detected mid-IR galaxies at z ∼ 0.88 in the AKARI north ecliptic pole deep field. We observed ∼350 AKARI sources with Subaru/Fiber Multi Object Spectrograph near-IR spectrograph, and detected confirmed Hα emission lines from 25 galaxies and expected Hα emission lines from 44 galaxies. The SFRHα, IR of our sample is almost constant (〈SFRHα, IR〉 = ∼ 25 M⊙ yr - 1) over the stellar mass range of our sample. Compared with main-sequence (MS) galaxies at a similar redshift range (z ∼ 0.78), the average SFR of our detected sample is comparable for massive galaxies ( ∼ 1010.58 M⊙), while higher by ∼0.6 dex for less massive galaxies ( ∼ 1010.05 M⊙). We measure metallicities from the [N II]/Hα emission line ratio. We find that the mass-metallicity relation of our individually measured sources agrees with that for optically-selected star-forming galaxies at z ∼ 0.1, while metallicities of stacked spectra agree with that of MS galaxies at z ∼ 0.78. Considering the high SFR of individually measured sources, the fundamental metallicity relation (FMR) of the IR galaxies is different from that at z ∼ 0.1. However, on the mass-metallicity plane, they are consistent with the MS galaxies, highlighting the higher SFR of the IR galaxies. This suggests that the evolutionary path of our infrared galaxies is different from that of MS galaxies. A possible physical interpretation includes that the star-formation activities of IR galaxies at z ∼ 0.88 in our sample are enhanced by interactions and/or mergers of galaxies, but the inflow of metal-poor gas is not yet induced, keeping the metallicity intact.
Improved Fiber Optics Final Report CRADA No. TSB-957-94
DOE Office of Scientific and Technical Information (OSTI.GOV)
Fox, Glenn; Wilford, Sandy
The existing chemistry of Lumenyte® (an illumination fiber optic developed by LIC) was such that the component monomers inherently polymerized to a very hard mass if exposed to environmental IR, UV, or a combination of these frequencies. Lumenyte optic also would cure to a hard mass by exposure to the UV & IR generated by the illuminating lamps-although this could occur at a much slower rate, and the hardening could occur even when the adverse frequencies were filtered. The resultant product did not have the flexibility for the required applications. LIC's objective was to include other monomeric components in themore » formulation to impart permanent flexibility. LIC sought the expertise and the use of the facilities in the Polymeric Materials Section at LLNL to achieve this objective.« less
NASA Astrophysics Data System (ADS)
Kumari, G. Vanitha; Asha, S.; Ananth, A. Nimrodh; Rajan, M. A. Jothi; Mathavan, T.
2018-04-01
Polyethylene glycol (PEG)/Silver (Ag) functionalized reduced graphene oxide aerogel (RGOA) was synthesized. PEG/Ag decorated reduced graphene oxide aerogel was characterized using XRD, Raman spectroscopy, Fourier transform infrared spectroscopy (FT-IR). The surface morphology of PEG/Ag/RGOA was analyzed using scanning electron microscope. The non-covalent interaction between reduced graphene oxide layers and the interaction between PEG and Ag on RGOA were studied by FT-IR spectra. It was observed that the interaction between Ag and PEG could enhance the properties of RGOA. Methyl Orange (MO) dye degradation was observed from UV-Vis Spectra. The process was studied by monitoring the simultaneous decrease in the height of UV-Vis absorption peak of dye solution. The results show that PEG/RGOA and PEG/Ag/RGOA are an efficient catalyst for dye degradation.
Ghosh, Batu; Shirahata, Naoto
2014-01-01
This review describes a series of representative synthesis processes, which have been developed in the last two decades to prepare silicon quantum dots (QDs). The methods include both top-down and bottom-up approaches, and their methodological advantages and disadvantages are presented. Considerable efforts in surface functionalization of QDs have categorized it into (i) a two-step process and (ii) in situ surface derivatization. Photophysical properties of QDs are summarized to highlight the continuous tuning of photoluminescence color from the near-UV through visible to the near-IR range. The emission features strongly depend on the silicon nanostructures including QD surface configurations. Possible mechanisms of photoluminescence have been summarized to ascertain the future challenges toward industrial use of silicon-based light emitters. PMID:27877634
NASA Astrophysics Data System (ADS)
Albayrak, Çiğdem; Gümrükçüoğlu, İsmail E.; Odabaşoğlu, Mustafa; İskeleli, Nazan Ocak; Ağar, Erbil
2009-08-01
Some novel azo compounds were prepared by the reaction of 2-hydroxyacetophenone with aniline and its substituted derivatives. The structures of synthesized azo compounds were determined by IR, UV-Vis, 1H NMR and 13C NMR spectroscopic techniques and the structures of some of these compounds were also determined by X-ray diffraction studies. Structural analysis using IR in solid state shows that the azo form is favoured in the azo compounds whereas UV-Vis analysis of the azo compounds in solution has shown that there is a azo and ionic form. The azo compounds in the basic solvents dimethylformamide (DMF) and dimethylsulfoxide (DMSO) are both azo and ionic form while these compounds in ethyl alcohol (EtOH) and chloroform (CHCl 3) are only azo form.
