GRACE-FO Prelaunch Briefing

NASA Image and Video Library

2018-05-21

NASA Headquarters Public Affairs Officer Steve Cole moderates a Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission prelaunch media briefing, Monday, May 21, 2018, at Vandenberg Air Force Base in California. The twin GRACE-FO spacecraft will measure changes in how mass is redistributed within and among Earth's atmosphere, oceans, land and ice sheets, as well as within Earth itself. Photo Credit: (NASA/Bill Ingalls)

GRACE-FO Briefing

NASA Image and Video Library

2018-04-30

Karen Fox, of NASA's Office of Communications, introduces Michael Watkins, GRACE-FO science lead and director of NASA's Jet Propulsion Laboratory and Frank Webb, GRACE-FO project scientist at JPL, during a briefing on the upcoming launch of the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission, Monday, April 30, 2018 at NASA Headquarters in Washington. The twin GRACE-FO spacecraft will measure and monitor monthly changes in how mass is redistributed within and among Earth's atmosphere, oceans, land and ice sheets, as well as within Earth itself. Photo Credit: (NASA/Joel Kowsky)

GRACE-FO Briefing

NASA Image and Video Library

2018-04-30

Karen Fox, of NASA's Office of Communications, right, discusses the upcoming launch of the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission with Michael Watkins, GRACE-FO science lead and director of NASA's Jet Propulsion Laboratory, left, and Frank Webb, GRACE-FO project scientist at JPL, Monday, April 30, 2018 at NASA Headquarters in Washington. The twin GRACE-FO spacecraft will measure and monitor monthly changes in how mass is redistributed within and among Earth's atmosphere, oceans, land and ice sheets, as well as within Earth itself. Photo Credit: (NASA/Joel Kowsky)

GRACE-FO Briefing

NASA Image and Video Library

2018-04-30

Frank Webb, GRACE-FO project scientist at JPL, discusses the upcoming launch of the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission, Monday, April 30, 2018 at NASA Headquarters in Washington. The twin GRACE-FO spacecraft will measure and monitor monthly changes in how mass is redistributed within and among Earth's atmosphere, oceans, land and ice sheets, as well as within Earth itself. Photo Credit: (NASA/Joel Kowsky)

GRACE-FO Briefing

NASA Image and Video Library

2018-04-30

Michael Watkins, GRACE-FO science lead and director of NASA's Jet Propulsion Laboratory, discusses the upcoming launch of the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission, Monday, April 30, 2018 at NASA Headquarters in Washington. The twin GRACE-FO spacecraft will measure and monitor monthly changes in how mass is redistributed within and among Earth's atmosphere, oceans, land and ice sheets, as well as within Earth itself. Photo Credit: (NASA/Joel Kowsky)

TrmFO, a Fibronectin-Binding Adhesin of Mycoplasma bovis.

PubMed

Guo, Yongpeng; Zhu, Hongmei; Wang, Jiayao; Huang, Jing; Khan, Farhan Anwar; Zhang, Jingjing; Guo, Aizhen; Chen, Xi

2017-08-09

Mycoplasma bovis is an important pathogenic mycoplasma, causing the cattle industry serious economic losses. Adhesion is a crucial step in the mycoplasmas' infection and colonization process; fibronectin (Fn), an extracellular matrix glycoprotein, is a molecular bridge between the bacterial adhesins and host cell receptors. The present study was designed to characterize the Fn-binding ability of methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase (TrmFO) and its role in M. bovis cytoadherence. The trmFO ( MBOV_RS00785 ) gene was cloned and expressed in E. coli BL21, and polyclonal antibodies against the recombinant TrmFO (rTrmFO) were raised in rabbits. Immunoblotting demonstrated that TrmFO was an immunogenic component, and the TrmFO expression was conserved in different M. bovis isolates. The mycoplasmacidal assay further showed that in the presence of complement, rabbit anti-recombinant TrmFO serum exhibited remarkable mycoplasmacidal efficacy. TrmFO was detected in both the M. bovis membrane and cytoplasm. By ligand dot blot and enzyme-linked immunosorbent assay (ELISA) binding assay, we found that rTrmFO bound Fn in a dose-dependent manner. Immunostaining visualized by confocal laser scanning microscopy showed that rTrmFO had capacity to adhere to the embryonic bovine lung (EBL) cells. In addition, the adhesion of M. bovis and rTrmFO to EBL cells could be inhibited by anti-rTrmFO antibodies. To the best of our knowledge, this is the first report to characterize the Fn-binding ability of TrmFO and its role in the bacterial adhesion to host cells.

TrmFO, a Fibronectin-Binding Adhesin of Mycoplasma bovis

PubMed Central

Guo, Yongpeng; Zhu, Hongmei; Wang, Jiayao; Huang, Jing; Khan, Farhan Anwar; Zhang, Jingjing; Guo, Aizhen; Chen, Xi

2017-01-01

Mycoplasma bovis is an important pathogenic mycoplasma, causing the cattle industry serious economic losses. Adhesion is a crucial step in the mycoplasmas’ infection and colonization process; fibronectin (Fn), an extracellular matrix glycoprotein, is a molecular bridge between the bacterial adhesins and host cell receptors. The present study was designed to characterize the Fn-binding ability of methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase (TrmFO) and its role in M. bovis cytoadherence. The trmFO (MBOV_RS00785) gene was cloned and expressed in E. coli BL21, and polyclonal antibodies against the recombinant TrmFO (rTrmFO) were raised in rabbits. Immunoblotting demonstrated that TrmFO was an immunogenic component, and the TrmFO expression was conserved in different M. bovis isolates. The mycoplasmacidal assay further showed that in the presence of complement, rabbit anti-recombinant TrmFO serum exhibited remarkable mycoplasmacidal efficacy. TrmFO was detected in both the M. bovis membrane and cytoplasm. By ligand dot blot and enzyme-linked immunosorbent assay (ELISA) binding assay, we found that rTrmFO bound Fn in a dose-dependent manner. Immunostaining visualized by confocal laser scanning microscopy showed that rTrmFO had capacity to adhere to the embryonic bovine lung (EBL) cells. In addition, the adhesion of M. bovis and rTrmFO to EBL cells could be inhibited by anti-rTrmFO antibodies. To the best of our knowledge, this is the first report to characterize the Fn-binding ability of TrmFO and its role in the bacterial adhesion to host cells. PMID:28792486

40 CFR 264.231 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.

Code of Federal Regulations, 2011 CFR

2011-07-01

... chemical characteristics of the wastes, including their potential to migrate through soil or to volatilize or escape into the atmosphere; (2) The attenuative properties of underlying and surrounding soils or other materials; (3) The mobilizing properties of other materials co-disposed with these wastes; and (4...

Grace-Fo satellites

NASA Image and Video Library

2017-11-09

The Gravity Recovery and Climate Experiment Follow-on (GRACE-FO) mission is a partnership between NASA and the German Research Centre for Geosciences (GFZ). GRACE-FO is a successor to the original GRACE mission, which began orbiting Earth on March 17, 2002. GRACE-FO will carry on the extremely successful work of its predecessor while testing a new technology designed to dramatically improve the already remarkable precision of its measurement system. The GRACE missions measure variations in gravity over Earth's surface, producing a new map of the gravity field every 30 days. Thus, GRACE shows how the planet's gravity differs not only from one location to another, but also from one period of time to another. Airbus Defence and Space (Friedrichshafen/Germany) is the industrial prime contractor to build the satellites.

The effect of QBO on foE

NASA Astrophysics Data System (ADS)

Atıcı, Ramazan; Sağır, Selçuk

2017-07-01

In the present work, the relationship with QBO of difference (ΔfoE = foEmea - foEIRI) between critical frequency (foE) values of ionospheric E-region, measured at Darwin and Casos Island stations and calculated by IRI-2012 ionospheric model, is statistically investigated. A multiple regression model is used as statistical tool. The ;Dummy; variables (;DummyWest; and ;DummyEast; represent westerly QBO values and easterly QBO values, respectively) are added to model in order to see the effect of westerly and easterly QBO. In the result of calculations, it is observed that the changes in ΔfoE about 50-52% can be explained by QBO at both stations. The relationship between QBO and ΔfoE is negative at both stations. The change of 1 ms-1 in whole set of QBO leads to a decrease of 0.008 MHz at Casos Island station and 0.017 MHz at Darwin station in ΔfoE. Directions of QBO have an effect on ΔfoE at the Darwin station, but they've not any effect on ΔfoE at Casos Island station. It is thought that the difference values in the foE are due to not to be included in the IRI-model of all parameters affecting the critical frequency value. Thus, QBO which is not included to IRI-model can have an effect on foE and more accurate results can be obtained by IRI model if the QBO is included in this model calculations.

Membrane fouling of forward osmosis (FO) membrane for municipal wastewater treatment: A comparison between direct FO and OMBR.

PubMed

Sun, Yan; Tian, Jiayu; Zhao, Zhiwei; Shi, Wenxin; Liu, Dongmei; Cui, Fuyi

2016-11-01

In this work, membrane fouling behavior in a direct forward osmosis (FO) and an osmotic membrane bioreactor (OMBR) for municipal wastewater treatment was systematically investigated and compared. During the long-term operation, much severer flux decline was observed for the direct FO than that for the OMBR. The cake layer was found to be much thicker, together with large amounts of microorganisms growing on the membrane surface in direct FO. Interestingly, no obvious attachment of microorganisms on the membrane surface was observed in the OMBR. The fourier transform infrared spectroscopy (FTIR) and excitation emission matrices (EEM) analyses showed the polysaccharides and proteins were the dominant organic foulants in the fouling layer, and the quantity of the organic substances was also higher in direct FO than that in OMBR. Energy-dispersive X-ray (EDX) results indicated the main inorganic elements in the fouling layer were Ca, Mg, Fe and P, all of which exhibited higher relative percentages in direct FO than that in OMBR. The occurrence of higher contents of microorganisms, organic foulants and inorganic elements in the cake layer caused a higher filtration resistance for the FO membrane in the direct FO. Although more severe membrane fouling was identified in direct FO, the hydraulic and chemical cleaning was more effective on recovering the water permeability of the membrane in direct FO than that in OMBR. Copyright © 2016 Elsevier Ltd. All rights reserved.

40 CFR 264.259 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.

Code of Federal Regulations, 2011 CFR

2011-07-01

...) The volume, physical, and chemical characteristics of the wastes, including their potential to migrate through soil or to volatilize or escape into the atmosphere; (2) The attenuative properties of underlying and surrounding soils or other materials; (3) The mobilizing properties of other materials co-disposed...

40 CFR 264.317 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.

Code of Federal Regulations, 2011 CFR

2011-07-01

... factors to be considered are: (1) The volume, physical, and chemical characteristics of the wastes, including their potential to migrate through the soil or to volatilize or escape into the atmosphere; (2) The attenuative properties of underlying and surrounding soils or other materials; (3) The mobilizing...

Space Weathering of Silicates Simulated by Successive Laser Irradiation: in Situ Reflectance Measurements of Fo90, Fo99+, and SiO2

NASA Technical Reports Server (NTRS)

Loeffler, M. J.; Dukes, C. A.; Christoffersen, R.; Baragiola, R. A.

2016-01-01

Pulsed-laser irradiation causes the visible-near-infrared spectral slope of olivine (Fo90 and Fo99+) and SiO2 to increase (redden), while the olivine samples darken and the SiO2 samples brighten slightly. XPS analysis shows that irradiation of Fo90 produces metallic Fe. Analytical SEM and TEM measurements confirm that reddening in the Fo90 olivine samples correlates with the production of "nanophase" metallic Fe (npFe0) grains, 20-50 nm in size. The reddening observed in the SiO2 sample is consistent with the formation of SiO or other SiOx species that absorb in the visible. The weak spectral brightening induced by laser irradiation of SiO2 is consistent with a change in surface topography of the sample. The darkening observed in the olivine samples is likely caused by the formation of larger npFe0 particles, such as the 100-400 nm diameter npFe0 identified during our TEM analysis of Fo90 samples. The Fo90 reflectance spectra are qualitatively similar to those in previous experiments suggesting that in all cases formation of npFe0 is causing the spectral alteration. Finally, we find that the accumulation of successive laser pulses cause continued sample darkening in the Vis-NIR, which suggests that repeated surface impacts are an efficient way to darken airless body surfaces.

GRACE-FO Spacecraft (Artist's Rendering)

NASA Image and Video Library

2018-04-25

Artist's rendering of the twin spacecraft of the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission, scheduled to launch in May, 2018. GRACE-FO will track the evolution of Earth's water cycle by monitoring changes in the distribution of mass on Earth. https://photojournal.jpl.nasa.gov/catalog/PIA22431

How Fo-ATPase generates rotary torque.

PubMed

Oster, G; Wang, H; Grabe, M

2000-04-29

The F-ATPases synthesize ATP using a transmembrane ionmotive force (IMF) established by the electron transport chain. This transduction involves first converting the IMF to a rotary torque in the transmembrane Fo portion. This torque is communicated from Fo to the F1 portion where the energy is used to release the newly synthesized ATP from the catalytic sites according to Boyer's binding change mechanism. Here we explain the principle by which an IMF generates this rotary torque in the Fo ion engine.

GRACE-FO Spacecraft Artist Rendering

NASA Image and Video Library

2017-05-04

This artist's rendering shows the twin spacecraft of the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) mission, a partnership between NASA and the German Research Centre for Geosciences (GFZ). GRACE-FO is a successor to the original GRACE mission, which began orbiting Earth on March 17, 2002. GRACE-FO will carry on the extremely successful work of its predecessor while testing a new technology designed to dramatically improve the already remarkable precision of its measurement system. The GRACE missions measure variations in gravity over Earth's surface, producing a new map of the gravity field every 30 days. Thus, GRACE shows how the planet's gravity differs not only from one location to another, but also from one period of time to another. https://photojournal.jpl.nasa.gov/catalog/PIA21607

Comparison of manual scaled and predicted foE and foF1 critical frequencies. Technical report

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gamache, R.R.; Kersey, W.T.

1990-07-01

The CCIR and Titheridge foE critical frequency prediction routines were tested by comparison with 1875 manually scaled values. The foF1 critical frequency prediction routine of Millman et al was tested by comparison with 1005 manually scaled values. Plots and statistics of the comparisons are presented and discussed. From the results recommendations are made to help improve autoscaling.

40 CFR 265.352 - Interim status incinerators burning particular hazardous wastes.

Code of Federal Regulations, 2012 CFR

2012-07-01

... 40 Protection of Environment 27 2012-07-01 2012-07-01 false Interim status incinerators burning... incinerators burning particular hazardous wastes. (a) Owners or operators of incinerators subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or FO27 if they receive a...

40 CFR 265.352 - Interim status incinerators burning particular hazardous wastes.

Code of Federal Regulations, 2014 CFR

2014-07-01

... 40 Protection of Environment 26 2014-07-01 2014-07-01 false Interim status incinerators burning... incinerators burning particular hazardous wastes. (a) Owners or operators of incinerators subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or FO27 if they receive a...

40 CFR 265.352 - Interim status incinerators burning particular hazardous wastes.

Code of Federal Regulations, 2013 CFR

2013-07-01

... 40 Protection of Environment 27 2013-07-01 2013-07-01 false Interim status incinerators burning... incinerators burning particular hazardous wastes. (a) Owners or operators of incinerators subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or FO27 if they receive a...

40 CFR 265.352 - Interim status incinerators burning particular hazardous wastes.

Code of Federal Regulations, 2010 CFR

2010-07-01

... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Interim status incinerators burning... incinerators burning particular hazardous wastes. (a) Owners or operators of incinerators subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or FO27 if they receive a...

40 CFR 265.352 - Interim status incinerators burning particular hazardous wastes.

Code of Federal Regulations, 2011 CFR

2011-07-01

... 40 Protection of Environment 26 2011-07-01 2011-07-01 false Interim status incinerators burning... incinerators burning particular hazardous wastes. (a) Owners or operators of incinerators subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or FO27 if they receive a...

40 CFR 265.383 - Interim status thermal treatment devices burning particular hazardous waste.

Code of Federal Regulations, 2010 CFR

2010-07-01

... devices burning particular hazardous waste. 265.383 Section 265.383 Protection of Environment... status thermal treatment devices burning particular hazardous waste. (a) Owners or operators of thermal treatment devices subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or...

40 CFR 265.383 - Interim status thermal treatment devices burning particular hazardous waste.

Code of Federal Regulations, 2013 CFR

2013-07-01

... devices burning particular hazardous waste. 265.383 Section 265.383 Protection of Environment... status thermal treatment devices burning particular hazardous waste. (a) Owners or operators of thermal treatment devices subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or...

40 CFR 265.383 - Interim status thermal treatment devices burning particular hazardous waste.

Code of Federal Regulations, 2014 CFR

2014-07-01

... devices burning particular hazardous waste. 265.383 Section 265.383 Protection of Environment... status thermal treatment devices burning particular hazardous waste. (a) Owners or operators of thermal treatment devices subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or...

40 CFR 265.383 - Interim status thermal treatment devices burning particular hazardous waste.

Code of Federal Regulations, 2012 CFR

2012-07-01

... devices burning particular hazardous waste. 265.383 Section 265.383 Protection of Environment... status thermal treatment devices burning particular hazardous waste. (a) Owners or operators of thermal treatment devices subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or...

40 CFR 265.383 - Interim status thermal treatment devices burning particular hazardous waste.

Code of Federal Regulations, 2011 CFR

2011-07-01

... devices burning particular hazardous waste. 265.383 Section 265.383 Protection of Environment... status thermal treatment devices burning particular hazardous waste. (a) Owners or operators of thermal treatment devices subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26, or...

Day-to-day variability of foEs in the equatorial ionosphere

NASA Astrophysics Data System (ADS)

Somoye, E. O.; Akala, A. O.; Adeniji-Adele, R. A.; Onori, E. O.; Ogwala, A.; Karimu, A. O.

2013-09-01

seasonal, and solar cycle effects of the variability (VR) of the critical frequency of sporadic E layer (foEsq) are investigated at Ibadan (7.4°N, 3.9°E, 6°S dip) in the African sector during high solar activity (HSA) year of 1958 (Rz = 181), moderate solar activity (MSA) year of 1973 (Rz = 30), and low solar activity (LSA) year of 1965 (Rz = 17). The diurnal variation of foEsq VR is characterized by post-midnight (32%-78%) and pre-midnight (20%-84%) peaks during high solar activity (HSA), the only epoch of the three showing these peaks and a diurnal trend. While the daytime foEsq VRs of the three epochs show no seasonal trend, pre-midnight and post-midnight, the foEsq VRs during HSA and LSA show seasonal trends. Similarity is observed in the curve of reciprocal of percentage occurrence of Esq and that of foEsq VR, indicating inverse variation of percentage occurrence and foEsq VR. Longitudinal influence is observed in the diurnal variation of HSA and MSA July foEsq VR of Ibadan (7.4°N, 3.9°E, 6°S dip) in the African sector, which is in the neighborhood of the Greenwich Meridian (GM); Singapore (1.3°N, 108.3°E, 17.6°S dip) in the Asian sector, east of GM; and Huancayo (12°S, 284.7°E, 1.90 dip) in the American sector, west of GM.

Properties of fluorosulfate-based ionic liquids and geometries of (FO2SOH)OSO2F- and (FO2SOH)2O2SOF-.