NASA Astrophysics Data System (ADS)
Kalinowska, M.; Piekut, J.; Bruss, A.; Follet, C.; Sienkiewicz-Gromiuk, J.; Świsłocka, R.; Rzączyńska, Z.; Lewandowski, W.
2014-03-01
The molecular structure of Mn(II), Cu(II), Zn(II), Cd(II) and Ca(II) ferulates (4-hydroxy-3-methoxycinnamates) was studied. The selected metal ferulates were synthesized. Their composition was established by means of elementary and thermogravimetric analysis. The following spectroscopic methods were used: infrared (FT-IR), Raman (FT-Raman), nuclear magnetic resonance (13C, 1H NMR) and ultraviolet-visible (UV/VIS). On the basis of obtained results the electronic charge distribution in studied metal complexes in comparison with ferulic acid molecule was discussed. The microbiological study of ferulic acid and ferulates toward Escherichia coli, Bacillus subtilis, Candida albicans, Pseudomonas aeruginosa, Staphylococcus aureus and Proteus vulgaris was done.
Zhou, Jing; Chen, Yan; Wang, Ying; Gao, Xia; Qu, Ding; Liu, Congyan
2013-12-24
The aim of this study was to compare the significance of the intestinal hydrolysis of prenylated flavonoids in Herba Epimedii by an intestinal enzyme and flora. Flavonoids were incubated at 37 °C with rat intestinal enzyme and intestinal flora. HPLC-UV was used to calculate the metabolic rates of the parent drug in the incubation and LC/MS/MS was used to determine the chemical structures of metabolites generated by different flavonoid glycosides. Rates of flavonoid metabolism by rat intestinal enzyme were quicker than those of intestinal flora. The sequence of intestinal flora metabolic rates was icariin>epimedin B>epimedin A>epimedin C>baohuoside I, whereas the order of intestinal enzyme metabolic rates was icariin>epimedin A>epimedin C>epimedin B>baohuoside I. Meanwhile, the LC/MS/MS graphs showed that icariin produced three products, epimedin A/B/C had four and baohuoside I yielded one product in incubations of both intestinal enzyme and flora, which were more than the results of HPLC-UV due to the fact LC/MS/MS has lower detectability and higher sensitivity. Moreover, the outcomes indicated that the rate of metabolization of flavonoids by intestinal enzyme were faster than those of intestinal flora, which was consistent with the HPLC-UV results. In conclusion, the metabolic pathways of the same components by intestinal flora and enzyme were the same. What's more, an intestinal enzyme such as lactase phlorizin hydrolase exhibited a more significant metabolic role in prenylated flavonoids of Herba Epimedi compared with intestinal flora.
Cakova, Veronika; Urbain, Aurélie; Antheaume, Cyril; Rimlinger, Nicole; Wehrung, Patrick; Bonté, Frédéric; Lobstein, Annelise
2015-01-01
In our continued efforts to contribute to the general knowledge on the chemical diversity of orchids, we have decided to focus our investigations on the Aeridinae subtribe. Following our previous phytochemical study of Vanda coerulea, which has led to the identification of phenanthrene derivatives, a closely related species, Aerides rosea Lodd. ex Lindl. & Paxton, was chosen for investigation. To identify new secondary metabolites, and to avoid isolation of those already known, by means of the combined systems HPLC-DAD(diode-array detector) with high-resolution tandem mass spectrometry (HRMS/MS) and HPLC-DAD-MS-SPE(solid-phase extraction)-UV-NMR. A dereplication strategy was developed using a HPLC-DAD-HRMS/MS targeted method and applied to fractions from A. rosea stem extract. Characterisation of unknown minor compounds was then performed using the combined HPLC-DAD-MS-SPE-UV-NMR system. The dereplication method allowed the characterisation of four compounds (gigantol, imbricatin, methoxycoelonin and coelonin), previously isolated from Vanda coerulea stem extract. The analyses of two fractions permitted the identification of five additional minor constituents including one phenanthropyran, two phenanthrene and two dihydrophenanthrene derivatives. The full set of NMR data of each compound was obtained from microgram quantities. Nine secondary metabolites were characterised in A. rosea stems, utilising HPLC systems combined with high-resolution analytical systems. Two of them are newly described phenanthrene derivatives: aerosanthrene (5-methoxyphenanthrene-2,3,7-triol) and aerosin (3-methoxy-9,10-dihydro-2,5,7-phenanthrenetriol). Copyright © 2014 John Wiley & Sons, Ltd.