PubMed

Enomoto, Takeshi; Matsumoto, Kazuhiko; Hagiwara, Rika

2011-12-14

A room temperature ionic liquid (IL) based on the fluorosulfate anion (SO(3)F(-)) has been synthesized by the reaction of 1-ethyl-3-methylimidazolium (EMIm(+)) chloride and fluorosulfuric acid (HOSO(2)F). The viscosity, ionic conductivity, and electrochemical window of EMImSO(3)F at 25 °C are 46.6 mPa s, 10.8 mS cm(-1), and 4.3 V, respectively. According to a solvatochromic measurement using ILs, there is a trend in the donor ability of fluoro- and oxofluoroanions, PF(6)(-) < BF(4)(-) < N(SO(2)CF(3))(2)(-) < SO(3)CF(3)(-) < SO(3)F(-) < PO(2)F(2)(-), which is explained by the atomic charges obtained from quantum mechanical calculations. The 1 : 2 and 1 : 3 stoichiometric reactions of EMImCl and HOSO(2)F give EMIm(FO(2)SOH)OSO(2)F and EMIm(FO(2)SOH)(2)O(2)SOF, respectively. Both the salts are liquid at room temperature without a HOSO(2)F dissociation pressure (< 1 Pa) and have low viscosity and high ionic conductivity (9.2 mPa s and 30.8 mS cm(-1) for EMIm(FO(2)SOH)OSO(2)F and 5.1 mPa s and 43.2 mS cm(-1) for EMIm(FO(2)SOH)(2)O(2)SOF). The vibrational modes and bonding properties of these anionic species are discussed with the aid of quantum mechanical calculations. The (FO(2)SOH)OSO(2)F(-) anion in EMIm(FO(2)SOH)OSO(2)F does not have an inversion centre, which stands in contrast to the one with an inversion centre (e.g. observed in solid Cs(FO(2)SOH)OSO(2)F). The (FO(2)SOH)(2)O(2)SOF(-) anion in EMIm(FO(2)SOH)(2)O(2)SOF is characterized by vibrational spectroscopy under C(s) symmetry.

Space Weathering of Silicates Simulated by Successive Laser Irradiation: In Situ Reflectance Measurements of Fo90, Fo99+, and Sio2

NASA Technical Reports Server (NTRS)

Loeffler, M. J.; Dukes, C. A.; Christoffersen, R.; Baragiola, R. A.

2016-01-01

Pulsed-laser irradiation causes the visible-near-infrared spectral slope of olivine (Fo90 and Fo99+) and SiO2 to increase (redden), while the olivine samples darken and the SiO2 samples brighten slightly. XPS analysis shows that irradiation of Fo90 produces metallic Fe. Analytical SEM and TEM measurements confirm that reddening in the Fo90 olivine samples correlates with the production of nanophase metallic Fe (npFe0) grains, 2050 nm in size. The reddening observed in the SiO2 sample is consistent with the formation of SiO or other SiOx species that absorb in the visible. The weak spectral brightening induced by laser irradiation of SiO2 is consistent with a change in surface topography of the sample. The darkening observed in the olivine samples is likely caused by the formation of larger npFe0 particles, such as the 100400 nm diameter npFe0 identified during our TEM analysis of Fo90 samples. The Fo90 reflectance spectra are qualitatively similar to those in previous experiments suggesting that in all cases formation of npFe0 is causing the spectral alteration. Finally, we find that the accumulation of successive laserpulses cause continued sample darkening in the Vis-NIR, which suggests that repeated surface impacts are an efficient way to darken airless body surfaces.

Fo-driven Rotation in the ATP Synthase Direction against the Force of F1 ATPase in the FoF1 ATP Synthase*

PubMed Central

Martin, James; Hudson, Jennifer; Hornung, Tassilo; Frasch, Wayne D.

2015-01-01

Living organisms rely on the FoF1 ATP synthase to maintain the non-equilibrium chemical gradient of ATP to ADP and phosphate that provides the primary energy source for cellular processes. How the Fo motor uses a transmembrane electrochemical ion gradient to create clockwise torque that overcomes F1 ATPase-driven counterclockwise torque at high ATP is a major unresolved question. Using single FoF1 molecules embedded in lipid bilayer nanodiscs, we now report the observation of Fo-dependent rotation of the c10 ring in the ATP synthase (clockwise) direction against the counterclockwise force of ATPase-driven rotation that occurs upon formation of a leash with Fo stator subunit a. Mutational studies indicate that the leash is important for ATP synthase activity and support a mechanism in which residues aGlu-196 and cArg-50 participate in the cytoplasmic proton half-channel to promote leash formation. PMID:25713065

High historical values of foEs—Reality or artefact?

NASA Astrophysics Data System (ADS)

Laštovička, J.; Boška, J.; Burešová, D.; Kouba, D.

2012-01-01

Very high values of foEs had sometimes been reported in the past. These values, as well as all other ionogram-scaled values, had been derived from ionograms under the assumption of the vertical reflection of ordinary mode of sounding radio waves. In the past it was impossible to check the validity of this assumption. However, modern digisondes determine clearly the oblique or extraordinary mode reflections. To test the assumption of the vertical reflection of ordinary mode for high values of foEs, seven summers (June 2004-August 2010) from a midlatitude station Pruhonice are chosen. All hourly values of foEs≥6.0 MHz are selected from this data set, altogether 282 values. In 90% of cases the “classical” way of evaluation of foEs provides values higher than “true” values from modern digisonde (average difference about 1 MHz). 38% of “classical” foEs are oblique reflections, which however do not occur in direction perpendicular to geomagnetic field. The occurrence of high values of foEs varies very much from year to year between 0 and 130 events per year. As for diurnal variation, a pronounced maximum occurs at ˜10:00LT and 16:00LT (secondary), and a minimum after midnight.

Torque-coupled thermodynamic model for FoF1 -ATPase

NASA Astrophysics Data System (ADS)

Ai, Guangkuo; Liu, Pengfei; Ge, Hao

2017-05-01

FoF1 -ATPase is a motor protein complex that utilizes transmembrane ion flow to drive the synthesis of adenosine triphosphate (ATP) from adenosine diphosphate (ADP) and phosphate (Pi). While many theoretical models have been proposed to account for its rotary activity, most of them focus on the Fo or F1 portions separately rather than the complex as a whole. Here, we propose a simple but new torque-coupled thermodynamic model of FoF1 -ATPase. Solving this model at steady state, we find that the monotonic variation of each portion's efficiency becomes much more robust over a wide range of parameters when the Fo and F1 portions are coupled together, as compared to cases when they are considered separately. Furthermore, the coupled model predicts the dependence of each portion's kinetic behavior on the parameters of the other. Specifically, the power and efficiency of the F1 portion are quite sensitive to the proton gradient across the membrane, while those of the Fo portion as well as the related Michaelis constants for proton concentrations respond insensitively to concentration changes in the reactants of ATP synthesis. The physiological proton gradient across the membrane in the Fo portion is also shown to be optimal for the Michaelis constants of ADP and phosphate in the F1 portion during ATP synthesis. Together, our coupled model is able to predict key dynamic and thermodynamic features of the FoF1 -ATPase in vivo semiquantitatively, and suggests that such coupling approach could be further applied to other biophysical systems.

Fo-perturbation and Fo/loudness dynamics in voices of normal children, with and without education in singing.

PubMed

Dejonckere, P H; Wieneke, G H; Bloemenkamp, D; Lebacq, J

1996-04-01

Sustained phonations were compared in two groups of children (aged 7-12), one with special artistic voice education and one from a normal school, without voice complaints or problems. The hypothesis of specific (better) biomechanical vocal fold properties in the first group is confronted with the hypothesis of differences solely related to training of voice control. In both groups, Fo-aperiodicity was measured in a sustained phonation at 3 different SPL levels. As a general rule, aperiodicity clearly decreases when the voice becomes louder. Aperiodicity is highly significantly lower, at all SPL-levels, in children with trained singing voices: this implies better mechanical properties of the vocal oscillator. The Fo/SPL relation on a sustained /a:/ does not differ in trained and untrained children's voices: out of singing context, trained children do not spontaneously control the Fo/SPL dynamics differently from untrained children. The higher regularity of vocal fold pulses is not related to the duration of training.

Multiple FoV MCAO on its way to the sky

NASA Astrophysics Data System (ADS)

Bergomi, Maria; Viotto, Valentina; Farinato, Jacopo; Marafatto, Luca; Radakrishnan, Kalyan; Ragazzoni, Roberto; Dima, Marco; Magrin, Demetrio; Arcidiacono, Carmelo; Diolaiti, Emiliano; Foppiani, Italo; Lombini, Matteo; Schreiber, Laura; Bertram, Thomas; Bizenberger, Peter; Conrad, Al; Herbst, Tom; Kittmann, Frank; Kopon, Derek; Meschke, Daniel; Zhang, Xianyu

2013-12-01

LINC-NIRVANA, an infrared camera working in a Fizeau interferometric layout, takes advantage of the Layer Oriented MCAO MFoV technique to correct a 2 arcmin FoV using only Natural Guide Stars (NGSs), exploiting the central 10 arcsec with a resolving power of a 23 meter telescope. For each arm of the LBT telescope 2 WaveFront Sensors (WFSs) optically conjugated, respectively at ground and high (7 km) layers, are used to search for NGSs. To avoid unnecessary waste of photons the two sensors look at different FoVs. The ground-layer one, essentially limited by practical conditions, searches for up to 12 NGSs in an annular 2-6 arcmin FoV, while the high-layer one, limited by the pupils superposition, looks for up to 8 NGSs in the central 2 arcmin FoV. The concept has left paper's realm to become glass and metal a few years ago. With the completion of the 2 high-layer WFSs by INAF-Bologna and, recently with the successful tests performed on the first ground-layer WFSs by INAF-Padova, further followed by the GWS Pathfinder experiment to test the ground layer correction at LBT, in collaboration with MPIA-Heidelberg, the concept is finally getting closer to its on-sky commissioning, foreseen in the next very few years. In this paper the basic concepts of MFoV MCAO will be revised, the current status of the system described and the near future toward final completion of the instrument depicted. Moreover a possible path for this concept toward an ELT will be traced.

FO Aqr time-series observations requested

NASA Astrophysics Data System (ADS)

Waagen, Elizabeth O.

2016-07-01

Dr. Colin Littlefield (University of Notre Dame) and colleagues Drs. Peter Garnavich (Notre Dame), Erin Aadland (Minnesota State), and Mark Kennedy (University College Cork) have requested AAVSO assistance in monitoring the intermediate polar cataclysmic variable FO Aqr beginning immediately. Littlefield, who with his colleagues recently published ATel #9216 and #9225, writes: "This system is in a faint state for the first time in its observational record, implying a dropoff in the mass-transfer rate. AAVSO observations contributed by Shawn Dvorak [the only observer following FO Aqr at the time] were particularly helpful in detecting this low state. Since early May, the system has recovered to V 15, but it is still well below its normal brightness. In addition, our time-series photometry shows a very strong 11.26-minute photometric period. By contrast, during its bright state, FO Aqr's light curve is dominated by a 20.9-minute period, corresponding with the spin period of the white dwarf. We interpret our observations as evidence that the system's accretion processes have changed dramatically as a result of the reduced mass-transfer rate. We have...determined that...[the 11.26-min] periodicity is dependent on the orbital phase of the binary. The 11.26-min period is dominant for about half of the orbit, but for the other half, a 22.5-min period is stronger. AAVSO observers can help us study both of these periods as well as their dependence on the orbital phase. We are particularly interested in any changes in this behavior as the system continues to brighten...Time-series photometry of FO Aqr [is requested] in order to better study the evolution of the 11.26-minute period as the system rebrightens. Unfiltered photometry reduced with a V zeropoint would be the most useful to us...A cadence of less than 60 seconds per image is important, given the brevity of these periods (especially the 11.26-min period). Finder charts with sequence may be created using the AAVSO

On Martell and Kaitchuck's model for the intermediate polar FO Aquarii

NASA Technical Reports Server (NTRS)

Mukai, Koji; Hellier, Coel

1992-01-01

Attention is given to the proposals of Martell and Kaitchuck (1991) that FO Aqr is a low-inclination system, rather than an eclipsing system, as recently claimed, and that the dominant periodicity (21 min) is the beat period rather than the white dwarf spin period, as is commonly supposed. It is shown that both proposals make it harder to understand the observations of this star, while there is no substantive evidence in their favor. It is concluded that FO Aqr is most likely a high-inclination system in which the secondary eclipses part of the accretion flow.

A novel Multi-Fiber Optode sensor system (MuFO) for monitoring oxygen

NASA Astrophysics Data System (ADS)

Koop-Jakobsen, K.; Fischer, J.; Wenzhöfer, F.

2012-04-01

In the marine environment, dissolved oxygen concentrations often vary significantly spatially as well as temporally. Monitoring these variations is essential for our understanding of the biological and chemical processes controlling the oxygen dynamics in water columns and sediments. Such investigations require a high number of measuring points and a high temporal resolution. A Multi-Fiber Optode sensor system (MuFO) was designed to assess these requirements. The MuFO system simultaneously controls 100 fiber optodes enabling continuous monitoring of oxygen in 100 positions within a 5-10m radius. The measurements are based on quenching of an oxygen sensitive luminophore, which is immobilised at the end of each fiber optode. The optical oxygen measurements are based on lifetime-imaging, which are converted into oxygen concentrations using a multipoint calibration. At a constant temperature of 21C, the system overall had a mean accuracy of 1.3%, a precision of 0.2% air saturation, the average 90% response time was 16 seconds and the detection limit was 0.1% air saturation. The MuFO set-up was build into a waterproof titanium casing for marine field applications. The system is battery-powered and has a maximum operational capacity of 15 hours for continuous measurements. The MuFO system was recently used for various research tasks in the marine environment: Mounted on a lander, the in situ MuFO system was used for investigations of oxygen dynamics in marine water columns placing the fiber optodes in a vertical line on a 7m high pole. For studies of oxygen dynamics in marine wetland rhizospheres, the sensing ends of the fiber optodes were covered with a 50cm protective sleeve made from stainless steel tubing, and the sensors were manually pushed into the rhizosphere. For laboratory measurements of sediment oxygen demand, the MuFO system was used to simultaneously monitor the oxygen consumption in multiple sediment slurry incubations. The MuFO system proved to be a

Variability of foF2 in the African equatorial ionosphere

NASA Astrophysics Data System (ADS)

Akala, A. O.; Oyeyemi, E. O.; Somoye, E. O.; Adeloye, A. B.; Adewale, A. O.

2010-06-01

This paper presents the impact of diurnal, seasonal and solar activity effects on the variability of ionospheric foF2 in the African equatorial latitude. Three African ionospheric stations; Dakar (14.8°N, 17.4°W, dip: 11.4°N), Ouagadougou (12.4°N, 1.5°W, dip: 2.8°N) and Djibouti (11.5°N, 42.8°E, dip: 7.2°N) were considered for the investigation. The overall aim is to provide African inputs that will be of assistance at improving existing forecasting models. The diurnal analysis revealed that the ionospheric critical frequency (foF2) is more susceptible to variability during the night-time than the day-time, with two peaks in the range; 18-38% during post-sunset hours and 35-55% during post-midnight hours. The seasonal and solar activity analyses showed a post-sunset September Equinox maximum and June Solstice maximum of foF2 variability in all the stations for all seasons. At all the stations, foF2 variability was high for low solar activity year. Overall, we concluded that equatorial foF2 variability increases with decreasing solar activity during night-time.

The accent method of voice therapy: effect of accentuations on FO, SPL, and airflow.

PubMed

Kotby, M N; Shiromoto, O; Hirano, M

1993-12-01

The effect of the increased flow rate (delta U) in response to the Accent Method exercises on fundamental frequency (FO) and sound pressure level (SPL) was studied in three subjects (professionally trained, trained, and untrained in this method). In all the subjects, the rhythmic accentuated exercises produced a variable degree of increase in FO (delta FO) and SPL (delta SPL). The professionally trained subject showed greater delta FO and delta SPL in response to the delta U in the fastest tempo, which requires higher skills. Both trained subjects showed a greater correlation between delta U and both delta SPL and delta FO, as well as between delta FO and delta SPL, as compared to the untrained subject. The effects of the accentuated exercises on FO and SPL in response to the increased airflow rate (delta U) thus appear to demonstrate the treating effectiveness of the Accent Method.

Investigation of the relationship between ionospheric foF2 and earthquakes

NASA Astrophysics Data System (ADS)

Karaboga, Tuba; Canyilmaz, Murat; Ozcan, Osman

2018-04-01

Variations of the ionospheric F2 region critical frequency (foF2) have been investigated statistically before earthquakes during 1980-2008 periods in Japan area. Ionosonde data was taken from Kokubunji station which is in the earthquake preparation zone for all earthquakes. Standard Deviations and Inter-Quartile Range methods are applied to the foF2 data. It is observed that there are anomalous variations in foF2 before earthquakes. These variations can be regarded as ionospheric precursors and may be used for earthquake prediction.

Sustainable water recovery from oily wastewater via forward osmosis-membrane distillation (FO-MD).

PubMed

Zhang, Sui; Wang, Peng; Fu, Xiuzhu; Chung, Tai-Shung

2014-04-01

This study proposed and investigated a hybrid forward osmosis - membrane distillation (FO-MD) system for sustainable water recovery from oily wastewater by employing lab-fabricated FO and MD hollow fiber membranes. Stable oil-in-water emulsions of different concentrations with small droplet sizes (<1 μm) were firstly prepared and applied as the feed solution in the FO process. Fouling was immediately observed in the FO mode and was low on the cellulose triacetate (CTA) - based thin film composite (TFC) membranes. Moreover, slight increment of fouling was observed in the first few hours and the water flux was then stabilized over 24 h. The characterizations of water flux and solute rejection in separate FO and MD processes revealed that a high water flux, good NaCl rejection, impressively high retention of oil droplets and partial permeation of acetic acid could be achieved. Finally, an integrated FO-MD system was developed to treat the oily wastewater containing petroleum, surfactant, NaCl and acetic acid at 60 °C in the batch mode. The water flux in FO undergoes three-stage decline due to fouling and reduction in osmotic driving force, but is quite stable in MD regardless of salt concentration. Oily wastewater with relatively high salinity could be effectively recovered by the FO-MD hybrid system while maintaining large water flux, at least 90% feed water recovery could be readily attained with only trace amounts of oil and salts, and the draw solution was re-generated for the next rounds of FO-MD run. Interestingly, significant amount of acetic acid was also retained in the permeate for further reuse as a chemical additive during the production of crude oil. The work has demonstrated that not only water but also organic additives in the wastewater could be effectively recovered by FO-MD systems for reuse or other utilizations. Copyright © 2014 Elsevier Ltd. All rights reserved.

Removal of organic micro-pollutants (phenol, aniline and nitrobenzene) via forward osmosis (FO) process: Evaluation of FO as an alternative method to reverse osmosis (RO).

PubMed

Cui, Yue; Liu, Xiang-Yang; Chung, Tai-Shung; Weber, Martin; Staudt, Claudia; Maletzko, Christian

2016-03-15

In this study, we have explored and compared the effectiveness of using (1) lab-fabricated forward osmosis (FO) membranes under both FO and reverse osmosis (RO) modes and (2) commercially available RO membranes under the RO mode for the removal of organic micro-pollutants. The lab-fabricated FO membranes are thin film composite (TFC) membranes consisting of a polyamide layer and a porous substrate cast from three different materials; namely, Matrimid, polyethersulfone (PESU) and sulfonated polyphenylene sulfone (sPPSU). The results show that the FO mode is superior to the RO mode in the removal of phenol, aniline and nitrobenzene from wastewater. The rejections of all three TFC membranes to all the three organic micro-pollutants under the FO processes are higher than 72% and can be even higher than 90% for aniline when a 1000 ppm aromatic aqueous solution and 1 M NaCl are employed as feeds. These performances outperform the results obtained from themselves and commercially available RO membranes under the RO mode. In addition, the rejection can be maintained even when treating a more concentrated feed solution (2000 ppm). The removal performance can be further enhanced by using a more concentrated draw solution (2 M). The water flux is almost doubled, and the rejection increment can reach up to 17%. Moreover, it was observed that annealing as a post-treatment would help compact the membrane selective layer and further enhance the separating efficiency. The obtained organic micro-pollutant rejections and water fluxes under various feasible operating conditions indicate that the FO process has potential to be a viable treatment for wastewater containing organic micro-pollutants. Copyright © 2016 Elsevier Ltd. All rights reserved.

Role of Vertical Larynx Movement and Cervical Lordosis in FO Control.

ERIC Educational Resources Information Center

Honda, Kiyoshi; Hirai, Hiroyuki; Masaki, Shinobu; Shimada, Yasuhiro

1999-01-01

Functional characteristics of the cervical structures of the larynx are investigated in search of physiological mechanisms of extralaryngeal FO control. Mean Response Time experiments were performed to record the positions of the articulators and the larynx during vowel production with different FO values. (Author/VWL)

A mechanism of midlatitude noontime foE long-term variations inferred from European observations

NASA Astrophysics Data System (ADS)

Mikhailov, A. V.; Perrone, L.; Nusinov, A. A.

2017-04-01

Manually scaled June noontime monthly median foE values at three European stations Rome, Juliusruh, and Slough/Chilton were used to understand the mechanism of foE long-term variations. The 11 year running mean smoothed foE manifests long-term (for some solar cycles) variations with the rising phase at the end of 1960-1985 and the falling phase after 1985. A close relationship (even in details) between (foEave)11y and (R12)11y variations with the correlation coefficient of 0.996 (absolutely significant according to Fisher F criterion) suggests that the Sun is the source of these (foEave)11y long-term variations. After removing solar activity long-term variations the residual (foEave)11y trend is very small ( 0.029% per decade) being absolutely insignificant. This means that all (foEave)11y variations are removed with one solar activity index, (R12)11y, i.e., this means that long-term variations are fully controlled by solar activity. Theory of midlatitude daytime E region tells us that long-term variations of solar EUV in two lines λ = 977 Å (CIII) and λ = 1025.7 Å (HLyβ) and X-ray radiation with λ < 100 Å (both manifesting the same long-term variations with the rising phase at the end of 1960-1985 and the falling phase after 1985) are responsible for the observed (foEave)11y variations. Therefore, the observed daytime midlatitude foE long-term variations have a natural (not anthropogenic) origin related to long-term variations of solar activity. No peculiarities in relation with the last deep solar minimum in 2008-2009 have been revealed.

Ionospheric variations over Chinese EIA region using foF2 and comparison with IRI-2016 model

NASA Astrophysics Data System (ADS)

Rao, S. S.; Chakraborty, Monti; Pandey, R.

2018-07-01

In the present work, we have analyzed data of critical frequency of the F2 region (foF2) for the period, 2008-2013 over low latitude Chinese station Guangzhou (Geog. Lat. 23.10°N, Geog. Long. 113.40°E, dip, Lat. 13.49°N) and results thereof have been compared with IRI-2016 model. foF2 data set of the present study encompasses period of unusual and extended solar minimum, i.e., the years 2008-2009 and rising phase of solar cycle 24. IRI data have been obtained by choosing topside electron density profile IRI-NeQuick for two F peak models, CCIR and URSI. It is found that the general trend of variation in foF2 closely follows the trend of the solar flux during the period of study. A linear regression analysis gave a correlation coefficient of 0.98 which shows strong dependence of foF2 variation over solar flux variation. Semi-annual and annual oscillations are clearly brought out in the foF2 data using the Lomb-Scargle periodogram. A presence of semiannual and winter anomaly in observed as well as modeled foF2 at Guangzhou have found to be consistent throughout the period 2008-2013 irrespective of the phases of the solar activity. Our results also show the stronger presence of winter anomaly during the years of higher solar flux and it has been confirmed by normalizing the difference of winter to summer foF2 values for each year. Comparative results of ionosonde observation and IRI-2016 model show a significant discrepancy with regard to values of foF2 in different seasons and local time variations. IRI 2016 model underestimates the foF2 values in winter and equinoxes and overestimates foF2 values in summer. IRI modeled foF2 values using CCIR and URSI F peak models were found greater during forenoon hours and smaller during afternoon hours than the observed foF2 values throughout the period 2008-2013.

Cyclophilin D Promotes Brain Mitochondrial F1FO ATP Synthase Dysfunction in Aging Mice

PubMed Central

Gauba, Esha; Guo, Lan; Du, Heng

2017-01-01

Brain aging is the known strongest risk factor for Alzheimer’s disease (AD). In recent years, mitochondrial deficits have been proposed to be a common mechanism linking brain aging to AD. Therefore, to elucidate the causative mechanisms of mitochondrial dysfunction in aging brains is of paramount importance for our understanding of the pathogenesis of AD, in particular its sporadic form. Cyclophilin D (CypD) is a specific mitochondrial protein. Recent studies have shown that F1FO ATP synthase oligomycin sensitivity conferring protein (OSCP) is a binding partner of CypD. The interaction of CypD with OSCP modulates F1FO ATP synthase function and mediates mitochondrial permeability transition pore (mPTP) opening. Here, we have found that increased CypD expression, enhanced CypD/OSCP interaction, and selective loss of OSCP are prominent brain mitochondrial changes in aging mice. Along with these changes, brain mitochondria from the aging mice demonstrated decreased F1FO ATP synthase activity and defective F1FO complex coupling. In contrast, CypD deficient mice exhibited substantially mitigated brain mitochondrial F1FO ATP synthase dysfunction with relatively preserved mitochondrial function during aging. Interestingly, the aging-related OSCP loss was also dramatically attenuated by CypD depletion. Therefore, the simplest interpretation of this study is that CypD promotes F1FO ATP synthase dysfunction and the resultant mitochondrial deficits in aging brains. In addition, in view of CypD and F1FO ATP synthase alterations seen in AD brains, the results further suggest that CypD-mediated F1FO ATP synthase deregulation is a shared mechanism linking mitochondrial deficits in brain aging and AD. PMID:27834780

Cyclophilin D Promotes Brain Mitochondrial F1FO ATP Synthase Dysfunction in Aging Mice.

PubMed

Gauba, Esha; Guo, Lan; Du, Heng

2017-01-01

Brain aging is the known strongest risk factor for Alzheimer's disease (AD). In recent years, mitochondrial deficits have been proposed to be a common mechanism linking brain aging to AD. Therefore, to elucidate the causative mechanisms of mitochondrial dysfunction in aging brains is of paramount importance for our understanding of the pathogenesis of AD, in particular its sporadic form. Cyclophilin D (CypD) is a specific mitochondrial protein. Recent studies have shown that F1FO ATP synthase oligomycin sensitivity conferring protein (OSCP) is a binding partner of CypD. The interaction of CypD with OSCP modulates F1FO ATP synthase function and mediates mitochondrial permeability transition pore (mPTP) opening. Here, we have found that increased CypD expression, enhanced CypD/OSCP interaction, and selective loss of OSCP are prominent brain mitochondrial changes in aging mice. Along with these changes, brain mitochondria from the aging mice demonstrated decreased F1FO ATP synthase activity and defective F1FO complex coupling. In contrast, CypD deficient mice exhibited substantially mitigated brain mitochondrial F1FO ATP synthase dysfunction with relatively preserved mitochondrial function during aging. Interestingly, the aging-related OSCP loss was also dramatically attenuated by CypD depletion. Therefore, the simplest interpretation of this study is that CypD promotes F1FO ATP synthase dysfunction and the resultant mitochondrial deficits in aging brains. In addition, in view of CypD and F1FO ATP synthase alterations seen in AD brains, the results further suggest that CypD-mediated F1FO ATP synthase deregulation is a shared mechanism linking mitochondrial deficits in brain aging and AD.

Effective As(III) Removal by A Multi-Charged Hydroacid Complex Draw Solute Facilitated Forward Osmosis-Membrane Distillation (FO-MD) Processes.

PubMed

Ge, Qingchun; Han, Gang; Chung, Tai-Shung

2016-03-01

Effective removal of As(III) from water by an oxalic acid complex with the formula of Na3[Cr(C2O4)3] (Na-Cr-OA) is demonstrated via an forward osmosis-membrane distillation (FO-MD) hybrid system in this study. Na-Cr-OA first proved its superiority as a draw solute with high water fluxes and negligible reverse fluxes in FO, then a systematic investigation of the Na-Cr-OA promoted FO process was conducted to ascertain the factors in As(III) removal. Relatively high water fluxes of 28 LMH under the FO mode and 74 LMH under the pressure retarded osmosis (PRO) mode were achieved when using a 1000 ppm As(III) solution as the feed and 1.0 M Na-Cr-OA as the draw solution at 60 °C. As(III) removal with a water recovery up to 21.6% (FO mode) and 48.3% (PRO mode) were also achieved in 2 h. An outstanding As(III) rejection with 30-3000 μg/L As(III) in the permeate was accomplished when As(III) feed solutions varied from 5 × 10(4) to 1 × 10(6) μg/L, superior to the best FO performance reported for As(III) removal. Incorporating MD into FO not only makes As(III) removal sustainable by reconcentrating the Na-Cr-OA solution simultaneously, but also reduces the As(III) concentration below 10 μg/L in the product water, meeting the WHO standard.

Validation of foF2 and TEC Modeling During Geomagnetic Disturbed Times: Preliminary Outcomes of International Forum for Space Weather Modeling Capabilities Assessment

NASA Astrophysics Data System (ADS)

Shim, J. S.; Tsagouri, I.; Goncharenko, L. P.; Kuznetsova, M. M.

2017-12-01

To address challenges of assessment of space weather modeling capabilities, the CCMC (Community Coordinated Modeling Center) is leading the newly established "International Forum for Space Weather Modeling Capabilities Assessment." This presentation will focus on preliminary outcomes of the International Forum on validation of modeled foF2 and TEC during geomagnetic storms. We investigate the ionospheric response to 2013 Mar. geomagnetic storm event using ionosonde and GPS TEC observations in North American and European sectors. To quantify storm impacts on foF2 and TEC, we first quantify quiet-time variations of foF2 and TEC (e.g., the median and the average of the five quietest days for the 30 days during quiet conditions). It appears that the quiet time variation of foF2 and TEC are about 10% and 20-30%, respectively. Therefore, to quantify storm impact, we focus on foF2 and TEC changes during the storm main phase larger than 20% and 50%, respectively, compared to 30-day median. We find that in European sector, both foF2 and TEC response to the storm are mainly positive phase with foF2 increase of up to 100% and TEC increase of 150%. In North America sector, however, foF2 shows negative effects (up to about 50% decrease), while TEC shows positive response (the largest increase is about 200%). To assess modeling capability of reproducing the changes of foF2 and TEC due to the storm, we use various model simulations, which are obtained from empirical, physics-based, and data assimilation models. The performance of each model depends on the selected metrics, therefore, only one metrics is not enough to evaluate the models' predictive capabilities in capturing the storm impact. The performance of the model also varies with latitude and longitude.

Insights into the Molecular Mechanism of Rotation in the Fo Sector of ATP Synthase

PubMed Central

Aksimentiev, Aleksij; Balabin, Ilya A.; Fillingame, Robert H.; Schulten, Klaus

2004-01-01

F1Fo-ATP synthase is a ubiquitous membrane protein complex that efficiently converts a cell's transmembrane proton gradient into chemical energy stored as ATP. The protein is made of two molecular motors, Fo and F1, which are coupled by a central stalk. The membrane unit, Fo, converts the transmembrane electrochemical potential into mechanical rotation of a rotor in Fo and the physically connected central stalk. Based on available data of individual components, we have built an all-atom model of Fo and investigated through molecular dynamics simulations and mathematical modeling the mechanism of torque generation in Fo. The mechanism that emerged generates the torque at the interface of the a- and c-subunits of Fo through side groups aSer-206, aArg-210, and aAsn-214 of the a-subunit and side groups cAsp-61 of the c-subunits. The mechanism couples protonation/deprotonation of two cAsp-61 side groups, juxtaposed to the a-subunit at any moment in time, to rotations of individual c-subunit helices as well as rotation of the entire c-subunit. The aArg-210 side group orients the cAsp-61 side groups and, thereby, establishes proton transfer via aSer-206 and aAsn-214 to proton half-channels, while preventing direct proton transfer between the half-channels. A mathematical model proves the feasibility of torque generation by the stated mechanism against loads typical during ATP synthesis; the essential model characteristics, e.g., helix and subunit rotation and associated friction constants, have been tested and furnished by steered molecular dynamics simulations. PMID:14990464

A psychometric study of the Fear of Sleep Inventory-Short Form (FoSI-SF).

PubMed

Pruiksma, Kristi E; Taylor, Daniel J; Ruggero, Camilo; Boals, Adriel; Davis, Joanne L; Cranston, Christopher; DeViva, Jason C; Zayfert, Claudia

2014-05-15

Fear of sleep may play a significant role in sleep disturbances in individuals with posttraumatic stress disorder (PTSD). This report describes a psychometric study of the Fear of Sleep Inventory (FoSI), which was developed to measure this construct. The psychometric properties of the FoSI were examined in a non-clinical sample of 292 college students (Study I) and in a clinical sample of 67 trauma-exposed adults experiencing chronic nightmares (Study II). Data on the 23 items of the FoSI were subjected to exploratory factor analyses (EFA) to identify items uniquely assessing fear of sleep. Next, reliability and validity of a 13-item version of the FoSI was examined in both samples. A 13-item Short-Form version (FoSI-SF) was identified as having a clear 2-factor structure with high internal consistency in both the non-clinical (α = 0.76-0.94) and clinical (α = 0.88-0.91) samples. Both studies demonstrated good convergent validity with measures of PTSD (0.48-0.61) and insomnia (0.39-0.48) and discriminant validity with a measure of sleep hygiene (0.19-0.27). The total score on the FoSI-SF was significantly higher in the clinical sample (mean = 17.90, SD = 12.56) than in the non-clinical sample (mean = 4.80, SD = 7.72); t(357) = 8.85 p < 0.001. Although all items are recommended for clinical purposes, the data support the use of the 13-item FoSI-SF for research purposes. Replication of the factor structure in clinical samples is needed. Results are discussed in terms of limitations of this study and directions for further research.

A Psychometric Study of the Fear of Sleep Inventory-Short Form (FoSI-SF)

PubMed Central

Pruiksma, Kristi E.; Taylor, Daniel J.; Ruggero, Camilo; Boals, Adriel; Davis, Joanne L.; Cranston, Christopher; DeViva, Jason C.; Zayfert, Claudia

2014-01-01

Study Objectives: Fear of sleep may play a significant role in sleep disturbances in individuals with posttraumatic stress disorder (PTSD). This report describes a psychometric study of the Fear of Sleep Inventory (FoSI), which was developed to measure this construct. Methods: The psychometric properties of the FoSI were examined in a non-clinical sample of 292 college students (Study I) and in a clinical sample of 67 trauma-exposed adults experiencing chronic nightmares (Study II). Data on the 23 items of the FoSI were subjected to exploratory factor analyses (EFA) to identify items uniquely assessing fear of sleep. Next, reliability and validity of a 13-item version of the FoSI was examined in both samples. Results: A 13-item Short-Form version (FoSI-SF) was identified as having a clear 2-factor structure with high internal consistency in both the non-clinical (α = 0.76–0.94) and clinical (α = 0.88-0.91) samples. Both studies demonstrated good convergent validity with measures of PTSD (0.48-0.61) and insomnia (0.39-0.48) and discriminant validity with a measure of sleep hygiene (0.19-0.27). The total score on the FoSI-SF was significantly higher in the clinical sample (mean = 17.90, SD = 12.56) than in the non-clinical sample (mean = 4.80, SD = 7.72); t357 = 8.85 p < 0.001. Conclusions: Although all items are recommended for clinical purposes, the data support the use of the 13-item FoSI-SF for research purposes. Replication of the factor structure in clinical samples is needed. Results are discussed in terms of limitations of this study and directions for further research. Citation: Pruiksma KE, Taylor DJ, Ruggero C, Boals A, Davis JL, Cranston C, DeViva JC, Zayfert C. A psychometric study of the Fear of Sleep Inventory-short form (FoSI-SF). J Clin Sleep Med 2014;10(5):551-558. PMID:24812541

Efficiently Combining Water Reuse and Desalination through Forward Osmosis-Reverse Osmosis (FO-RO) Hybrids: A Critical Review.

PubMed

Blandin, Gaetan; Verliefde, Arne R D; Comas, Joaquim; Rodriguez-Roda, Ignasi; Le-Clech, Pierre

2016-07-01

Forward osmosis (FO) is a promising membrane technology to combine seawater desalination and water reuse. More specifically, in a FO-reverse osmosis (RO) hybrid process, high quality water recovered from the wastewater stream is used to dilute seawater before RO treatment. As such, lower desalination energy needs and/or water augmentation can be obtained while delivering safe water for direct potable reuse thanks to the double dense membrane barrier protection. Typically, FO-RO hybrid can be a credible alternative to new desalination facilities or to implementation of stand-alone water reuse schemes. However, apart from the societal (public perception of water reuse for potable application) and water management challenges (proximity of wastewater and desalination plants), FO-RO hybrid has to overcome technical limitation such as low FO permeation flux to become economically attractive. Recent developments (i.e., improved FO membranes, use of pressure assisted osmosis, PAO) demonstrated significant improvement in water flux. However, flux improvement is associated with drawbacks, such as increased fouling behaviour, lower rejection of trace organic compounds (TrOCs) in PAO operation, and limitation in FO membrane mechanical resistance, which need to be better considered. To support successful implementation of FO-RO hybrid in the industry, further work is required regarding up-scaling to apprehend full-scale challenges in term of mass transfer limitation, pressure drop, fouling and cleaning strategies on a module scale. In addition, refined economics assessment is expected to integrate fouling and other maintenance costs/savings of the FO/PAO-RO hybrid systems, as well as cost savings from any treatment step avoided in the water recycling.