NASA Technical Reports Server (NTRS)
Gruppioni, Carlotta; Pozzi, F.; Rodighiero, G.; Delvecchio, I.; Berta, S.; Pozzetti, L.; Zamorani, G.; Andreani, P.; Cimatti, A.; Ilbert, O.;
2013-01-01
We exploit the deep and extended far-IR data sets (at 70, 100 and 160 µm) of the Herschel Guaranteed Time Observation (GTO) PACS Evolutionary Probe (PEP) Survey, in combination with the Herschel Multi-tiered Extragalactic Survey data at 250, 350 and 500 µm, to derive the evolution of the rest-frame 35-, 60-, 90- and total infrared (IR) luminosity functions (LFs) up to z 4.We detect very strong luminosity evolution for the total IR LF (LIR ? (1 + z)(sup 3.55 +/- 0.10) up to z 2, and ? (1 + z)(sup 1.62 +/- 0.51) at 2 less than z less than approximately 4) combined with a density evolution (? (1 + z)(sup -0.57 +/- 0.22) up to z 1 and ? (1 + z)(sup -3.92 +/- 0.34) at 1 less than z less than approximately 4). In agreement with previous findings, the IR luminosity density (?IR) increases steeply to z 1, then flattens between z 1 and z 3 to decrease at z greater than approximately 3. Galaxies with different spectral energy distributions, masses and specific star formation rates (SFRs) evolve in very different ways and this large and deep statistical sample is the first one allowing us to separately study the different evolutionary behaviours of the individual IR populations contributing to ?IR. Galaxies occupying the well-established SFR-stellar mass main sequence (MS) are found to dominate both the total IR LF and ?IR at all redshifts, with the contribution from off-MS sources (=0.6 dex above MS) being nearly constant (20 per cent of the total ?IR) and showing no significant signs of increase with increasing z over the whole 0.8 < z <2.2 range. Sources with mass in the range 10 = log(M/solar mass) = 11 are found to dominate the total IR LF, with more massive galaxies prevailing at the bright end of the high-z (greater than approximately 2) LF. A two-fold evolutionary scheme for IR galaxies is envisaged: on the one hand, a starburst-dominated phase in which the Super Massive Black Holes (SMBH) grows and is obscured by dust (possibly triggered by a major merging event), is followed by an AGN-dominated phase, then evolving towards a local elliptical. On the other hand, moderately star-forming galaxies containing a low-luminosity AGN have various properties suggesting they are good candidates for systems in a transition phase preceding the formation of steady spiral galaxies.
Drooger, Jan C; Jager, Agnes; Lam, Mei-Ho; den Boer, Mathilda D; Sleijfer, Stefan; Mathijssen, Ron H J; de Bruijn, Peter
2015-10-10
The aim of this study was to validate an earlier developed high-performance highly sensitive ultra performance liquid chromatography/tandem mass spectrometry (UPLC-MS/MS) method for quantification of tamoxifen and its three main metabolites (N-desmethyl-tamoxifen, 4-hydroxy-tamoxifen and 4-hydroxy-N-desmethyl-tamoxifen) in scalp hair. This non-invasive method might, by segmental analysis of hair, be useful in the determination of the concentration of drugs and its metabolites over time, which can be used to study a wide variety of clinical relevant questions. Hair samples (150-300 hair strands, cut as close to the scalp as possible from the posterior vertex region of the head) were collected from female patients taking tamoxifen 20mg daily (n=19). The analytes were extracted using a liquid-liquid extraction procedure with carbonate buffer at pH 8.8 and a mixture of n-hexane/isopropranol method, followed by UPLC-MS/MS chromatography, based on an earlier validated method. The calibration curves were linear in the range of 1.00-200 pmol for tamoxifen and N-desmethyl-tamoxifen, with lower limit of quantitation of 1.00 pmol and 0.100-20.0 pmol with lower limit of quantitation of 0.100 pmol for endoxifen and 4-hydroxy-tamoxifen. Assay performance was fair with a within-run and between-run variability less than 9.24 at the three quality control samples and less than 15.7 for the lower limit of quantitation. Importantly, a steep linear decline was observed from distal to proximal hair segments. Probably, this is due to UV exposure as we showed degradation of tamoxifen and its metabolites after exposure to UV-light. Furthermore, higher concentrations of tamoxifen were found in black hair samples compared to blond and brown hair samples. We conclude that measurement of the concentration of tamoxifen and its main metabolites in hair is possible, with the selective, sensitive, accurate and precise UPLC-MS/MS method. However, for tamoxifen, it seems not possible to determine exposure over time with segmental analysis of hair, probably largely due to the effect of UV irradiation. Further research should therefore focus on quantification of other anticancer drugs, in segmented scalp hair, that are less sensitive to UV irradiation. Copyright © 2015 Elsevier B.V. All rights reserved.
IR Variability of Eta Carinae: The 2009 Event
NASA Astrophysics Data System (ADS)
Smith, Nathan
2008-08-01
Every 5.5 years, η Carinae experiences a dramatic ``spectroscopic event'' when high-excitation lines in its UV, optical, and IR spectrum disappear, and its hard X-ray and radio continuum flux crash. This periodicity has been attributed to an eccentric binary system with a shell ejection occurring at periastron, and the next periastron event will occur in January 2009. The last event in June/July 2003 was poorly observed because the star was very low in the sky, but this next event is perfectly suited for an intense ground-based monitoring campaign. Mid-IR images and spectra with T-ReCS provide a direct measure of changes in the current bolometric luminosity and a direct measure of the mass in dust formation episodes that may occur at periastron in the colliding wind shock. Near-IR emission lines trace related changes in the post-event wind and ionization changes in the circumstellar environment needed to test specific models for the cause of η Car's variability as it recovers from its recent ``event''. Because the nebular geometry is known very well from previous observations in this program, monitoring the changes in nebular ionization will yield a 3-D map of the changing asymmetric UV radiation field geometry in the binary system, and the first estimate of the orientation of its orbit.
Ultraviolet /UV/ sensitive phosphors for silicon imaging detectors
NASA Technical Reports Server (NTRS)
Viehmann, W.; Cowens, M. W.; Butner, C. L.
1981-01-01
The fluorescence properties of UV sensitive organic phosphors and the radiometric properties of phosphor coated silicon detectors in the VUV, UV, and visible wavelengths are described. With evaporated films of coronene and liumogen, effective quantum efficiencies of up to 20% have been achieved on silicon photodiodes in the vacuum UV. With thin films of methylmethacrylate (acrylic), which are doped with organic laser dyes and deposited from solution, detector quantum efficiencies of the order of 15% for wavelengths of 120-165 nm and of 40% for wavelengths above 190 nm have been obtained. The phosphor coatings also act as antireflection coatings and thereby enhance the response of coated devices throughout the visible and near IR.
On Gauge Invariant Cosmological Perturbations in UV-modified Hořava Gravity: A Brief Introduction
NASA Astrophysics Data System (ADS)
Park, Mu-In
2018-01-01
We revisit gauge invariant cosmological perturbations in UV-modified, z = 3 Hořava gravity with one scalar matter field, which has been proposed as a renormalizable gravity theory without the ghost problem in four dimensions. We confirm that there is no extra graviton modes and general relativity is recovered in IR, which achieves the consistency of the model. From the UV-modification terms which break the detailed balance condition in UV, we obtain scale-invariant power spectrums for non-inflationary backgrounds, like the power-law expansions, without knowing the details of early expansion history of Universe. This could provide a new framework for the Big Bang cosmology.
Design of UV-absorbing PVDF membrane via surface-initiated AGET ATRP
NASA Astrophysics Data System (ADS)
Dong, Li; Liu, Xiangdong; Xiong, Zhengrong; Sheng, Dekun; Zhou, Yan; Lin, Changhong; Yang, Yuming
2018-03-01
Herein, PVDF membranes with excellent UV-absorbing property were first synthesized through grafting the polymerizable low-molecular-weight organic UV-absorber 2-hydroxy-4-(3-methacryloxy-2-hydroxylpropoxy) benzophenone (BPMA) onto α-bromoester-functionalized PVDF membranes via the surface-initiated activator generated by electron transfer atom transfer radical polymerization (SI-AGET ATRP). The surface initiators were immobilized by the reaction between 2-bromoisobutyryl bromide (BIBB) and the hydroxylated PVDF membranes. PVDF-g-PBPMA membranes with different grafting densities were obtained by tuning the polymerization time and the modified membranes were characterized by 1H-NMR, FT-IR, XPS, SEM, UV-vis Spectrophotometer, TGA and DSC. The experimental results indicated that PBPMA chains were successfully introduced onto PVDF membranes. Most importantly, the PVDF-g-PBPMA membranes exhibited outstanding UV-shielding property. UV-vis transmittance spectra showed that most UV light below 360 nm could be absorbed by PVDF-g-PBPMA membranes and the whole UV light region (200-400 nm) can be blocked with the reaction time increased.