Efficiently Combining Water Reuse and Desalination through Forward Osmosis—Reverse Osmosis (FO-RO) Hybrids: A Critical Review

PubMed Central

Blandin, Gaetan; Verliefde, Arne R.D.; Comas, Joaquim; Rodriguez-Roda, Ignasi; Le-Clech, Pierre

2016-01-01

Forward osmosis (FO) is a promising membrane technology to combine seawater desalination and water reuse. More specifically, in a FO-reverse osmosis (RO) hybrid process, high quality water recovered from the wastewater stream is used to dilute seawater before RO treatment. As such, lower desalination energy needs and/or water augmentation can be obtained while delivering safe water for direct potable reuse thanks to the double dense membrane barrier protection. Typically, FO-RO hybrid can be a credible alternative to new desalination facilities or to implementation of stand-alone water reuse schemes. However, apart from the societal (public perception of water reuse for potable application) and water management challenges (proximity of wastewater and desalination plants), FO-RO hybrid has to overcome technical limitation such as low FO permeation flux to become economically attractive. Recent developments (i.e., improved FO membranes, use of pressure assisted osmosis, PAO) demonstrated significant improvement in water flux. However, flux improvement is associated with drawbacks, such as increased fouling behaviour, lower rejection of trace organic compounds (TrOCs) in PAO operation, and limitation in FO membrane mechanical resistance, which need to be better considered. To support successful implementation of FO-RO hybrid in the industry, further work is required regarding up-scaling to apprehend full-scale challenges in term of mass transfer limitation, pressure drop, fouling and cleaning strategies on a module scale. In addition, refined economics assessment is expected to integrate fouling and other maintenance costs/savings of the FO/PAO-RO hybrid systems, as well as cost savings from any treatment step avoided in the water recycling. PMID:27376337

Simplified, rapid, and inexpensive estimation of water primary productivity based on chlorophyll fluorescence parameter Fo.

PubMed

Chen, Hui; Zhou, Wei; Chen, Weixian; Xie, Wei; Jiang, Liping; Liang, Qinlang; Huang, Mingjun; Wu, Zongwen; Wang, Qiang

2017-04-01

Primary productivity in water environment relies on the photosynthetic production of microalgae. Chlorophyll fluorescence is widely used to detect the growth status and photosynthetic efficiency of microalgae. In this study, a method was established to determine the Chl a content, cell density of microalgae, and water primary productivity by measuring chlorophyll fluorescence parameter Fo. A significant linear relationship between chlorophyll fluorescence parameter Fo and Chl a content of microalgae, as well as between Fo and cell density, was observed under pure-culture conditions. Furthermore, water samples collected from natural aquaculture ponds were used to validate the correlation between Fo and water primary productivity, which is closely related to Chl a content in water. Thus, for a given pure culture of microalgae or phytoplankton (mainly microalgae) in aquaculture ponds or other natural ponds for which the relationship between the Fo value and Chl a content or cell density could be established, Chl a content or cell density could be determined by measuring the Fo value, thereby making it possible to calculate the water primary productivity. It is believed that this method can provide a convenient way of efficiently estimating the primary productivity in natural aquaculture ponds and bringing economic value in limnetic ecology assessment, as well as in algal bloom monitoring. Copyright © 2017 Elsevier GmbH. All rights reserved.

Combination of forward osmosis (FO) process with coagulation/flocculation (CF) for potential treatment of textile wastewater.

PubMed

Han, Gang; Liang, Can-Zeng; Chung, Tai-Shung; Weber, Martin; Staudt, Claudia; Maletzko, Christian

2016-03-15

A novel combination of forward osmosis (FO) process with coagulation/flocculation (CF) (FO-CF) has been experimentally conceived for the treatment and reuse of textile wastewater. FO is employed to spontaneously recover water from the wastewater via osmosis and thus effectively reduces its volume with a dramatically enhanced dye concentration. CF is then applied to precipitate and remove dyes from the FO concentrated stream with much improved efficiency and reduced chemical dosage. The FO-CF hybrid system exhibits unique advantages of high water flux and recovery rate, well controlled membrane fouling, high efficiency, and minimal environmental impact. Using a lab-made thin-film composite (TFC) FO membrane, an initial water flux (Jw) of 36.0 L m(-2) h(-1) with a dye rejection of 99.9% has been demonstrated by using 2 M NaCl as the draw solution and synthetic textile wastewater containing multiple textile dyes, inorganic salts and organic additives as the feed under the FO mode. The Jw could be maintained at a high value of 12.0 L m(-2) h(-1) even when the recovery rate of the wastewater reaches 90%. Remarkable reverse fouling behavior has also been observed where the Jw of the fouled membrane can be almost fully restored to the initial value by physical flushing without using any chemicals. Due to the great dye concentration in the FO concentrated wastewater stream, the CF process could achieve more than 95% dye removal with a small dosage of coagulants and flocculants at 500-1000 ppm. The newly developed FO-CF hybrid process may open up new exploration of alternative technologies for the effective treatment and reuse of textile effluents. Copyright © 2016 Elsevier Ltd. All rights reserved.

JPL-20180522-GRACFOf-0001-NASAs GRACE FO Satellite Launches Aboard a SpaceX Falcon 9 Rocket

NASA Image and Video Library

2018-05-22

3-2-1 liftoff of Falcon 9 with GRACE-FO! NASA's Gravity Recovery and Climate Experiment Follow-on, or GRACE-FO, launched from Vandenberg Air Force Base on California's Central Coast on May 22, 2018. The twin orbiters shared a ride to space with five Iridium NEXT communications satellites. GRACE-FO will continue a study begun by the original GRACE mission, which proved that water movement can be tracked with high precision by its effect on Earth's gravitational field. GRACE-FO will continue the record of regional variations in gravity, telling us about changes in glaciers, ground water, sea levels and the health of our planet as a whole. For more, visit https://gracefo.jpl.nasa.gov .

Comparison of foE and M(3000)F2 variability at Ibadan, Singapore and Slough

NASA Astrophysics Data System (ADS)

Somoye, E. O.; Onori, E. O.; Akala, A. O.

2013-01-01

The variability, VR, of critical frequency of E-layer, foE, and ionospheric propagation factor, M(3000)F2 at Ibadan (7.4°N, 3.9°E, 6°S dip) is investigated for local time, seasonal and solar cycle variations. Latitudinal influence of these characteristics is sought by comparison with foE VR and M(3000)F2 VR of Slough ( 51.5°N, 359.4°E, 66.5°N dip) in the European sector, and Singapore (1.3°N,103.8°E, 17.6°S dip) in the Asian sector. While the pattern of foE VR is similar to those of other F2 characteristics with characteristic peaks around dawn and dusk, M(3000)F2 VR shows no clear diurnal trend.A lower bound of foE VR is usually 3% while the maximum VR ranges between 8% and13% at post-sunrise and pre-sunset hours at all the epochs, M(3000)F2 VR is however lower during MSA (about 9%) than during LSA and HSA when it is 4% to about 12-14%. Generally, daytime M(3000)F2 VR is greater than that of foE VR by between 5% and 10%. Furthermore, no latitudinal difference is observed in both characteristics during both HSA and MSA. While nighttime M(3000)F2 VR is about half that of nighttime foF2 VR (the critical frequency of F2-layer ) VR, daytime VR of both characteristics are about equal during the three epochs at Ibadan. For Slough, nighttime M(3000)F2 VR and nighttime foF2 VR as well as the daytime VR of both characteristics are about equal. This difference is most likely due to latitudinal effect.

[Effectiveness of the HighFO novel oxygen nebulizer for respiratory failure patients with severe hypoxia].

PubMed

Takamatsu, Kazufumi; Sakuramoto, Minoru; Inoue, Daiki; Ishitoko, Manabu; Itotani, Ryo; Suzuki, Shinko; Matsumoto, Masataka; Takemura, Masaya; Fukui, Motonari

2011-04-01

Optimal oxygen delivery is an essential component of therapy for patients with respiratory failure. Reservoir masks or air entrainment nebulizers have often been used for patients who require highly concentrated oxygen, but these may not actually deliver a sufficient fraction of inspired oxygen if there is a marked increase in the patient's ventilatory demands, or if oxygen flow becomes limited due to high resistance in the nebulizer nozzles. The HighFO nebulizer is a novel air entrainment nebulizer equipped with unique structures which reduce nozzle resistance, and as a result, it is possible to supply a sufficient flow of highly concentrated-oxygen. The purpose of this study was to evaluate the effectiveness and usefulness of the HighFO nebulizer in 10 respiratory failure patients with severe hypoxemia who used a reservoir mask and required more than 10 L/min of oxygen supply. In each case, the reservoir mask was replaced with the HighFO nebulizer, and changes in percutaneous oxygen saturation (SpO2) were monitored using pulse oximetry. Oxygenation improved promptly after the reservoir mask was substituted for the HighFO nebulizer (SpO2 : 83.7% +/- 8.5%-94.2% +/- 3.2%, p = 0.007). This finding suggests that the HighFO nebulizer was reasonably effective in delivering highly concentrated oxygen, sufficient for patient demands. The HighFO nebulizer may be the beginning of a new strategy for oxygen therapy.

Produced Water Treatment Using the Switchable Polarity Solvent Forward Osmosis (SPS FO) Desalination Process: Preliminary Engineering Design Basis

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wendt, Daniel; Adhikari, Birendra; Orme, Christopher

Switchable Polarity Solvent Forward Osmosis (SPS FO) is a semi-permeable membrane-based water treatment technology. INL is currently advancing SPS FO technology such that a prototype unit can be designed and demonstrated for the purification of produced water from oil and gas production operations. The SPS FO prototype unit will used the thermal energy in the produced water as a source of process heat, thereby reducing the external process energy demands. Treatment of the produced water stream will reduce the volume of saline wastewater requiring disposal via injection, an activity that is correlated with undesirable seismic events, as well as generatemore » a purified product water stream with potential beneficial uses. This paper summarizes experimental data that has been collected in support of the SPS FO scale-up effort, and describes how this data will be used in the sizing of SPS FO process equipment. An estimate of produced water treatment costs using the SPS FO process is also provided.« less

GRACE-FO Satellites in a Clean Room at Vandenberg Air Force Base

NASA Image and Video Library

2018-03-12

One of the two Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) satellites and its turntable fixture at the Astrotech Space Operations processing facility at Vandenberg Air Force Base, California. GRACE-FO will extend GRACE's legacy of scientific achievements, which range from tracking mass changes of Earth's polar ice sheets and estimating global groundwater changes, to measuring the mass changes of large earthquakes and inferring changes in deep ocean currents, a driving force in climate. To date, GRACE observations have been used in more than 4,300 research publications. Its measurements provide a unique view of the Earth system and have far-reaching benefits to society, such as providing insights into where global groundwater resources may be shrinking or growing and where dry soils are contributing to drought. GRACE-FO is planned to fly at least five years. https://photojournal.jpl.nasa.gov/catalog/PIA22339

GRACE-FO Satellites in a Clean Room at Vandenberg Air Force Base

NASA Image and Video Library

2018-03-12

The Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) twin satellites, attached to turntable fixtures, at the Astrotech Space Operations processing facility at Vandenberg Air Force Base, California. GRACE-FO will extend GRACE's legacy of scientific achievements, which range from tracking mass changes of Earth's polar ice sheets and estimating global groundwater changes, to measuring the mass changes of large earthquakes and inferring changes in deep ocean currents, a driving force in climate. To date, GRACE observations have been used in more than 4,300 research publications. Its measurements provide a unique view of the Earth system and have far-reaching benefits to society, such as providing insights into where global groundwater resources may be shrinking or growing and where dry soils are contributing to drought. GRACE-FO is planned to fly at least five years. https://photojournal.jpl.nasa.gov/catalog/PIA22341

GRACE-FO Satellites in a Clean Room at Vandenberg Air Force Base

NASA Image and Video Library

2018-03-12

The Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) twin satellites, attached to turntable fixtures, at the Astrotech Space Operations processing facility at Vandenberg Air Force Base, California. GRACE-FO will extend GRACE's legacy of scientific achievements, which range from tracking mass changes of Earth's polar ice sheets and estimating global groundwater changes, to measuring the mass changes of large earthquakes and inferring changes in deep ocean currents, a driving force in climate. To date, GRACE observations have been used in more than 4,300 research publications. Its measurements provide a unique view of the Earth system and have far-reaching benefits to society, such as providing insights into where global groundwater resources may be shrinking or growing and where dry soils are contributing to drought. GRACE-FO is planned to fly at least five years. https://photojournal.jpl.nasa.gov/catalog/PIA22338

GRACE-FO Satellites in a Clean Room at Vandenberg Air Force Base

NASA Image and Video Library

2018-03-12

The Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) twin satellites, attached to turntable fixtures, at the Astrotech Space Operations processing facility at Vandenberg Air Force Base, California. GRACE-FO will extend GRACE's legacy of scientific achievements, which range from tracking mass changes of Earth's polar ice sheets and estimating global groundwater changes, to measuring the mass changes of large earthquakes and inferring changes in deep ocean currents, a driving force in climate. To date, GRACE observations have been used in more than 4,300 research publications. Its measurements provide a unique view of the Earth system and have far-reaching benefits to society, such as providing insights into where global groundwater resources may be shrinking or growing and where dry soils are contributing to drought. GRACE-FO is planned to fly at least five years. https://photojournal.jpl.nasa.gov/catalog/PIA22340

Long-term trend of foE in European higher middle latitudes

NASA Astrophysics Data System (ADS)

Laštovička, Jan

2016-04-01

Long-term changes and trends have been observed in the whole ionosphere below its maximum. As concerns the E region, historical global data (Bremer, 2008) provide predominantly slightly positive trend, even though some stations provide a negative trend. Here we use data of two European stations with the best long data series of parameters of the ionospheric E layer, Slough/Chilton and Juliusruh over 1975-2014 (40 years). Noon-time medians (10-14 LT) are analyzed. The trend pattern after removing solar influence is complex. For yearly average values for Chilton first foE is decreasing in 1975-1990 by about 0.1 MHz, then the trend levels off or a little increase occurs in 1990-2004, and finally in 2004-2014 again a decrease is observed (again by about 0.1 MHz but over shorter period). Juliusruh yields a similar pattern. Similar analysis is also done for some months to check seasonal dependence of trends. The stability of relation between solar activity and foE is tested to clarify potential role of this factor in apparent trend of foE.

The Rotation Periods of 845 Naema, 1607 Mavis, and (30105) 2000 FO3

NASA Astrophysics Data System (ADS)

Bembrick, Collin; Allen, Bill; Bolt, Greg

2008-06-01

The synodic rotation period of minor planet 845 Naëma was found to be 20.892 ± 0.019 h. Similarly, the period of 1607 Mavis was 6.1339 ± 0.0004 h, and (30105) 2000 FO3 has a period of 7.272 ± 0.004 h. 845 Naëma has a complex lightcurve.

First uncertainty evaluation of the FoCS-2 primary frequency standard

NASA Astrophysics Data System (ADS)

Jallageas, A.; Devenoges, L.; Petersen, M.; Morel, J.; Bernier, L. G.; Schenker, D.; Thomann, P.; Südmeyer, T.

2018-06-01

We report the uncertainty evaluation of the Swiss continuous primary frequency standard FoCS-2 (Fontaine Continue Suisse). Unlike other primary frequency standards which are working with clouds of cold atoms, this fountain uses a continuous beam of cold caesium atoms bringing a series of metrological advantages and specific techniques for the evaluation of the uncertainty budget. Recent improvements of FoCS-2 have made possible the evaluation of the frequency shifts and of their uncertainties in the order of . When operating in an optimal regime a relative frequency instability of is obtained. The relative standard uncertainty reported in this article, , is strongly dominated by the statistics of the frequency measurements.

South American foF2 database using genetic algorithms

NASA Astrophysics Data System (ADS)

Gularte, Erika; Bilitza, Dieter; Carpintero, Daniel; Jaen, Juliana

2016-07-01

We present the first step towards a new database of the ionospheric parameter foF2 for the South American region. The foF2 parameter, being the maximum of the ionospheric electronic density profile and its main sculptor, is of great interest not only in atmospheric studies but also in the realm of radio propagation. Due to its importance, its large variability and the difficulty to model it in time and space, it was the subject of an intense study since decades ago. The current databases, used by the IRI (International Reference Ionosphere) model, and based on Fourier expansions, has been built in the 60s from the available ionosondes at that time; therefore, it is still short of South American data. The main goal of this work is to upgrade the database, incorporating the now available data compiled by the RAPEAS (Red Argentina para el Estudio de la Atmósfera Superior, Argentine Network for the Study of the Upper Atmosphere) network. Also, we developed an algorithm to study the foF2 variability, based on the modern technique of genetic algorithms, which has been successfully applied on other disciplines. One of the main advantages of this technique is its ability in working with many variables and with unfavorable samples. The results are compared with the IRI databases, and improvements to the latter are suggested. Finally, it is important to notice that the new database is designed so that new available data can be easily incorporated.

Students' Social Media Engagement and Fear of Missing out (FoMO) in a Diverse Classroom

ERIC Educational Resources Information Center

Alt, Dorit

2017-01-01

With the growing attention paid to fear of missing out (FoMO) psychological phenomenon in explaining social media engagement (SME), this mixed-method research measured the relative impact of FoMO on students' SME for personal reasons during lectures. The moderating effect of culture (minority vs. non-minority students) on the connection between…

A discharge flow-photoionization mass spectrometric study of the FO(X 2 Pi i) radical. Photoionization efficiency spectrum and ionization energy

NASA Technical Reports Server (NTRS)

Zhang, Zhengyu; Kuo, Szu-Cherng; Klemm, R. Bruce; Monks, Paul S.; Stief, Louis J.

1994-01-01

Photoionization efficiency spectra of FO were measured over the wavelength range 80.0-100.0 nm and in the ionization threshold region, 94.0-100.0 nm, using a discharge flow-photoionization mass spectrometer apparatus coupled to a synchrotron radiation source. FO was generated by the reaction of F2P atoms with NO3 and via a F2O2 discharge. A value of 12.78 +/- 0.03 eV was obtained for the adiabatic ionization energy of FO from photoion thresholds which corresponds to FO(+)(X 3 Sigma -) from FO(X 2 Pi i). These results, which are the first to be obtained by direct Photo-ionization mass spectrometry (PIMS) measurements, corroborate those of a photoelectron spectroscopy (PES) study; however, the ionization energy determined here is free from interferences due to other species which complicated the PES measurement. A value of 109.5 +/- 8.0 kJ/mol for Delta f H 0 298(FO) is computed from the present value of IE(FO) and a previous appearance energy measurement, and a value for the proton affinity of FO is calculated to be 511.5 +/- 10.0 kJ/mol.

Controlling the morphology and performance of FO membrane via adjusting the atmosphere humidity during casting procedure

NASA Astrophysics Data System (ADS)

Zuo, Hao-Ran; Cao, Gui-Ping; Wang, Meng; Zhang, Huan-Huan; Song, Chen-Chen; Fang, Xu; Wang, Tao

2018-03-01

Forward osmosis (FO) has received great interest for its considerable potential in a wide range of fields. In this work, the morphology and performance of FO membrane were regulated by adjusting the atmosphere humidity (HC) of casting procedure. The polysulfone support layer was casted under various atmosphere humidity levels ranging from 40% to 80%. By multi-techniques such as SEM, AFM, and XPS, it was proved that the atmosphere humidity had modified the surface morphology and thickness of the skin layer in support layer, which contributed up to 90% of the structure parameter, resulting in distinct morphology, thickness, and cross-linking degree of active layer. The active layer with sparse bead-like wrinkles on the smooth surface of support layer casted at HC = 65% showed the highest water permeability [26.9 (L/m2 h MPa)] and considerable low salt permeability [0.0390 (L/m2 h)]. It was found that the water flux of FO-65 was 27% and 46% higher than that of FO-80 in AL-DS and AL-FS mode, respectively, and the salt rejection was as high as 98%. Our work highlighted the importance of considering the effect of atmosphere humidity during casting when design an FO membrane for appropriate performance.