X-Ray Properties of Lyman Break Galaxies in the Hubble Deep Field North Region
NASA Technical Reports Server (NTRS)
Nandra, K.; Mushotzky, R. F.; Arnaud, K.; Steidel, C. C.; Adelberger, K. L.; Gardner, J. P.; Teplitz, H. I.; Windhorst, R. A.; White, Nicholas E. (Technical Monitor)
2002-01-01
We describe the X-ray properties of a large sample of z approximately 3 Lyman Break Galaxies (LBGs) in the region of the Hubble Deep Field North, derived from the 1 Ms public Chandra observation. Of our sample of 148 LBGs, four are detected individually. This immediately gives a measure of the bright AGN (active galactic nuclei) fraction in these galaxies of approximately 3 per cent, which is in agreement with that derived from the UV (ultraviolet) spectra. The X-ray color of the detected sources indicates that they are probably moderately obscured. Stacking of the remainder shows a significant detection (6 sigma) with an average luminosity of 3.5 x 10(exp 41) erg/s per galaxy in the rest frame 2-10 keV band. We have also studied a comparison sample of 95 z approximately 1 "Balmer Break" galaxies. Eight of these are detected directly, with at least two clear AGN based on their high X-ray luminosity and very hard X-ray spectra respectively. The remainder are of relatively low luminosity (< 10(exp 42) erg/s, and the X-rays could arise from either AGN or rapid star-formation. The X-ray colors and evidence from other wavebands favor the latter interpretation. Excluding the clear AGN, we deduce a mean X-ray luminosity of 6.6 x 10(exp 40) erg/s, a factor approximately 5 lower than the LBGs. The average ratio of the UV and X-ray luminosities of these star forming galaxies L(sub UV)/L (sub X), however, is approximately the same at z = 1 as it is at z = 3. This scaling implies that the X-ray emission follows the current star formation rate, as measured by the UV luminosity. We use our results to constrain the star formation rate at z approximately 3 from an X-ray perspective. Assuming the locally established correlation between X-ray and far-IR (infrared) luminosity, the average inferred star formation rate in each Lyman break galaxy is found to be approximately 60 solar mass/yr, in excellent agreement with the extinction-corrected UV estimates. This provides an external check on the UV estimates of the star formation rates, and on the use of X-ray luminosities to infer these rates in rapidly starforming galaxies at high redshift.
Entropy bound of local quantum field theory with generalized uncertainty principle
NASA Astrophysics Data System (ADS)
Kim, Yong-Wan; Lee, Hyung Won; Myung, Yun Soo
2009-03-01
We study the entropy bound for local quantum field theory (LQFT) with generalized uncertainty principle. The generalized uncertainty principle provides naturally a UV cutoff to the LQFT as gravity effects. Imposing the non-gravitational collapse condition as the UV-IR relation, we find that the maximal entropy of a bosonic field is limited by the entropy bound A 3 / 4 rather than A with A the boundary area.
Atomic Oxygen Effects on POSS Polyimides
2011-07-25
resistance to UV damage, and excellent thermal properties.1 Despite the desirable properties of Kapton, this polyimide and all organic polymeric materials...stability, insulation properties, IR transparency, low solar absorptance, resistance to UV damage, and excellent thermal properties.1 Despite the...8 × 1021 atoms cm-2. Free standing films of MC-POSS polyimide were sewn to a Kapton blanket and exposed to a sweeping ram in LEO on MISSE-5
2005 6th Annual Science and Engineering Technology Conference
2005-04-21
BioFAC VBAIDS Hybrid: PCR/Immuno Fast PCR Fast Immunoassay Mass Spec (Pyrolysis) SIBS UV -LIF IR Fluorochrome Charge Detect. BioCADS Trigger Advanced...Weights Beam forming Signal Processing mapped to GPU architecture Vector Processor STAP (STAP-BOY) GaN High Frequency Transistor (WBG-RF) UV Laser...Service anti- counterfeiting • Embedded security strips Technology Limitations and Barriers • Training and cost (training intensive) Land Borders North Land
An auroral oval at the footprint of Saturn's kilometric radio sources, colocated with the UV aurorae
NASA Astrophysics Data System (ADS)
Lamy, L.; Cecconi, B.; Prangé, R.; Zarka, P.; Nichols, J. D.; Clarke, J. T.
2009-10-01
Similarly to other magnetized planets, Saturn displays auroral emissions generated by accelerated electrons gyrating around high-latitude magnetic field lines. They mainly divide in ultraviolet (UV) and infrared (IR) aurorae, excited by electron collisions with the upper atmosphere, and Saturn's kilometric radiation (SKR), radiated from higher altitudes by electron-wave resonance. Whereas spatially resolved UV and IR images of atmospheric aurorae reveal a continuous auroral oval around each pole, the SKR source locus was only indirectly constrained by the Voyager radio experiment to a limited local time (LT) range on the morningside, leading to interpretation of the SKR modulation as a fixed flashing light. Here, we present resolved SKR maps derived from the Cassini Radio and Plasma Wave Science (RPWS) experiment using goniopolarimetric techniques. We observe radio sources all around the planet, organized along a high-latitude continuous auroral oval. Observations of the Hubble Space Telescope obtained in January 2004 and January 2007 have been compared to simultaneous and averaged Cassini-RPWS measurements, revealing that SKR and UV auroral ovals are very similar, both significantly enhanced on the dawnside. These results imply that the SKR and atmospheric aurorae are triggered by the same populations of energetic electron beams, requiring a unified model of particle acceleration and precipitation on Saturn.