A comparison of neural network-based predictions of foF2 with the IRI-2012 model at conjugate points in Southeast Asia

NASA Astrophysics Data System (ADS)

Wichaipanich, Noraset; Hozumi, Kornyanat; Supnithi, Pornchai; Tsugawa, Takuya

2017-06-01

This paper presents the development of Neural Network (NN) model for the prediction of the F2 layer critical frequency (foF2) at three ionosonde stations near the magnetic equator of Southeast Asia. Two of these stations including Chiang Mai (18.76°N, 98.93°E, dip angle 12.7°N) and Kototabang (0.2°S, 100.3°E, dip angle 10.1°S) are at the conjugate points while Chumphon (10.72°N, 99.37°E, dip angle 3.0°N) station is near the equator. To produce the model, the feed forward network with backpropagation algorithm is applied. The NN is trained with the daily hourly values of foF2 during 2004-2012, except 2009, and the selected input parameters, which affect the foF2 variability, include day number (DN), hour number (HR), solar zenith angle (C), geographic latitude (θ), magnetic inclination (I), magnetic declination (D) and angle of meridian (M) relative to the sub-solar point, the 7-day mean of F10.7 (F10.7_7), the 81-day mean of SSN (SSN_81) and the 2-day mean of Ap (Ap_2). The foF2 data of 2009 and 2013 are then used for testing the NN model during the foF2 interpolation and extrapolation, respectively. To examine the performance of the proposed NN, the root mean square error (RMSE) of the observed foF2, the proposed NN model and the IRI-2012 (CCIR and URSI options) model are compared. In general, the results show the same trends in foF2 variation between the models (NN and IRI-2012) and the observations in that they are higher during the day and lower at night. Besides, the results demonstrate that the proposed NN model can predict the foF2 values more closely during daytime than during nighttime as supported by the lower RMSE values during daytime (0.5 ≤ RMSE ≤ 1.0 for Chumphon and Kototabang, 0.7 ≤ RMSE ≤ 1.2 at Chiang Mai) and with the highest levels during nighttime (0.8 ≤ RMSE ≤ 1.5 for Chumphon and Kototabang, 1.2 ≤ RMSE ≤ 2.0 at Chiang Mai). Furthermore, the NN model predicts the foF2 values more accurately than the IRI model at the

Enhancing boron rejection in FO using alkaline draw solutions.

PubMed

Wang, Yi-Ning; Li, Weiyi; Wang, Rong; Tang, Chuyang Y

2017-07-01

This study provides a novel method to enhance boron removal in a forward osmosis (FO) process. It utilizes the reverse solute diffusion (RSD) of ions from alkaline draw solutions (DSs) and the concentration polarization of the hydroxyl ions to create a highly alkaline environment near the membrane active surface. The results show that boron rejection can be significantly enhanced by increasing the pH of NaCl DS to 12.5 in the active-layer-facing-feed-solution (AL-FS) orientation. The effect of RSD enhanced boron rejection was further promoted in the presence of concentration polarization (e.g., in the active-layer-facing-draw-solution (AL-DS) orientation). The current study opens a new dimension for controlling contaminant removal by FO using tailored DS chemistry, where the RSD-induced localized water chemistry change is taken advantage in contrast to the conventional method of chemical dosing to the bulk feed water. Copyright © 2017 Elsevier Ltd. All rights reserved.

A prediction model of short-term ionospheric foF2 based on AdaBoost

NASA Astrophysics Data System (ADS)

Zhao, Xiukuan; Ning, Baiqi; Liu, Libo; Song, Gangbing

2014-02-01

In this paper, the AdaBoost-BP algorithm is used to construct a new model to predict the critical frequency of the ionospheric F2-layer (foF2) one hour ahead. Different indices were used to characterize ionospheric diurnal and seasonal variations and their dependence on solar and geomagnetic activity. These indices, together with the current observed foF2 value, were input into the prediction model and the foF2 value at one hour ahead was output. We analyzed twenty-two years' foF2 data from nine ionosonde stations in the East-Asian sector in this work. The first eleven years' data were used as a training dataset and the second eleven years' data were used as a testing dataset. The results show that the performance of AdaBoost-BP is better than those of BP Neural Network (BPNN), Support Vector Regression (SVR) and the IRI model. For example, the AdaBoost-BP prediction absolute error of foF2 at Irkutsk station (a middle latitude station) is 0.32 MHz, which is better than 0.34 MHz from BPNN, 0.35 MHz from SVR and also significantly outperforms the IRI model whose absolute error is 0.64 MHz. Meanwhile, AdaBoost-BP prediction absolute error at Taipei station from the low latitude is 0.78 MHz, which is better than 0.81 MHz from BPNN, 0.81 MHz from SVR and 1.37 MHz from the IRI model. Finally, the variety characteristics of the AdaBoost-BP prediction error along with seasonal variation, solar activity and latitude variation were also discussed in the paper.

Peridotites and basalts reveal broad congruence between two independent records of mantle fO2 despite local redox heterogeneity

NASA Astrophysics Data System (ADS)

Birner, Suzanne K.; Cottrell, Elizabeth; Warren, Jessica M.; Kelley, Katherine A.; Davis, Fred A.

2018-07-01

The oxygen fugacity (fO2) of the oceanic upper mantle has fundamental implications for the production of magmas and evolution of the Earth's interior and exterior. Mid-ocean ridge basalts and peridotites sample the oceanic upper mantle, and retain a record of oxygen fugacity. While fO2 has been calculated for mid-ocean ridge basalts worldwide (>200 locations), ridge peridotites have been comparatively less well studied (33 samples from 11 locations), and never in the same geographic location as basalts. In order to determine whether peridotites and basalts from mid-ocean ridges record congruent information about the fO2 of the Earth's interior, we analyzed 31 basalts and 41 peridotites from the Oblique Segment of the Southwest Indian Ridge. By measuring basalts and peridotites from the same ridge segment, we can compare samples with maximally similar petrogenetic histories. We project the composition and oxygen fugacity of each lithology back to source conditions, and evaluate the effects of factors such as subsolidus diffusion in peridotites and fractional crystallization in basalts. We find that, on average, basalts and peridotites from the Oblique Segment both reflect a source mantle very near the quartz-fayalite-magnetite (QFM) buffer. However, peridotites record a significantly wider range of values (nearly 3 orders of magnitude in fO2), with a single dredge recording a range in fO2 greater than that previously reported for mid-ocean ridge peridotites worldwide. This suggests that mantle fO2 may be heterogeneous on relatively short length scales, and that this heterogeneity may be obscured within aggregated basalt melts. We further suggest that the global peridotite fO2 dataset may not provide a representative sample of average basalt-source mantle. Our study motivates further investigation of the fO2 recorded by ridge peridotites, as peridotites record information about the fO2 of the Earth's interior that cannot be gleaned from analysis of basalts alone.

SoFoCles: feature filtering for microarray classification based on gene ontology.

PubMed

Papachristoudis, Georgios; Diplaris, Sotiris; Mitkas, Pericles A

2010-02-01

Marker gene selection has been an important research topic in the classification analysis of gene expression data. Current methods try to reduce the "curse of dimensionality" by using statistical intra-feature set calculations, or classifiers that are based on the given dataset. In this paper, we present SoFoCles, an interactive tool that enables semantic feature filtering in microarray classification problems with the use of external, well-defined knowledge retrieved from the Gene Ontology. The notion of semantic similarity is used to derive genes that are involved in the same biological path during the microarray experiment, by enriching a feature set that has been initially produced with legacy methods. Among its other functionalities, SoFoCles offers a large repository of semantic similarity methods that are used in order to derive feature sets and marker genes. The structure and functionality of the tool are discussed in detail, as well as its ability to improve classification accuracy. Through experimental evaluation, SoFoCles is shown to outperform other classification schemes in terms of classification accuracy in two real datasets using different semantic similarity computation approaches.

Fast deswelling of nanocomposite polymer hydrogels via magnetic field-induced heating for emerging FO desalination.

PubMed

Razmjou, Amir; Barati, Mohammad Reza; Simon, George P; Suzuki, Kiyonori; Wang, Huanting

2013-06-18

Freshwater shortage is one of the most pressing global issues. Forward osmosis (FO) desalination technology is emerging for freshwater production from saline water, which is potentially more energy-efficient than the current reverse osmosis process. However, the lack of a suitable draw solute is the major hurdle for commercial implementation of the FO desalination technology. We have previously reported that thermoresponsive hydrogels can be used as the draw agent for a FO process, and this new hydrogel-driven FO process holds promise for further development for practical application. In the present work, magnetic field-induced heating is explored for the purpose of developing a more effective way to recover water from swollen hydrogel draw agents. The composite hydrogel particles are prepared by copolymerization of sodium acrylate and N-isopropylacrylamide in the presence of magnetic nanoparticles (γ-Fe2O3, <50 nm). The results indicate that the magnetic heating is an effective and rapid method for dewatering of hydrogels by generating the heat more uniformly throughout the draw agent particles, and thus, a dense skin layer commonly formed via conventional heating from the outside of the particle is minimized. The FO dewatering performance is affected by the loading of magnetic nanoparticles and magnetic field intensity. Significantly enhanced liquid water recovery (53%) is achieved under magnetic heating, as opposed to only around 7% liquid water recovery obtained via convection heating. Our study shows that the magnetic heating is an attractive alternative stimulus for the extraction of highly desirable liquid water from the draw agent in the polymer hydrogel-driven forward osmosis process.

Energy requirements of the switchable polarity solvent forward osmosis (SPS-FO) water purification process

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wendt, Daniel S.; Orme, Christopher J.; Mines, Gregory L.

A model was developed to estimate the process energy requirements of a switchable polarity solvent forward osmosis (SPS FO) system for water purification from aqueous NaCl feed solution concentrations ranging from 0.5 to 4.0 molal at an operational scale of 480 m3/day (feed stream). The model indicates recovering approximately 90% of the water from a feed solution with NaCl concentration similar to seawater using SPS FO would have total equivalent energy requirements between 2.4 and 4.3 kWh per m 3 of purified water product. The process is predicted to be competitive with current costs for disposal/treatment of produced water frommore » oil and gas drilling operations. As a result, once scaled up the SPS FO process may be a thermally driven desalination process that can compete with the cost of seawater reverse osmosis.« less

Energy requirements of the switchable polarity solvent forward osmosis (SPS-FO) water purification process

DOE PAGES

Wendt, Daniel S.; Orme, Christopher J.; Mines, Gregory L.; ...

2015-08-01

A model was developed to estimate the process energy requirements of a switchable polarity solvent forward osmosis (SPS FO) system for water purification from aqueous NaCl feed solution concentrations ranging from 0.5 to 4.0 molal at an operational scale of 480 m3/day (feed stream). The model indicates recovering approximately 90% of the water from a feed solution with NaCl concentration similar to seawater using SPS FO would have total equivalent energy requirements between 2.4 and 4.3 kWh per m 3 of purified water product. The process is predicted to be competitive with current costs for disposal/treatment of produced water frommore » oil and gas drilling operations. As a result, once scaled up the SPS FO process may be a thermally driven desalination process that can compete with the cost of seawater reverse osmosis.« less

Oxygen Buffering in High Pressure Solid Media Assemblies: New Approach Enabling Study of fO2 from IW-4 to IW+4.5

NASA Technical Reports Server (NTRS)

Righter, K.; Pando, K. M.; Ross, D. K.; Butterworth, A. L.; Gainsforth, Z.; Jilly-Rehak, C. E.; Westphal, A. J.

2017-01-01

Oxygen fugacity is an intensive parameter that controls some fundamental chemical and physical properties in planetary materials. In terrestrial magmas high fO2 promotes magnetite stability and low fO2 causes Fe-enrichment due to magnetite suppression. In lunar and asteroidal basalts, low fO2 can allow metal to be stable. Experimental studies will therefore be most useful if they are done at a specific and relevant fO2 for the samples under consideration. Control of fO2 in the solid media apparatus (piston cylinder multi-anvil) has relied on either sliding sensors or graphite capsule buffering, which are of limited application to the wide range of fO2 recorded in planetary or astromaterials. Here we describe a new approach that allows fO2 to be specified across a wide range of values relevant to natural samples.

Parametric decadal climate forecast recalibration (DeFoReSt 1.0)

NASA Astrophysics Data System (ADS)

Pasternack, Alexander; Bhend, Jonas; Liniger, Mark A.; Rust, Henning W.; Müller, Wolfgang A.; Ulbrich, Uwe

2018-01-01

Near-term climate predictions such as decadal climate forecasts are increasingly being used to guide adaptation measures. For near-term probabilistic predictions to be useful, systematic errors of the forecasting systems have to be corrected. While methods for the calibration of probabilistic forecasts are readily available, these have to be adapted to the specifics of decadal climate forecasts including the long time horizon of decadal climate forecasts, lead-time-dependent systematic errors (drift) and the errors in the representation of long-term changes and variability. These features are compounded by small ensemble sizes to describe forecast uncertainty and a relatively short period for which typically pairs of reforecasts and observations are available to estimate calibration parameters. We introduce the Decadal Climate Forecast Recalibration Strategy (DeFoReSt), a parametric approach to recalibrate decadal ensemble forecasts that takes the above specifics into account. DeFoReSt optimizes forecast quality as measured by the continuous ranked probability score (CRPS). Using a toy model to generate synthetic forecast observation pairs, we demonstrate the positive effect on forecast quality in situations with pronounced and limited predictability. Finally, we apply DeFoReSt to decadal surface temperature forecasts from the MiKlip prototype system and find consistent, and sometimes considerable, improvements in forecast quality compared with a simple calibration of the lead-time-dependent systematic errors.

Hysterosalpingo-foam sonography (HyFoSy): Tolerability, safety and the occurrence of pregnancy post-procedure.

PubMed

Tanaka, Keisuke; Chua, Jackie; Cincotta, Robert; Ballard, Emma L; Duncombe, Gregory

2018-02-01

Fallopian tube patency testing is an essential part of infertility evaluation. Hysterosalpingo-contrast sonography (HyCoSy) has been described as reliable, well tolerated and safe compared to other modalities such as laparoscopy and a dye test or hysterosalpingography. Limited availability of the previously used contrast has led to the introduction of a foam contrast agent as an alternative. To assess the tolerability, safety and occurrence of pregnancy post-procedure of hysterosalpingo-foam sonography (HyFoSy). A retrospective cohort study of women who had a HyFoSy at Queensland Ultrasound for Women from March 2013 to February 2015. A questionnaire was sent to their referring doctor to identify any complications or subsequent pregnancies with or without artificial reproductive technology (ART) within six months of the HyFoSy. Of 200 women, four cases were abandoned due to difficulty introducing the intracervical catheter, severe discomfort or a vasovagal episode. Response from referring doctors for 155 women reported no post-procedural complication. One hundred and eleven women were followed up for at least six months. Twenty-four out of 59 women (40.7%) who had ART and 24 out of 52 women (46.2%) who did not have ART conceived. Fifty percent of women who were nulligravida at the time of investigation, found to have at least one patent fallopian tube, whose partner had a normal semen analysis, spontaneously conceived within the time of follow up. HyFoSy is well tolerated and safe. A preponderance of pregnancies in the first month after HyFoSy suggests that a therapeutic effect may exist. © 2017 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.

FoSSI: the family of simplified solver interfaces for the rapid development of parallel numerical atmosphere and ocean models

NASA Astrophysics Data System (ADS)

Frickenhaus, Stephan; Hiller, Wolfgang; Best, Meike

The portable software FoSSI is introduced that—in combination with additional free solver software packages—allows for an efficient and scalable parallel solution of large sparse linear equations systems arising in finite element model codes. FoSSI is intended to support rapid model code development, completely hiding the complexity of the underlying solver packages. In particular, the model developer need not be an expert in parallelization and is yet free to switch between different solver packages by simple modifications of the interface call. FoSSI offers an efficient and easy, yet flexible interface to several parallel solvers, most of them available on the web, such as PETSC, AZTEC, MUMPS, PILUT and HYPRE. FoSSI makes use of the concept of handles for vectors, matrices, preconditioners and solvers, that is frequently used in solver libraries. Hence, FoSSI allows for a flexible treatment of several linear equations systems and associated preconditioners at the same time, even in parallel on separate MPI-communicators. The second special feature in FoSSI is the task specifier, being a combination of keywords, each configuring a certain phase in the solver setup. This enables the user to control a solver over one unique subroutine. Furthermore, FoSSI has rather similar features for all solvers, making a fast solver intercomparison or exchange an easy task. FoSSI is a community software, proven in an adaptive 2D-atmosphere model and a 3D-primitive equation ocean model, both formulated in finite elements. The present paper discusses perspectives of an OpenMP-implementation of parallel iterative solvers based on domain decomposition methods. This approach to OpenMP solvers is rather attractive, as the code for domain-local operations of factorization, preconditioning and matrix-vector product can be readily taken from a sequential implementation that is also suitable to be used in an MPI-variant. Code development in this direction is in an advanced state under

A novel TFC forward osmosis (FO) membrane supported by polyimide (PI) microporous nanofiber membrane

NASA Astrophysics Data System (ADS)

Chi, Xiang-Yu; Zhang, Ping-Yun; Guo, Xue-Jiao; Xu, Zhen-Liang

2018-01-01

A novel interfacial polymerization (IP) procedure on polyimide (PI) microporous nanofiber membrane support with mean pore size 1.27 μm was reported. Using m-phenylenediamine (MPD) as aqueous phase monomer, trimesoyl chloride (TMC) as organic phase monomer, ethanol as aqueous phase co-solvent, thin-film composite (TFC) forward osmosis (FO) membrane was fabricated by two IP procedures. The first IP procedure with the unconventional order (ie, the membrane was immersed in the TMC organic phase first, then in the co-solvent ethanol-water MPD aqueous phase) was used to diminish the pore size of PI microporous nanofiber membrane support for the formation of the polyamide layer. The secondary IP procedure was employed to form the relatively dense polyamide layer with conventional order (ie, the membrane was immersed in the co-solvent ethanol-water MPD aqueous phase first, then in the TMC organic phase). The experimental results showed that higher ethanol concentration led to the relatively higher pure water permeability in RO process and osmotic water flux in FO process, whereas NaCl rejection in RO process decreased and reverse salt flux increased. The specific salt flux (Js/Jv) of TFC FO PI nanofiber membrane (PIN-2-4) could be as low as 0.095 g/L in FO mode. These results could be attributed to influence of the addition of ethanol into aqueous phase on the surface morphology, hydrophilicity and polyamide layer structure.

Concentrating molasses distillery wastewater using biomimetic forward osmosis (FO) membranes.

PubMed

Singh, N; Petrinic, I; Hélix-Nielsen, C; Basu, S; Balakrishnan, M

2018-03-01

Treatment of sugarcane molasses distillery wastewater is challenging due to the presence of complex phenolic compounds (melanoidins and polyphenols) having antioxidant properties. Due to zero liquid discharge regulations, Indian distilleries continue to explore effective treatment options. This work examines the concentration of distillery wastewater by forward osmosis (FO) using aquaporin biomimetic membranes and magnesium chloride hexahydrate (MgCl 2 .6H 2 O) as draw solution. The operational parameters viz. feed solution and draw solution flow rate and draw solution concentration were optimized using 10% v/v melanoidins model feed solution. This was followed by trials with distillery wastewater. Under the conditions of this work, feed and draw flow rates of 1 L/min and draw solution concentration of 2M MgCl 2 .6H 2 O for melanoidins model solution and 3M MgCl 2 .6H 2 O for distillery wastewater were optimal for maximum rejection. Rejection of 90% melanoidins, 96% antioxidant activity and 84% COD was obtained with melanoidins model feed, with a corresponding water flux of 6.3 L/m 2 h. With as-received distillery wastewater, the rejection was similar (85-90%) to the melanoidins solution, but the water flux was lower (2.8 L/m 2 h). Water recovery from distillery wastewater over 24 h study period was higher with FO (70%) than reported for RO (35-45%). Repeated use of the FO membrane over five consecutive 24 h cycles with fresh feed and draw solutions and periodic cleaning showed consistent average water flux and rejection of the feed constituents. Copyright © 2017 Elsevier Ltd. All rights reserved.