Lucero, Diego; Zago, Valeria; López, Graciela I; Graffigna, Mabel; Fainboim, Hugo; Miksztowicz, Verónica; Meroño, Tomás; Belli, Susana; Levalle, Oscar; Wikinski, Regina; Brites, Fernando; Berg, Gabriela; Schreier, Laura
2011-01-14
It is not elucidated if liver fat deposits associated to metabolic syndrome (MS) aggravate the atherogenic state. We evaluated, in MS patients, if the presence of non-alcoholic hepatic steatosis (HS) determines differences in inflammatory markers and VLDL characteristics. Seventy-five patients with MS were divided into 2 groups depending on the presence or absence of HS, assessed by ultrasound. Lipid profile, free fatty acids (FFA), VLDL composition, adiponectin, tumor necrosis factor-alpha (TNF-α), high sensitivity C-reactive protein (hs-CRP), and soluble adhesion molecules (sVCAM-1 and sICAM-1) were measured. HS patients presented increased triglycerides levels, HOMA-IR and FFA. Patients with HS showed a reduction in adiponectin (p = 0.04) and increase in hs-CRP (p = 0.02), independently of insulin-resistance (IR). FFA correlated positively with TNF-α (p = 0.04) and inversely with adiponectin (p = 0.01). hs-CRP correlated with all inflammatory markers, independently of IR: TNF-α (r = 0.34, p = 0.02), sVCAM-1 (r = 0.29 p = 0.03), sICAM-1 (r = 0.56, p = 0.01), adiponectin (r = -0.34, p = 0.04). HS patients presented higher VLDL mass and number of particles. Adiponectin correlated with VLDL cholesterol content (r = -0.47, p = 0.04), independently of IR. VLDL, once secreted, would suffer from changes, becoming more atherogenic. Simple HS would play an important role increasing cardiovascular risk, independently of IR. hs-CRP may represent a useful biomarker of this condition. Copyright © 2010 Elsevier B.V. All rights reserved.
IDENTIFICATION OF NEW OZONE DISINFECTION BY PRODUCTS IN DRINKING WATER
Using a combination of spectral identification techniques-gas chromatography coupled with low- and high-resolution electron-impact mass spectrometry (GC/EI-MS), low- and high-resolution chemical ionization mass spectrometry (GC/CI-MS), and infrared spectroscopy (GC/ IR)-we identi...
NASA Astrophysics Data System (ADS)
Komasa, Anna
2018-01-01
Experimental and theoretical IR, Raman, UV-Vis, 1H and 13C NMR spectra of 1,4-di(3-hydroxypyridinium)butane dibromide and 1,4-di(3-hydroxymethylpyridinium)butane dibromide were obtained and analyzed. Optimized geometrical structures of the studied compounds were calculated by B3LYP method using 6-311++G(d,p) basis set and employed to determine the theoretical wavenumbers and intensities of IR and Raman spectra. The frequency assignments were supported by the potential energy distribution (PED) analysis. The significant role of the intermolecular interactions and the hydrogen bond was revealed on the basis of IR spectra. The calculated GIAO/B3LYP/6-311++G(d,p) isotropic magnetic shielding constants were used to predict the 1H and 13C chemical shifts for the optimized structures. Accuracy of the prediction of 1H and 13C chemical shifts was significantly improved by a simulation of the solvent in calculations. On the basis of UV-Vis spectra the acid-base equilibrium in the water solution of 1,4-di(3-hydroxypyridinium)butane dibromide was found.
The existence of imidazoline corrosion inhibitors
DOE Office of Scientific and Technical Information (OSTI.GOV)
Martin, J.A.; Valone, F.W.
1985-05-01
Spectroscopic methods, i.e., Fourier transform infrared (FT-IR), carbon-13 nuclear magnetic reasonance (/sup 13/C NMR), and ultraviolet (UV) spectroscopy, were used to investigate the actual chemical composition of oilfield corrosion inhibitors. Inhibitor formulations consisting of an amide or imidazoline reacted with a dimer-trimer acid, along with an ethoxylated surfactant and an aromatic solvent, were used for these studies. /sup 13/C NMR and FT-IR spectra of these inhibitors, as well as spectra of pure imidazolines, showed that the imidazoline functional group was fairly rapidly hydrolyzed to the amide form. For instance, in FT-IR studies, the imine functional group decreased in intensity asmore » a function of time. Coincident with this was an increase in the intensities of the vibrational resonances attributed to the amide functionality. The relative molar ratio of imidazoline to amide in a corrosion inhibitor could be calculated via UV spectroscopy. Within a 20 day interval after inhibitor synthesis, this ratio decreased by a factor greater than 20. These results, as well as a discussion of their economic impact on oilfield corrosion inhibitor formulation, are presented in this paper.« less
STREAK CAMERA MEASUREMENTS OF THE APS PC GUN DRIVE LASER
DOE Office of Scientific and Technical Information (OSTI.GOV)
Dooling, J. C.; Lumpkin, A. H.