Ability of Nonpathogenic Fusarium oxysporum Strain Fo47 To Induce Resistance against Pythium ultimum Infection in Cucumber

PubMed Central

Benhamou, Nicole; Garand, Chantal; Goulet, Alain

2002-01-01

The influence exerted by nonpathogenic Fusarium oxysporum strain Fo47 in triggering cucumber protection against infection by Pythium ultimum was investigated ultrastructurally. Macroscopic and microscopic observations of the pathogen colony in dual cultures revealed that reduction of Pythium growth was associated with marked disorders, including generalized disorganization of the host cytoplasm, retraction of the plasmalemma, and complete loss of the protoplasm. Cytochemical labeling of cellulose with an exoglucanase-gold complex showed that the cellulose component of the host cell walls was structurally preserved at a time when the host cytoplasm had undergone complete disorganization. A similar antagonistic process was observed at the root cell surface. Most striking and interesting was the finding that mycoparasitism, as evidenced by the frequent occurrence of Fo47 hyphae within nearly empty cells of the pathogen, occurred not only at the root surface but also within the invaded root tissues. The specific labeling pattern obtained with the exoglucanase-gold complex confirmed that Fo47 successfully penetrated cells of the pathogen, both in the rhizosphere and inside the root tissues. Pythium cells that could evade the first defensive line in the rhizosphere could penetrate the root epidermis, but their growth was restricted to the outermost tissues. Positive correlations between Fo47 treatment and induced resistance to infection by P. ultimum in cucumber were confirmed by (i) the reduction of pathogen viability; (ii) the elaboration of newly formed barriers, a phenomenon which was not seen in Fo47-free plants, where the pathogen proliferated in all root tissues within a few days; and (iii) the occlusion of intercellular spaces with a dense material likely enriched in phenolics. Taken together, our observations provide the first convincing evidence that Fo47 exerts a direct inhibitory effect on P. ultimum through a combination of antibiosis and mycoparasitism, in

Effect of salinity and temperature on treatment of concentrated wastewater from RO by FO-MD

NASA Astrophysics Data System (ADS)

Zhou, Yingru; Huang, Manhong; Deng, Qian

2018-02-01

In this study the appropriate temperature of the membrane distillation (MD) hot side (the permeation flux of MD was controlled by adjusting the hot side temperature) was selected according to the water flux of FO process so that the water transfer rate on both sides of FO and MD was consistent and the FO-MD process could be stable operation. When the salt concentration of feed solution was 30, 55, 80 and 100 g/L, the desalination rates changed little, which were 99.1%, 98.4%, 98.9% and 98.7%, respectively. The removal rate of COD was 93.8%, 94.2%, 91.6% and 92.7% which also changed little like the desalination rates. The removal rate of chromaticity increased with the increase of salinity, which attained 96.6%, 97.0%, 97.2% and 97.9%, respectively. This study proved that salinity of the feed solution affected little on the removal rate of contaminants but great on the water flux, with the increase of salinity from 30 to 100 g/L, the water flux was 6.05, 4.81, 4.33 and 3.87 LMH with the appropriate temperature (67.5±0.5, 64.5±0.5, 62.5±0.5 and 60.5±0.5 °C) of MD hot side. In a word, FO-MD was first used to treat the high salinity RO water with over 30 g/L total dissolved solids (TDS), FO-MD was a promising new process for high salinity wastewater treatment, and the hybrid system can solve the problem of lower draw solution concentration, and the high-quality production water will be obtained directly by this hybrid system with low membrane fouling tendency.

A prediction model of short-term ionospheric foF2 Based on AdaBoost

NASA Astrophysics Data System (ADS)

Zhao, Xiukuan; Liu, Libo; Ning, Baiqi

Accurate specifications of spatial and temporal variations of the ionosphere during geomagnetic quiet and disturbed conditions are critical for applications, such as HF communications, satellite positioning and navigation, power grids, pipelines, etc. Therefore, developing empirical models to forecast the ionospheric perturbations is of high priority in real applications. The critical frequency of the F2 layer, foF2, is an important ionospheric parameter, especially for radio wave propagation applications. In this paper, the AdaBoost-BP algorithm is used to construct a new model to predict the critical frequency of the ionospheric F2-layer one hour ahead. Different indices were used to characterize ionospheric diurnal and seasonal variations and their dependence on solar and geomagnetic activity. These indices, together with the current observed foF2 value, were input into the prediction model and the foF2 value at one hour ahead was output. We analyzed twenty-two years’ foF2 data from nine ionosonde stations in the East-Asian sector in this work. The first eleven years’ data were used as a training dataset and the second eleven years’ data were used as a testing dataset. The results show that the performance of AdaBoost-BP is better than those of BP Neural Network (BPNN), Support Vector Regression (SVR) and the IRI model. For example, the AdaBoost-BP prediction absolute error of foF2 at Irkutsk station (a middle latitude station) is 0.32 MHz, which is better than 0.34 MHz from BPNN, 0.35 MHz from SVR and also significantly outperforms the IRI model whose absolute error is 0.64 MHz. Meanwhile, AdaBoost-BP prediction absolute error at Taipei station from the low latitude is 0.78 MHz, which is better than 0.81 MHz from BPNN, 0.81 MHz from SVR and 1.37 MHz from the IRI model. Finally, the variety characteristics of the AdaBoost-BP prediction error along with seasonal variation, solar activity and latitude variation were also discussed in the paper.

Step size of the rotary proton motor in single FoF1-ATP synthase from a thermoalkaliphilic bacterium by DCO-ALEX FRET

NASA Astrophysics Data System (ADS)

Hammann, Eva; Zappe, Andrea; Keis, Stefanie; Ernst, Stefan; Matthies, Doreen; Meier, Thomas; Cook, Gregory M.; Börsch, Michael

2012-02-01

Thermophilic enzymes operate at high temperatures but show reduced activities at room temperature. They are in general more stable during preparation and, accordingly, are considered to be more rigid in structure. Crystallization is often easier compared to proteins from bacteria growing at ambient temperatures, especially for membrane proteins. The ATP-producing enzyme FoF1-ATP synthase from thermoalkaliphilic Caldalkalibacillus thermarum strain TA2.A1 is driven by a Fo motor consisting of a ring of 13 c-subunits. We applied a single-molecule Förster resonance energy transfer (FRET) approach using duty cycle-optimized alternating laser excitation (DCO-ALEX) to monitor the expected 13-stepped rotary Fo motor at work. New FRET transition histograms were developed to identify the smaller step sizes compared to the 10-stepped Fo motor of the Escherichia coli enzyme. Dwell time analysis revealed the temperature and the LDAO dependence of the Fo motor activity on the single molecule level. Back-and-forth stepping of the Fo motor occurs fast indicating a high flexibility in the membrane part of this thermophilic enzyme.

Antagonistic Effect of Nonpathogenic Fusarium oxysporum Fo47 and Pseudobactin 358 upon Pathogenic Fusarium oxysporum f. sp. dianthi

PubMed Central

Lemanceau, Philippe; Bakker, Peter A. H. M.; De Kogel, Willem Jan; Alabouvette, Claude; Schippers, Bob

1993-01-01

Pseudobactin production by Pseudomonas putida WCS358 significantly improves biological control of fusarium wilt caused by nonpathogenic Fusarium oxysporum Fo47b10 (P. Lemanceau, P. A. H. M. Bakker, W. J. de Kogel, C. Alabouvette, and B. Schippers, Appl. Environ. Microbiol. 58:2978-2982, 1992). The antagonistic effect of Fo47b10 and purified pseudobactin 358 was studied by using an in vitro bioassay. This bioassay allows studies on interactions among nonpathogenic F. oxysporum Fo47b10, pathogenic F. oxysporum f. sp. dianthi WCS816, and purified pseudobactin 358, the fluorescent siderophore produced by P. putida WCS358. Both nonpathogenic and pathogenic F. oxysporum reduced each other's growth when grown together. However, in these coinoculation experiments, pathogenic F. oxysporum WCS816 was relatively more inhibited in its growth than nonpathogenic F. oxysporum Fo47b10. The antagonism of nonpathogenic F. oxysporum against pathogenic F. oxysporum strongly depends on the ratio of nonpathogenic to pathogenic F. oxysporum densities: the higher this ratio, the stronger the antagonism. This fungal antagonism appears to be mainly associated with the competition for glucose. Pseudobactin 358 reduced the growth of both F. oxysporum strains, whereas ferric pseudobactin 358 did not; antagonism by pseudobactin 358 was then related to competition for iron. However, the pathogenic F. oxysporum strain was more sensitive to this antagonism than the nonpathogenic strain. Pseudobactin 358 reduced the efficiency of glucose metabolism by the fungi. These results suggest that pseudobactin 358 increases the intensity of the antagonism of nonpathogenic F. oxysporum Fo47b10 against pathogenic F. oxysporum WCS816 by making WCS816 more sensitive to the glucose competition by Fo47b10. PMID:16348860

The Mineralogy, Geochemistry, and Redox State of Multivalent Cations During the Crystallization of Primitive Shergottitic Liquids at Various (f)O2. Insights into the (f)O2 Fugacity of the Martian Mantle and Crustal Influences on Redox Conditions of Martian Magmas.

NASA Technical Reports Server (NTRS)

Shearer, C. K.; Bell, A. S.; Burger, P. V.; Papike, J. J.; Jones, J.; Le, L.; Muttik, N.

2016-01-01

The (f)O2 [oxygen fugacity] of crystallization for martian basalts has been estimated in various studies to range from IW-1 to QFM+4 [1-3]. A striking geochemical feature of the shergottites is the large range in initial Sr isotopic ratios and initial epsilon(sup Nd) values. Studies by observed that within the shergottite group the (f)O2 [oxygen fugacity] of crystallization is highly correlated with these chemical and isotopic characteristics with depleted shergottites generally crystallizing at reduced conditions and enriched shergottites crystallizing under more oxidizing conditions. More recent work has shown that (f)O2 [oxygen fugacity] changed during the crystallization of these magmas from one order of magnitude in Y980459 (Y98) to several orders of magnitude in Larkman Nunatak 06319. These real or apparent variations within single shergottitic magmas have been attributed to mixing of a xenocrystic olivine component, volatile loss-water disassociation, auto-oxidation during crystallization of mafic phases, and assimilation of an oxidizing crustal component (e.g. sulfate). In contrast to the shergottites, augite basalts such as NWA 8159 are highly depleted yet appear to be highly oxidized (e.g. QFM+4). As a first step in attempting to unravel petrologic complexities that influence (f)O2 [oxygen fugacity] in martian magmas, this study explores the effect of (f)O2 [oxygen fugacity] on the liquid line of descent (LLD) for a primitive shergottite liquid composition (Y98). The results of this study will provide a fundamental basis for reconstructing the record of (f)O2 [oxygen fugacity] in shergottites and other martian basalts, its effect on both mineral chemistries and valence state partitioning, and a means for examining the role of crystallization (and other more complex processes) on the petrologic linkages between olivine-phyric and pyroxene-plagioclase shergottites.

Upgrading CCIR's fo F 2 maps using available ionosondes and genetic algorithms

NASA Astrophysics Data System (ADS)

Gularte, Erika; Carpintero, Daniel D.; Jaen, Juliana

2018-04-01

We have developed a new approach towards a new database of the ionospheric parameter fo F 2 . This parameter, being the frequency of the maximum of the ionospheric electronic density profile and its main modeller, is of great interest not only in atmospheric studies but also in the realm of radio propagation. The current databases, generated by CCIR (Committee Consultative for Ionospheric Radiowave propagation) and URSI (International Union of Radio Science), and used by the IRI (International Reference Ionosphere) model, are based on Fourier expansions and have been built in the 60s from the available ionosondes at that time. The main goal of this work is to upgrade the databases by using new available ionosonde data. To this end we used the IRI diurnal/spherical expansions to represent the fo F 2 variability, and computed its coefficients by means of a genetic algorithm (GA). In order to test the performance of the proposed methodology, we applied it to the South American region with data obtained by RAPEAS (Red Argentina para el Estudio de la Atmósfera Superior, i.e. Argentine Network for the Study of the Upper Atmosphere) during the years 1958-2009. The new GA coefficients provide a global better fit of the IRI model to the observed fo F 2 than the CCIR coefficients. Since the same formulae and the same number of coefficients were used, the overall integrity of IRI's typical ionospheric feature representation was preserved. The best improvements with respect to CCIR are obtained at low solar activities, at large (in absolute value) modip latitudes, and at night-time. The new method is flexible in the sense that can be applied either globally or regionally. It is also very easy to recompute the coefficients when new data is available. The computation of a third set of coefficients corresponding to days of medium solar activity in order to avoid the interpolation between low and high activities is suggested. The same procedure as for fo F 2 can be perfomed to

Development and Release of a GRACE-FO "Grand Simulation" Data Set by JPL

NASA Astrophysics Data System (ADS)

Fahnestock, E.; Yuan, D. N.; Wiese, D. N.; McCullough, C. M.; Harvey, N.; Sakumura, C.; Paik, M.; Bertiger, W. I.; Wen, H. Y.; Kruizinga, G. L. H.

2017-12-01

The GRACE-FO mission, to be launched early in 2018, will require several stages of data processing to be performed within its Science Data System (SDS). In an effort to demonstrate effective implementation and inter-operation of this level 1, 2, and 3 data processing, and to verify its combined ability to recover a truth Earth gravity field to within top-level requirements, the SDS team has performed a system test which it has termed the "Grand Simulation". This process starts with iteration to converge on a mutually consistent integrated truth orbit, non-gravitational acceleration time history, and spacecraft attitude time history, generated with the truth models for all elements of the integrated system (geopotential, both GRACE-FO spacecraft, constellation of GPS spacecraft, etc.). Level 1A data products are generated and then the GPS time to onboard receiver time clock error is introduced into those products according to a realistic truth clock offset model. The various data products are noised according to current best estimate noise models, and then some are used within a precision orbit determination and clock offset estimation/recovery process. Processing from level 1A to level 1B data products uses the recovered clock offset to correct back to GPS time, and performs gap-filling, compression, etc. This exercises nearly all software pathways intended for processing actual GRACE-FO science data. Finally, a monthly gravity field is recovered and compared against the truth background field. In this talk we briefly summarize the resulting performance vs. requirements, and lessons learned in the system test process. Finally, we provide information for use of the level 1B data set by the general community for gravity solution studies and software trials in anticipation of operational GRACE-FO data. ©2016 California Institute of Technology. Government sponsorship acknowledged.

Chemical treatment of commercial reverse osmosis membranes for use in FO

EPA Science Inventory

Commercially available reverse osmosis (RO) membranes – SW30HR, BW30, and AG – were chemically treated for use in forward osmosis (FO). Nitric acid, phosphoric acid, sulfuric acid, ethanol, and ethanol–acid–water ternary solutions were employed for the treatment. All three membra...

NiO and Fe/Mn in Fo-rich olivines from OIB, MORB, and mantle peridotites

NASA Astrophysics Data System (ADS)

Li, H.; Baker, M.; Hofmann, A. E.; Clague, D.; Stolper, E.

2006-12-01

Olivines from mantle peridotites have a narrow range of NiO (0.36±0.03 [1σ] wt%), but NiO of olivines in basalts suggest NiO in mantle olivines is actually more variable: e.g., Hawaiian phenocrysts (Fo>90) have NiO >0.55%, and olivines from continental flood basalts can have >0.5% NiO. At the other end of the spectrum, some basaltic suites (e.g., Iceland, MORBs) have Fo>90 olivines with NiO >0.2%. Partial melting calculations on peridotites show it is difficult to generate liquids that crystallize Fo>90 olivines with >0.4% NiO without resorting to complex processes. Hypotheses to explain the variability of NiO in mantle-derived olivines include (1) reaction of peridotite with silica-rich melts of eclogite results in decreasing modal abundance of olivine and increasing NiO in olivine [1,2]; (2) magmas with NiO-rich olivines come from sources enriched in NiO due to a core-derived component [3]. [4] proposed that high Fe/Mn of Hawaiian vs. Icelandic and MORB lavas reflect a core-derived component in their sources. Possible core incorporation is poorly constrained but FeO and NiO are expected to increase by such processes, leading to correlations between NiO and Fe/Mn in mantle rocks with significant core-derived components. We present high-precision analyses of Fo-rich olivines from OIBs, MORBs, komatiites, and mantle peridotites, focusing on NiO contents and Fe/Mn ratios. Our goal is to test hypotheses to explain elevated NiO of Fo-rich olivines in basalts. Olivines are Fo85.1-93.4; more were analyzed, but we focused on this range to avoid complications due to decreasing NiO in olivine with crystallization. Errors (1σ) are 0.01 wt% in NiO and 1.5 in Fe/Mn (wt). Our data show several features: (1) NiO contents and Fe/Mn ratios of Fo>88 olivines are positively correlated, with the low end of the trend (NiO ~0.23%, Fe/Mn ~61) defined by MORB and Iceland and the high end of the trend (NiO ~0.55%, Fe/Mn ~80) by Reunion and Hawaii. Between these end points, there is a

The FoReVer Methodology: A MBSE Framework for Formal Verification

NASA Astrophysics Data System (ADS)

Baracchi, Laura; Mazzini, Silvia; Cimatti, Alessandro; Tonetta, Stefano; Garcia, Gerald

2013-08-01

The need for high level of confidence and operational integrity in critical space (software) systems is well recognized in the Space industry and has been addressed so far through rigorous System and Software Development Processes and stringent Verification and Validation regimes. The Model Based Space System Engineering process (MBSSE) derived in the System and Software Functional Requirement Techniques study (SSFRT) focused on the application of model based engineering technologies to support the space system and software development processes, from mission level requirements to software implementation through model refinements and translations. In this paper we report on our work in the ESA-funded FoReVer project where we aim at developing methodological, theoretical and technological support for a systematic approach to the space avionics system development, in phases 0/A/B/C. FoReVer enriches the MBSSE process with contract-based formal verification of properties, at different stages from system to software, through a step-wise refinement approach, with the support for a Software Reference Architecture.

The Effect of fO2 on Partition Coefficients of U and Th between Garnet and Silicate Melt

NASA Astrophysics Data System (ADS)

Huang, F.; He, Z.; Schmidt, M. W.; Li, Q.