We report recent pulse-duration measurements of the APS PC Gun drive laser at both second harmonic and fourth harmonic wavelengths. The drive laser is a Nd:Glass-based chirped pulsed amplifier (CPA) operating at an IR wavelength of 1053 nm, twice frequency-doubled to obtain UV output for the gun. A Hamamatsu C5680 streak camera and an M5675 synchroscan unit are used for these measurements; the synchroscan unit is tuned to 119 MHz, the 24th subharmonic of the linac s-band operating frequency. Calibration is accomplished both electronically and optically. Electronic calibration utilizes a programmable delay line in the 119 MHz rf path. Themore » optical delay uses an etalon with known spacing between reflecting surfaces and is coated for the visible, SH wavelength. IR pulse duration is monitored with an autocorrelator. Fitting the streak camera image projected profiles with Gaussians, UV rms pulse durations are found to vary from 2.1 ps to 3.5 ps as the IR varies from 2.2 ps to 5.2 ps.« less
Gholipour, Yousef; Nonami, Hiroshi; Erra-Balsells, Rosa
2008-12-01
Single-cell cytoplasm sap (1-10 pL) was extracted by using a pressure probe glass microcapillary tip from tulip leaf and bulb and analyzed by UV-MALDI-TOF MS for free underivatized carbohydrate content. Three matrices including 2,5-dihydroxybenzoic acid (DHB), 2,4,6-trihydroxyacetophenone (THAP), and carbon nanotubes (CNTs) in positive ion mode were selected for analysis because of acceptable carbohydrate-related signal reproducibility. Disaccharide and oligosaccharide (up to 15 Hex when THAP was used, 11 Hex with DHB, and 7 Hex with CNTs) were detected in tulip bulb cell cytoplasm sample. When DHB was used as matrix, neutral carbohydrates were more abundantly detected as sodiated cations; the sugar-related signals, however, appeared as dominant potassiated cations when THAP and CNTs were used. Small amount of monosaccharide was also detected in bulb cell cytoplasm with CNTs as matrix. UV-MALDI-TOF MS of leaf cell extract resulted in high-resolution detection of hexose and disaccharide with DHB, THAP, and CNTs.
Prevalence of hyperandrogenism and polycystic ovary syndrome in female to male transsexuals.
Becerra-Fernández, Antonio; Pérez-López, Gilberto; Román, Miriam Menacho; Martín-Lazaro, Juan F; Lucio Pérez, María Jesús; Asenjo Araque, Nuria; Rodríguez-Molina, José Miguel; Berrocal Sertucha, María Carmen; Aguilar Vilas, María Victorina
2014-01-01
Prevalence of hyperandrogenism (HA), including the polycystic ovary syndrome (PCOS), in female-to-male transsexuals (FMT) is high. This has been related to metabolic syndrome (MS), which appears to increase cardiovascular morbidity and mortality throughout cross-sex hormone (CSH) therapy. To assess the prevalence of HA and PCOS in FMT patients before the start of CSH therapy, and their association to MS and its components, insulin resistance (IR) and other cardiovascular risk (CVR) factors. Seventy-seven FMTs underwent clinical and biochemical assessment for HA before the start of CSH therapy. CVR, IR, and other MS parameters were also assessed. Prevalence of HA was 49.4% (73.7% were cases of PCOS [Rotterdam criteria]), and prevalence of PCOS in the overall sample was 36.4%. Prevalence of MS was 38.4% and 51.7% according to ATP-III and IDF criteria respectively). MS (according to ATP-III and IDF criteria respectively) was found in 36.8% and 57.9% as compared to 25.6% and 41% of patients with and without HA respectively (p<0.0001 and P<0.01 respectively). Of total patients, 54.5% had normal weight (body mass index [BMI] 18.5-24.9 kg.m(-2)), 26% were overweight (BMI 25-29.9 kg.m(-2)), and 19.5% were obese (BMI ≥ 30 kg.m(-2)). After adjusting for BMI, the comparison of hormonal, metabolic, and anthropometric parameters showed statistically significant differences in plasma glucose, HOMA-IR, and abdominal circumference (P<0.001 for all), as well as HDL cholesterol (HDL) (P=0.033), but not in total testosterone or calculated free testosterone levels. In the total sample, 27.3% had HDL levels less than 50mg/dL. Overall HA, and PCOS in particular, are highly prevalent in FMTs. HA and PCOS are related to early development of SM, IR, and other CVR factors with unknown consequences in adulthood. Copyright © 2013 SEEN. Published by Elsevier Espana. All rights reserved.
Structure of 2,4-Diaminopyrimidine - Theobromine Alternate Base Pairs
NASA Technical Reports Server (NTRS)
Gengeliczki, Zsolt; Callahan, Michael P.; Kabelac, Martin; Rijs, Anouk M.; deVries, Mattanjah S.
2011-01-01
We report the structure of clusters of 2,4-diaminopyrimidine with 3,7-dimethylxanthine (theobromine) in the gas phase determined by IR-UV double resonance spectroscopy in both the near-IR and mid-IR regions in combination with ab initio computations. These clusters represent potential alternate nucleobase pairs, geometrically equivalent to guanine-cytosine. We have found the four lowest energy structures, which include the Watson-Crick base pairing motif. This Watson-Crick structure has not been observed by resonant two-photon ionization (R2PI) in the gas phase for the canonical DNA base pairs.
Nural Yilgor; Dilek Dogu; Roderquita Moore; Evren Terzi; S. Nami Kartal
2013-01-01
The chemical and morphological changes in heartwood specimens of Liquidambar orientalis Mill. caused by the white-rot fungus Trametes versicolor and the brown-rot fungi Tyromyces palustris and Gloeophyllum trabeum were studied by wet chemistry, FT-IR, GC-MS analyses, and photo-...
NASA Astrophysics Data System (ADS)
Patsaeva, Marina; Khatuntsev, Igor; Turin, Alexander; Zasova, Ludmila; Bertaux, Jean-loup
2017-04-01
A set of UV (365 nm) and IR (965 nm) images obtained by the Venus Monitoring Camera (VMC) was used to study the circulation of the mesosphere at two altitude levels. Displacement vectors were obtained by wind tracking in automated mode for observation period from 2006 to 2014 for UV images [1,2] and from 2006 to 2012 for IR images. The long observation period and good longitude-latitude coverage by single measurements allowed us to focus on the study of the slow-periodic component. The influence of the underlying surface topography on the change of speed of the average zonal wind at UV level at low latitudes, discovered by visual methods has been described in [3]. Analysis of the longitude-latitude distribution of the zonal and meridional components for 172000 (257 orbits) digital individual wind measurements at UV level and for 32,000 (150 orbits) digital individual wind measurements at IR level allows us to compare the influence of Venus topography on the change of the zonal and meridional components at both cloud levels. At the UV level (67±2 km) longitudinal profiles of the zonal speed for different latitude bins in low latitudes correlate with surface profiles. These correlations are most noticeable in the region of Aphrodite Terra. The correlation shift depends on the surface height. Albedo profiles correlate with surface profiles also at high latitudes. Zonal speed profiles at low latitude (5-15°S) depend not only on altitude, but also on local time. Minimum of the zonal speed is observed over Aphrodite Terra (90-100°E) at about 12 LT. A diurnal harmonic with an extremum over Aphrodite Terra was found. It can be considered as a superposition of a solar-synchronous tide and a stationary wave caused by interaction of the windstream with the surface. At the IR level (55±4 km) a correlation between surface topography and meridional speed was found in the region 10-30°S. The average meridional flow is equatorward at the IR level, but in the region Aphrodite Terra it is poleward. Acknowledgements: M.V. Patsaeva, I.V. Khatuntsev and J.-L. Bertaux were supported by the Ministry of Education and Science of Russian Federation grant 14.W03.31.0017. References: [1] Khatuntsev, I.V., M.V. Patsaeva, D.V. Titov, N.I. Ignatiev, A.V. Turin, S.S. Limaye, W.J. Markiewicz, M. Almeida, T. Roatsch and R. Moissl (2013), Cloud level winds from the Venus Express Monitoring Camera imaging., Icarus, 226, 140-158. [2] Patsaeva, M.V., I.V. Khatuntsev, D.V. Patsaev, D.V. Titov, N.I. Ignatiev, W.J. Markiewicz, A.V. Rodin (2015), The relationship between mesoscale circulation and cloud morphology at the upper cloud level of Venus from VMC/Venus Express, Planet. Space Sci. 113(08), 100-108, doi:10.1016/j.pss.2015.01.013. [3] Bertaux, J.-L., I. V. Khatuntsev, A. Hauchecorne, W. J. Markiewicz, E. Marcq, S. Lebonnois, M. Patsaeva, A. Turin, and A. Fedorova (2016), Influence of Venus topography on the zonal wind and UV albedo at cloud top level: The role of stationary gravity waves, J. Geophys. Res. Planets, 121, 1087-1101, doi:10.1002/2015JE004958.