2014-12-01

Garnet is one of the most important minerals controlling partitioning of U and Th in the upper mantle. U is redox sensitive, while Th is tetra-valent at redox conditions of the silicate Earth. U-series disequilibria have provided a unique tool to constrain the time-scales and processes of magmatism at convergent margins. Variation of garnet/meltDU/Th with fO2 is critical to understand U-series disequilibria in arc lavas. However, there is still no systematic experimental study about the effect of fO2 on partitioning of U and Th between garnet and melt. Here we present experiments on partitioning of U, Th, Zr, Hf, Nb, Ta, and REE between garnet and silicate melts at various fO2. The starting material was hydrous haplo-basalt. The piston cylinder experiments were performed with Pt double capsules with C-CO, MnO-Mn3O4 (MM), and hematite-magnetite (HM) buffers at 3 GPa and 1185-1230 oC. The experiments produced garnets with diameters > 50μm and quenched melt. Major elements were measured by EMPA at ETH Zurich. Trace elements were determined using LA-ICP-MS at Northwestern University (Xi'an, China) and SIMS (Cameca1280 at the Institute of Geology and Geophysics, Beijing, China), producing consistent partition coefficient data for U and Th. With fO2 increasing from CCO to MM and HM, garnet/meltDU decreases from 0.041 to 0.005, while garnet/meltDTh ranges from 0.003 to 0.007 without correlation with fO2. Notably, garnet/meltDTh/U increases from 0.136 at CCO to 0.41 at HM. Our results indicate that U is still more compatible than Th in garnet even at the highest fO2 considered for the subarc mantle wedge (~NNO). Therefore, we predict that if garnet is the dominant phase controlling U-Th partitioning during melting of the mantle wedge, melts would still have 230Th excess over 238U. This explains why most young continental arc lavas have 230Th excess. If clinopyroxene is the dominant residual phase during mantle melting, U could be more incompatible than Th at high fO2

The inhibition of the mitochondrial F1FO-ATPase activity when activated by Ca2+ opens new regulatory roles for NAD.

PubMed

Nesci, Salvatore; Trombetti, Fabiana; Ventrella, Vittoria; Pirini, Maurizio; Pagliarani, Alessandra

2018-01-26

The mitochondrial F1FO-ATPase is uncompetitively inhibited by NAD+ only when the natural cofactor Mg2+ is replaced by Ca2+, a mode putatively involved in cell death. The Ca2+-dependent F1FO-ATPase is also inhibited when NAD+ concentration in mitochondria is raised by acetoacetate. The enzyme inhibition by NAD+ cannot be ascribed to any de-ac(et)ylation or ADP-ribosylation by sirtuines, as it is not reversed by nicotinamide. Moreover, the addition of acetyl-CoA or palmitate, which would favor the enzyme ac(et)ylation, does not affect the F1FO-ATPase activity. Consistently, NAD+ may play a new role, not associated with redox and non-redox enzymatic reactions, in the Ca2+-dependent regulation of the F1FO-ATPase activity.

FirefOx Design Reference fO2 Sensor for Hot, Deep Atmospheres

NASA Astrophysics Data System (ADS)

Izenberg, N.; Papadakis, S.; Deglau, D.; Francomacaro, A. S.

2016-12-01

Understanding the composition of the lowest portion of Venus' atmosphere is critical to knowing the stable mineralogy of the rocks there. Oxygen gas is a critical trace component, with fugacity, or partial pressure, estimated in the range of 10-19 to 10-22 from early probe measurements down to 22km altitude (Pioneer Venus, Venera), chemical equilibrium measurements, and other modeling. "FirefOx" is a simple oxygen fugacity sensor with the express purpose of determining the partial pressure of oxygen in the lowest scale heights of the Venus atmosphere, and especially the lowest hundreds of meters; the surface atmosphere interface, where the atmosphere and surface move to thermodynamic equilibrium. Knowledge of the fO2 at the surface atmosphere interface is crucial to determining the stable mineralogy of surface materials (e.g. magnetite vs. hematite) and gas chemistry in the near-surface atmosphere FirefOx is a Metal/Metal Oxide oxygen fugacity sensor intended to be mounted on the outside of a Venus descent probe, with electronics housed inside a thermally controlled environment. The sole sensor capability is the precise, accurate detection of the partial pressure of oxygen gas (fO2) in the near-surface environment of Venus, at up to 95-bar pressure (predominantly CO2. Surface temperatures at mean planetary elevation are near 735 K, thus a required operational temperature range of 710-740 K covers a range of near-surface elevations. FirefOx system requirements are low ( 100-200 grams, mass, milliwatt power, several kilobytes total science data). A design reference sensor, composed of custom, Yittria-ZrO ceramic electrolyte, with an encapsulated Pd/PdO standard and patterned Pt electrodes has demonstrated scientifically useful signal-to-noise millivolt level potential at temperatures as low as 620 K, relatable to fO2 by a Nernst equation E = RT/4F ln(PO2/PrefO2) where E = open circuit potential across the sensor electrolyte, R = universal gas constant, T

Advanced oxidation of biorefractory organics in aqueous solution together with bioelectricity generation by microbial fuel cells with composite FO/GPEs

NASA Astrophysics Data System (ADS)

Fu, Bao-rong; Shen, Chao; Ren, Jing; Chen, Jia-yi; Zhao, Lin

2018-03-01

In this study, ferric oxide loading graphite particle electrodes (FO/GPEs) were prepared as cathode of a three-dimensional electrode MFC-Fenton system. The properties of the composite cathode were examined with higher surface area and more mesopores. FO/GPEs could work as both cathode and Fenton iron reagents, contributing to high oxidation activity and better performance of electricity generation. The application of FO/GPEs MFC-Fenton system on degrading p-nitrophenol presented high catalytic efficiency in a wide range of pH value. The removal of p-nitrophenol and TOC attained to about 85 % within 8 and 64 h at neutral pH, respectively. A neutral FO/GPEs MFC-Fenton oxidation mechanism was also proposed. Specifically, both the surface iron sites and dissolved iron ions catalyzed the decomposition of H2O2. As results, the generated hydroxyl radicals were used for p-nitrophenol degradation and the iron oxide was recycled.

Status and prospect of the Swiss continuous Cs fountain FoCS-2

NASA Astrophysics Data System (ADS)

Jallageas, A.; Devenoges, L.; Petersen, M.; Morel, J.; Bernier, L.-G.; Thomann, P.; Südmeyer, T.

2016-06-01

The continuous cesium fountain clock FoCS-2 at METAS presents many unique characteristics and challenges in comparison with standard pulsed fountain clocks. For several years FoCS-2 was limited by an unexplained frequency sensitivity on the velocity of the atoms, in the range of 140 • 10-15. Recent experiments allowed us to identify the origin of this problem as undesirable microwave surface currents circulating on the shield of the coaxial cables that feed the microwave cavity. A strong reduction of this effect was obtained by adding microwave absorbing coatings on the coaxial cables and absorbers inside of the vacuum chamber. This breakthrough opens the door to a true metrological validation of the fountain. A series of simulation tools have already been developed and proved their efficiency in the evaluation of some of the uncertainties of the continuous fountain. With these recent improvements, we are confident in the future demonstration of an uncertainty budget at the 10-15 level and below.

The Cr Redox Record of fO2 Variation in Angrites. Evidence for Redox Conditions of Angrite Petrogenesis and Parent Body

NASA Technical Reports Server (NTRS)

Shearer, Charles K.; Bell, Aaron S.; Burger, Paul V.; Papike, James J.; Jones, John; Le, Loan

2016-01-01

Angrites represent some of the earliest stages of planetesimal differentiation. Not surprisingly, there is no simple petrogenetic model for their origin. Petrogenesis has been linked to both magmatic and impact processes. Studies demonstrated that melting of chondritic material (e.g. CM, CV) at redox conditions where pure iron metal is unstable (e.g., IW+1 to IW+2) produced angrite-like melts. Alternatively, angrites were produced at more reducing conditions (fO2 plays in producing angrite magmas is critical for deciphering their petrogenesis and extending our understanding of primordial melting of asteroids. Calculations for the fO2 conditions of angrite crystallization are limited, and only preliminary attempts been made to understand the changes in fO2 that occurred during petrogenesis. Many of the angrites have phase assemblages which provide conflicting signals about redox conditions during crystallization (e.g., Fe metal and a Fe-Ti oxide with potential Fe3+. There have been several estimates of fO2 for angrites. Most notably, experiments examined the variation of DEu/DGd with fO2, between plagioclase and fassaitic pyroxene in equilibrium with an angrite melt composition. They used their observations to estimate the fO2 of crystallization to be approximately IW+0.6 for angrite LEW 86010. This estimate is only a "snapshot" of fO2 conditions during co-crystallization of plagioclase and pyroxene. Preliminary XANES analyses of V redox state in pyroxenes from D'Orbigny reported changes in fO2 from IW-0.7 during early pyroxene crystallization to IW+0.5 during latter episodes of pyroxene crystallization [15]. As this was a preliminary report, it presented limited information concerning the effects of pyroxene orientation and composition on the V valence measurements, and the effect of melt composition on valence and

New Evidence That Nonlinear Source-Filter Coupling Affects Harmonic Intensity and fo Stability During Instances of Harmonics Crossing Formants.

PubMed

Maxfield, Lynn; Palaparthi, Anil; Titze, Ingo

2017-03-01

The traditional source-filter theory of voice production describes a linear relationship between the source (glottal flow pulse) and the filter (vocal tract). Such a linear relationship does not allow for nor explain how changes in the filter may impact the stability and regularity of the source. The objective of this experiment was to examine what effect unpredictable changes to vocal tract dimensions could have on fo stability and individual harmonic intensities in situations in which low frequency harmonics cross formants in a fundamental frequency glide. To determine these effects, eight human subjects (five male, three female) were recorded producing fo glides while their vocal tracts were artificially lengthened by a section of vinyl tubing inserted into the mouth. It was hypothesized that if the source and filter operated as a purely linear system, harmonic intensities would increase and decrease at nearly the same rates as they passed through a formant bandwidth, resulting in a relatively symmetric peak on an intensity-time contour. Additionally, fo stability should not be predictably perturbed by formant/harmonic crossings in a linear system. Acoustic analysis of these recordings, however, revealed that harmonic intensity peaks were asymmetric in 76% of cases, and that 85% of fo instabilities aligned with a crossing of one of the first four harmonics with the first three formants. These results provide further evidence that nonlinear dynamics in the source-filter relationship can impact fo stability as well as harmonic intensities as harmonics cross through formant bandwidths. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

New isochromophilones VII and VIII produced by Penicillium sp. FO-4164.

PubMed

Yang, D J; Tomoda, H; Tabata, N; Masuma, R; Omura, S

1996-03-01

New isochromophilones VII and VIII were isolated from the culture broth of Penicillium sp. FO-4164. The structures were elucidated as 6H-2-benzopyran-6,8(7H)-dione, 5-chloro-3-(3',5'-dimethyl-1',3'-heptadienyl)-1,7,8a-trihydro-7, 8a-dihydroxy-7-methyl-7-acetate for isochromophilone VII and 6H-2-benzopyran-6-one,5-chloro-3-(3',5'-dimethyl-1', 3'-heptadienyl)-1,7,8,8a-tetrahydro-7,8-dihydroxy-7-methyl-8-acetate for isochromophilone VIII. Isochromophilones VII and VIII inhibited diacylglycerol acyltransferase activity with IC50 values of 20.0 and 127 microM and acyl-CoA: cholesterol acyltransferase activity with IC50 values of 24.5 and 47.0 microM, respectively.

A natural driven membrane process for brackish and wastewater treatment: photovoltaic powered ED and FO hybrid system.

PubMed

Zhang, Yang; Pinoy, Luc; Meesschaert, Boudewijn; Van der Bruggen, Bart

2013-09-17

In isolated locations, remote areas, or islands, potable water is precious because of the lack of drinking water treatment facilities and energy supply. Thus, a robust and reliable water treatment system based on natural energy is needed to reuse wastewater or to desalinate groundwater/seawater for provision of drinking water. In this work, a hybrid membrane system combining electrodialysis (ED) and forward osmosis (FO), driven by renewable energy (solar energy), denoted as EDFORD (ED-FO Renewable energy Desalination), is proposed to produce high-quality water (potable) from secondary wastewater effluent or brackish water. In this hybrid membrane system, feedwater (secondary wastewater effluent or synthetic brackish water) was drawn to the FO draw solution while the organic and inorganic substances (ions, compounds, colloids and particles) were rejected. The diluted draw solution was then pumped to the solar energy driven ED. In the ED unit, the diluted draw solution was desalted and high-quality water was produced; the concentrate was recycled to the FO unit and reused as the draw solution. Results show that the water produced from this system contains a low concentration of total organic carbon (TOC), carbonate, and cations derived from the feedwater; had a low conductivity; and meets potable water standards. The water production cost considering the investment for membranes and solar panel is 3.32 to 4.92 EUR m(-3) (for 300 days of production per year) for a small size potable water production system.

Extensible Stylesheet Language Formatting Objects (XSL-FO): a tool to transform patient data into attractive clinical reports.

PubMed

Simonaitis, Linas; Belsito, Anne; Warvel, Jeff; Hui, Siu; McDonald, Clement J

2006-01-01

Clinicians at Wishard Hospital in Indianapolis print and carry clinical reports called "Pocket Rounds". This paper describes a new process we developed to improve these clinical reports. The heart of our new process is a World Wide Web Consortium standard: Extensible Stylesheet Language Formatting Objects (XSL-FO). Using XSL-FO stylesheets we generated Portable Document Format (PDF) and PostScript reports with complex formatting: columns, tables, borders, shading, indents, dividing lines. We observed patterns of clinical report printing during a eight month study period on three Medicine wards. Usage statistics indicated that clinicians accepted the new system enthusiastically: 78% of 26,418 reports were printed using the new system. We surveyed 67 clinical users. Respondents gave the new reports a rating of 4.2 (on a 5 point scale); they gave the old reports a rating of 3.4. The primary complaint was that it took longer to print the new reports. We believe that XSL-FO is a promising way to transform text data into functional and attractive clinical reports: relatively easy to implement and modify.

Monitoring transient elastic energy storage within the rotary motors of single FoF1-ATP synthase by DCO-ALEX FRET

NASA Astrophysics Data System (ADS)

Ernst, Stefan; Düser, Monika G.; Zarrabi, Nawid; Börsch, Michael

2012-03-01

The enzyme FoF1-ATP synthase provides the 'chemical energy currency' adenosine triphosphate (ATP) for living cells. Catalysis is driven by mechanochemical coupling of subunit rotation within the enzyme with conformational changes in the three ATP binding sites. Proton translocation through the membrane-bound Fo part of ATP synthase powers a 10-step rotary motion of the ring of c subunits. This rotation is transmitted to the γ and ɛ subunits of the F1 part. Because γ and ɛ subunits rotate in 120° steps, we aim to unravel this symmetry mismatch by real time monitoring subunit rotation using single-molecule Förster resonance energy transfer (FRET). One fluorophore is attached specifically to the F1 motor, another one to the Fo motor of the liposome-reconstituted enzyme. Photophysical artifacts due to spectral fluctuations of the single fluorophores are minimized by a previously developed duty cycle-optimized alternating laser excitation scheme (DCO-ALEX). We report the detection of reversible elastic deformations between the rotor parts of Fo and F1 and estimate the maximum angular displacement during the load-free rotation using Monte Carlo simulations.

Ecotoxicological evaluation of three deicers (NaCl, NaFo, CMA)-effect on terrestrial organisms.

PubMed

Robidoux, P Y; Delisle, C E

2001-02-01

The use of chemical deicers such as sodium chloride (NaCl) has increased significantly during the past three decades. Deicers induce metal corrosion and alter the physicochemical properties of soils and water. Environmental damage caused by the use of NaCl has prompted government agencies to find alternative deicers. This article presents a comparative ecotoxicological study of three deicers on soil organisms. Sodium formiate (NaFo) and calcium-magnesium acetate (CMA) are the most interesting commercially available deicers based upon their characteristics and potential toxicity. Organisms used in this study were four species of macrophytes (cress (Lepidium sativum), barley (Ordeum vulgare), red fescue grass (Festuca rubra), Kentucky bluegrass (Poa pratensis)) and an invertebrate (Eisenia fetida). Using standardized and modified methods, the relative toxicity of deicers was CMA < NaFo congruent with NaCl. The results demonstrate that these chemicals could have similar impacts in terrestrial environments since similar quantities of NaFo and greater amounts of CMA are necessary to achieve the same efficiency as NaCl. The toxicity of the tested substances was lower in natural composted soil than in artificial substrate (silica or OECD soil), indicating decreased environmental bioavailability. The response of the organisms changed according to endpoint, species, and soil characteristics (artificial substrate as compared to natural organic soil). The most sensitive endpoint measured was macrophyte growth with Kentucky bluegrass being the most sensitive species. Copyright 2001 Academic Press.

40 CFR 721.1550 - Benzenediazonium, 4-(di-methyl-amino)-, salt with 2-hy-droxy-5-sul-fo-benzoic acid (1:1).

Code of Federal Regulations, 2011 CFR

2011-07-01

...-amino)-, salt with 2-hy-droxy-5-sul-fo-benzoic acid (1:1). (a) Chemical substance and significant new... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Benzenediazonium, 4-(di-methyl-amino)-, salt with 2-hy-droxy-5-sul-fo-benzoic acid (1:1). 721.1550 Section 721.1550 Protection of Environment...

Functional characterization of the gene FoOCH1 encoding a putative α-1,6-mannosyltransferase in Fusarium oxysporum f. sp. cubense.

PubMed

Li, Min-Hui; Xie, Xiao-Ling; Lin, Xian-Feng; Shi, Jin-Xiu; Ding, Zhao-Jian; Ling, Jin-Feng; Xi, Ping-Gen; Zhou, Jia-Nuan; Leng, Yueqiang; Zhong, Shaobin; Jiang, Zi-De

2014-04-01

Fusarium oxysporum f. sp. cubense (FOC) is the causal agent of banana Fusarium wilt and has become one of the most destructive pathogens threatening the banana production worldwide. However, few genes related to morphogenesis and pathogenicity of this fungal pathogen have been functionally characterized. In this study, we identified and characterized the disrupted gene in a T-DNA insertional mutant (L953) of FOC with significantly reduced virulence on banana plants. The gene disrupted by T-DNA insertion in L953 harbors an open reading frame, which encodes a protein with homology to α-1,6-mannosyltransferase (OCH1) in fungi. The deletion mutants (ΔFoOCH1) of the OCH1 orthologue (FoOCH1) in FOC were impaired in fungal growth, exhibited brighter staining with fluorescein isothiocyanate (FITC)-Concanavalin A, had less cell wall proteins and secreted more proteins into liquid media than the wild type. Furthermore, the mutation or deletion of FoOCH1 led to loss of ability to penetrate cellophane membrane and decline in hyphal attachment and colonization as well as virulence to the banana host. The mutant phenotypes were fully restored by complementation with the wild type FoOCH1 gene. Our data provide a first evidence for the critical role of FoOCH1 in maintenance of cell wall integrity and virulence of F. oxysporum f. sp. cubense. Copyright © 2014 Elsevier Inc. All rights reserved.

The ASCA PV phase observation of FO Aquarii

NASA Technical Reports Server (NTRS)

Mukai, Koji; Ishida, Manabu; Osborne, Julian P.

1994-01-01

We report on a approximately 1-day Advanced Satellite for Cosmology and Astrophysics (ASCA) observation of the intermediate polar FO Aquarii. We find two distinctive spectral components, one unabsorbed and the other strongly absorbed; the observed 2-10 keV flux severely underestimates the total system luminosity, due to this strong absorption intrinsic to the binary. The absorbed component is dominant in terms of luminosity, and its light curve is simple. The unabsorbed component accounts for approximately 2% of the luminosity, and shows a much more complicated light curve. As the dominant component predominantly shows a sinusoidal modulation at the white dwarf spin period, it provides a strong evidence for a partial accretion disk in the system.

Effect of fO2 on phase relationship in basaltic andesites during magmatic differentiation: Control of fO2 and sulphur speciation in piston cylinder experiments.

NASA Astrophysics Data System (ADS)

Matjuschkin, Vladimir; Tattitch, Brian; Blundy, Jonathan D.; Skora, Susanne

2014-05-01

Within the mantle wedge above subduction zones, oxidation reaction take place by interaction of reduced mantle rocks with more oxidized, hydrous fluids, which can cause a local drop of the solidus, resulting in partial melting (2,6,7). The resultant melts are more oxidized that their ocean floor counterparts, which has implications for their subsequent differentiation paths, the speciation of multivalent elements and the solubility and transport of chemical compounds in magmatic systems (1,4,5). We present a series of sulphur-doped high-pressure experiments conducted to investigate the effect of oxygen fugacity on phase relationships and the behaviour of sulphur in silicate melts. Natural aphyric andesite (FM37) erupted from Laguna del Maule volcano, Chile (3) was selected as a starting composition. Experiments were carried out at 5kbar, 950-1150° C and variable oxygen fugacity conditions. New experiments buffered at Co-CoO and Ni-NiO buffer conditions have been performed using a new "MTB capsule design" developed in order to accurately control fO2 by means of a double capsule containing metal-oxide buffers and a pyrex sleeve to minimise H2 diffusion. This new design constrains oxygen fugacity to within ±0.1-0.2logfO2 units of the target value. Before conducting these experiments, the assemblage was tested multiple times at 10kbar, 1000° C over 24-48 hours and demonstrated consistent, accurate fO2 control. Analyses of the preliminary experimental run products, from a related Chilean basaltic andesite starting composition, demonstrate a clear effect of fO2 on phase relationships and the proportion of melt generated during experiments. Under oxidized conditions, as temperature decreased from 1150° C to 1050° C, the amount of melt decreased from 100% to ~80%, due to the formation of orthopyroxene, anhydrite and plagioclase. In contrast, in reduced runs the system remains nearly liquid (~5% crystals) down to 950° C due to the change in sulphur speciation and

Inhibition of ATP Hydrolysis by Thermoalkaliphilic F1Fo-ATP Synthase Is Controlled by the C Terminus of the ɛ Subunit

PubMed Central

Keis, Stefanie; Stocker, Achim; Dimroth, Peter; Cook, Gregory M.

2006-01-01

The F1Fo-ATP synthases of alkaliphilic bacteria exhibit latent ATPase activity, and for the thermoalkaliphile Bacillus sp. strain TA2.A1, this activity is intrinsic to the F1 moiety. To study the mechanism of ATPase inhibition, we developed a heterologous expression system in Escherichia coli to produce TA2F1 complexes from this thermoalkaliphile. Like the native F1Fo-ATP synthase, the recombinant TA2F1 was blocked in ATP hydrolysis activity, and this activity was stimulated by the detergent lauryldimethylamine oxide. To determine if the C-terminal domain of the ɛ subunit acts as an inhibitor of ATPase activity and if an electrostatic interaction plays a role, a TA2F1 mutant with either a truncated ɛ subunit [i.e., TA2F1(ɛΔC)] or substitution of basic residues in the second α-helix of ɛ with nonpolar alanines [i.e., TA2F1(ɛ6A)] was constructed. Both mutants showed ATP hydrolysis activity at low and high concentrations of ATP. Treatment of the purified F1Fo-ATP synthase and TA2F1(ɛWT) complex with proteases revealed that the ɛ subunit was resistant to proteolytic digestion. In contrast, the ɛ subunit of TA2F1(ɛ6A) was completely degraded by trypsin, indicating that the C-terminal arm was in a conformation where it was no longer protected from proteolytic digestion. In addition, ATPase activity was not further activated by protease treatment when compared to the untreated control, supporting the observation that ɛ was responsible for inhibition of ATPase activity. To study the effect of the alanine substitutions in the ɛ subunit in the entire holoenzyme, we reconstituted recombinant TA2F1 complexes with F1-stripped native membranes of strain TA2.A1. The reconstituted TA2FoF1(ɛWT) was blocked in ATP hydrolysis and exhibited low levels of ATP-driven proton pumping consistent with the F1Fo-ATP synthase in native membranes. Reconstituted TA2FoF1(ɛ6A) exhibited ATPase activity that correlated with increased ATP-driven proton pumping, confirming that the �

Ionospheric foF2 at EIA region: comparison between observations and IRI model

NASA Astrophysics Data System (ADS)

Chuo, Y. J.; Lee, C. C.

We have used data from an equatorial ionization anomaly area station in the western Pacific region to study the monthly variability of foF2 Diurnal seasonal and solar activity effects were investigated The data established by this study are proposed as valid input values for the development of URSI and CCIR options for the International Reference Ionosphere

The FOAM study: is Hysterosalpingo foam sonography (HyFoSy) a cost-effective alternative for hysterosalpingography (HSG) in assessing tubal patency in subfertile women? Study protocol for a randomized controlled trial.

PubMed

van Rijswijk, Joukje; van Welie, Nienke; Dreyer, Kim; van Hooff, Machiel H A; de Bruin, Jan Peter; Verhoeve, Harold R; Mol, Femke; Kleiman-Broeze, Kimiko A; Traas, Maaike A F; Muijsers, Guido J J M; Manger, Arentje P; Gianotten, Judith; de Koning, Cornelia H; Koning, Aafke M H; Bayram, Neriman; van der Ham, David P; Vrouenraets, Francisca P J M; Kalafusova, Michaela; van de Laar, Bob I G; Kaijser, Jeroen; van Oostwaard, Miriam F; Meijer, Wouter J; Broekmans, Frank J M; Valkenburg, Olivier; van der Voet, Lucy F; van Disseldorp, Jeroen; Lambers, Marieke J; Peters, Henrike E; Lier, Marit C I; Lambalk, Cornelis B; van Wely, Madelon; Bossuyt, Patrick M M; Stoker, Jaap; van der Veen, Fulco; Mol, Ben W J; Mijatovic, Velja

2018-05-09

Tubal pathology is a causative factor in 20% of subfertile couples. Traditionally, tubal testing during fertility work-up is performed by hysterosalpingography (HSG). Hysterosalpingo-foam sonography (HyFoSy) is a new technique that is thought to have comparable accuracy as HSG, while it is less expensive and more patient friendly. HyFoSy would be an acceptable alternative for HSG, provided it has similar effectiveness in terms of patient outcomes. We aim to compare the effectiveness and costs of management guided by HyFoSy or by HSG. Consenting women will undergo tubal testing by both HyFoSy and HSG in a randomized order during fertility work-up. The study group will consist of 1163 subfertile women between 18 and 41 years old who are scheduled for tubal patency testing during their fertility work-up. Women with anovulatory cycles not responding to ovulation induction, endometriosis, severe male subfertility or a known contrast (iodine) allergy will be excluded. We anticipate that 7 % (N = 82) of the participants will have discordant test results for HyFoSy and HSG. These participants will be randomly allocated to either a management strategy based on HyFoSy or a management strategy based on HSG, resulting in either a diagnostic laparoscopy with chromopertubation or a strategy that assumes tubal patency (intrauterine insemination or expectant management). The primary outcome is ongoing pregnancy leading to live birth within 12 months after randomization. Secondary outcomes are patient pain scores, time to pregnancy, clinical pregnancy, miscarriage rate, multiple pregnancy rate, preterm birth rate and number of additional treatments. Costs will be estimated by counting resource use and calculating unit prices. This trial will compare the effectiveness and costs of HyFoSy versus HSG in assessing tubal patency in subfertile women. Dutch Trial Register (NTR 4746, http://www.trialregister.nl ). Date of registration: 19 August 2014.

Modeling ionospheric foF 2 response during geomagnetic storms using neural network and linear regression techniques

NASA Astrophysics Data System (ADS)

Tshisaphungo, Mpho; Habarulema, John Bosco; McKinnell, Lee-Anne

2018-06-01

In this paper, the modeling of the ionospheric foF 2 changes during geomagnetic storms by means of neural network (NN) and linear regression (LR) techniques is presented. The results will lead to a valuable tool to model the complex ionospheric changes during disturbed days in an operational space weather monitoring and forecasting environment. The storm-time foF 2 data during 1996-2014 from Grahamstown (33.3°S, 26.5°E), South Africa ionosonde station was used in modeling. In this paper, six storms were reserved to validate the models and hence not used in the modeling process. We found that the performance of both NN and LR models is comparable during selected storms which fell within the data period (1996-2014) used in modeling. However, when validated on storm periods beyond 1996-2014, the NN model gives a better performance (R = 0.62) compared to LR model (R = 0.56) for a storm that reached a minimum Dst index of -155 nT during 19-23 December 2015. We also found that both NN and LR models are capable of capturing the ionospheric foF 2 responses during two great geomagnetic storms (28 October-1 November 2003 and 6-12 November 2004) which have been demonstrated to be difficult storms to model in previous studies.

Spread-F occurrences and relationships with foF2 and h'F at low- and mid-latitudes in China

NASA Astrophysics Data System (ADS)

Wang, Ning; Guo, Lixin; Zhao, Zhenwei; Ding, Zonghua; Lin, Leke

2018-04-01

Ionospheric irregularities are an important phenomenon in scientific studies and applications of radio-wave propagation. Spread-F echoes in ionograms are a type of high-frequency band irregularities that include frequency spread-F (FSF), range spread-F (RSF), and mixed spread-F (MSF) events. In this study, we obtained spread-F data from four ionosondes at low- and mid-latitudes near the 120°E chain in China during the 23rd solar cycle. We used these data to investigate spread-F occurrence percentages and variations with local time, season, latitude, and solar activity. The four ionosondes were located at Haikou (HK) (20°N, 110.34°E), Guangzhou (GZ) (23.14°N, 113.36°E), Beijing (BJ) (40.11°N, 116.28°E), and Changchun (CC) (43.84°N, 125.28°E). We also present possible correlations between spread-Fs and other ionospheric parameters, such as the critical frequency of the F2-layer (foF2) and the virtual height of the bottom-side F-layer (h'F). In particular, we investigated the possible threshold of the foF2 affecting the FSF and the relationship between the h'F and the RSF. The main conclusions are as follows: (a) the FSF occurrence percentages were anti-correlated with solar activity at all four sites; meanwhile, RSF occurrence rates increased with the increase in solar activity at HK, but not at the other three sites; (b) FSF occurrence rates were larger at the mid-latitudes than expected, while FSFs occurred more often after midnight; (c) the highest FSF occurrence rates mostly appeared during the summer months, while RSFs occurred mostly in the equinoctial months of 2000-2002 at HK and GZ; (d) a lower foF2 was suitable for FSF events; nevertheless, h'F and RSF occurrences satisfied the parabolic relationship; (e) the foF2 thresholds for FSFs were 15, 14, 7.6, and 7.8 MHz at HK, GZ, BJ, and CC, respectively. The h'Fs occurring between 240 and 290 km were more favorable for RSF occurrences. These results are important for understanding ionospheric

FoCa: a modular treatment planning system for proton radiotherapy with research and educational purposes

NASA Astrophysics Data System (ADS)

Sánchez-Parcerisa, D.; Kondrla, M.; Shaindlin, A.; Carabe, A.

2014-12-01

FoCa is an in-house modular treatment planning system, developed entirely in MATLAB, which includes forward dose calculation of proton radiotherapy plans in both active and passive modalities as well as a generic optimization suite for inverse treatment planning. The software has a dual education and research purpose. From the educational point of view, it can be an invaluable teaching tool for educating medical physicists, showing the insights of a treatment planning system from a well-known and widely accessible software platform. From the research point of view, its current and potential uses range from the fast calculation of any physical, radiobiological or clinical quantity in a patient CT geometry, to the development of new treatment modalities not yet available in commercial treatment planning systems. The physical models in FoCa were compared with the commissioning data from our institution and show an excellent agreement in depth dose distributions and longitudinal and transversal fluence profiles for both passive scattering and active scanning modalities. 3D dose distributions in phantom and patient geometries were compared with a commercial treatment planning system, yielding a gamma-index pass rate of above 94% (using FoCa’s most accurate algorithm) for all cases considered. Finally, the inverse treatment planning suite was used to produce the first prototype of intensity-modulated, passive-scattered proton therapy, using 13 passive scattering proton fields and multi-leaf modulation to produce a concave dose distribution on a cylindrical solid water phantom without any field-specific compensator.

Binding of the immunomodulatory drug Bz-423 to mitochondrial FoF1-ATP synthase in living cells by FRET acceptor photobleaching

NASA Astrophysics Data System (ADS)

Starke, Ilka; Johnson, Kathryn M.; Petersen, Jan; Gräber, Peter; Opipari, Anthony W.; Glick, Gary D.; Börsch, Michael

2016-03-01

Bz-423 is a promising new drug for treatment of autoimmune diseases. This small molecule binds to subunit OSCP of the mitochondrial enzyme FoF1-ATP synthase and modulates its catalytic activities. We investigate the binding of Bz-423 to mitochondria in living cells and how subunit rotation in FoF1-ATP synthase, i.e. the mechanochemical mechanism of this enzyme, is affected by Bz-423. Therefore, the enzyme was marked selectively by genetic fusion with the fluorescent protein EGFP to the C terminus of subunit γ. Imaging the threedimensional arrangement of mitochondria in living yeast cells was possible at superresolution using structured illumination microscopy, SIM. We measured uptake and binding of a Cy5-labeled Bz-423 derivative to mitochondrial FoF1-ATP synthase in living yeast cells using FRET acceptor photobleaching microscopy. Our data confirmed the binding of Cy5-labeled Bz-423 to the top of the F1 domain of the enzyme in mitochondria of living Saccharomyces cerevisiae cells.

Social Media Use and the Fear of Missing out (FoMO) While Studying Abroad

ERIC Educational Resources Information Center

Hetz, Patricia R.; Dawson, Christi L.; Cullen, Theresa A.

2015-01-01

Fear of Missing Out (FoMO) is a social construct that examines whether students are concerned that they are missing out on experiences that others are having, and we examined this relation to their concerns over missing activities in their home culture. This mixed-methods pilot study sought to determine how social media affects the study abroad…

Observing single FoF1-ATP synthase at work using an improved fluorescent protein mNeonGreen as FRET donor

NASA Astrophysics Data System (ADS)

Heitkamp, Thomas; Deckers-Hebestreit, Gabriele; Börsch, Michael

2016-02-01

Adenosine triphosphate (ATP) is the universal chemical energy currency for cellular activities provided mainly by the membrane enzyme FoF1-ATP synthase in bacteria, chloroplasts and mitochondria. Synthesis of ATP is accompanied by subunit rotation within the enzyme. Over the past 15 years we have developed a variety of single-molecule FRET (smFRET) experiments to monitor catalytic action of individual bacterial enzymes in vitro. By specifically labeling rotating and static subunits within a single enzyme we were able to observe three-stepped rotation in the F1 motor, ten-stepped rotation in the Fo motor and transient elastic deformation of the connected rotor subunits. However, the spatial and temporal resolution of motor activities measured by smFRET were limited by the photophysics of the FRET fluorophores. Here we evaluate the novel FRET donor mNeonGreen as a fusion to FoF1-ATP synthase and compare it to the previously used fluorophore EGFP. Topics of this manuscript are the biochemical purification procedures and the activity measurements of the fully functional mutant enzyme.

Variations of the critical foE-frequency of the ionosphere connected with earthquakes. Evaluation of observations of the vertical sounding station "Tokyo"

NASA Astrophysics Data System (ADS)

Liperovskaya, Elena V.; Meister, Claudia-Veronika; Hoffmann, Dieter H. H.; Silina, Alexandra S.

2016-04-01

In the present work the critical frequencies foE and foF2 of the ionosphere are considered as possible earthquake precursors. The statistical analysis of the critical frequencies is carried out based on the data of the vertical sounding station (VSS) "Kokubunji" ("Tokyo") (ϕ = 35.7o N, λ = 139.5o E, 1957-1988) obtained every hour. Disturbances are considered on the background of seasonal, geomagnetic as well as 11-years and 27-days Solar variations. Special normalized parameters E and F are introduced, which represent the almost seasonal-independent parts of foE and foF2. Days with high Solar (Wolf number > 100) and geomagnetic (ΣKp > 25) activities are excluded from the analysis. For all data (observed every hour) analysed, no correlations of the normalized parameters E and F are found. One day before the seismic shock, a positive correlation is observed. The superimposed epochs method is used to determine the temporal behaviour of E and F. It is found that E and F decrease one day before the earthquakes provided that the seismic shocks occur at distances 600 < R < 1000 km from the VSS, and that the focus of earthquakes with magnitudes M > 5.5 is situated at depths smaller than 60 km. The reliability of the effect is larger than 98 %. Possible physical mechanisms of the phenomenon are discussed.

Simultaneous monitoring of the two coupled motors of a single FoF1-ATP synthase by three-color FRET using duty cycle-optimized triple-ALEX

NASA Astrophysics Data System (ADS)

Zarrabi, N.; Ernst, S.; Düser, M. G.; Golovina-Leiker, A.; Becker, W.; Erdmann, R.; Dunn, S. D.; Börsch, M.

2009-02-01

FoF1-ATP synthase is the enzyme that provides the 'chemical energy currency' adenosine triphosphate, ATP, for living cells. The formation of ATP is accomplished by a stepwise internal rotation of subunits within the enzyme. Briefly, proton translocation through the membrane-bound Fo part of ATP synthase drives a 10-step rotary motion of the ring of c subunits with respect to the non-rotating subunits a and b. This rotation is transmitted to the γ and ɛ subunits of the F1 sector resulting in 120° steps. In order to unravel this symmetry mismatch we monitor subunit rotation by a single-molecule fluorescence resonance energy transfer (FRET) approach using three fluorophores specifically attached to the enzyme: one attached to the F1 motor, another one to the Fo motor, and the third one to a non-rotating subunit. To reduce photophysical artifacts due to spectral fluctuations of the single fluorophores, a duty cycle-optimized alternating three-laser scheme (DCO-ALEX) has been developed. Simultaneous observation of the stepsizes for both motors allows the detection of reversible elastic deformations between the rotor parts of Fo and F1.

Parameter Estimation for GRACE-FO Geometric Ranging Errors

NASA Astrophysics Data System (ADS)

Wegener, H.; Mueller, V.; Darbeheshti, N.; Naeimi, M.; Heinzel, G.

2017-12-01

Onboard GRACE-FO, the novel Laser Ranging Instrument (LRI) serves as a technology demonstrator, but it is a fully functional instrument to provide an additional high-precision measurement of the primary mission observable: the biased range between the two spacecraft. Its (expectedly) two largest error sources are laser frequency noise and tilt-to-length (TTL) coupling. While not much can be done about laser frequency noise, the mechanics of the TTL error are widely understood. They depend, however, on unknown parameters. In order to improve the quality of the ranging data, it is hence essential to accurately estimate these parameters and remove the resulting TTL error from the data.Means to do so will be discussed. In particular, the possibility of using calibration maneuvers, the utility of the attitude information provided by the LRI via Differential Wavefront Sensing (DWS), and the benefit from combining ranging data from LRI with ranging data from the established microwave ranging, will be mentioned.

Five X-ray observations of the intermediate polar FO Aqr spanning ten years

NASA Technical Reports Server (NTRS)

Beardmore, A. P.; Mukai, K.; Norton, A. J.; Osborne, J. P.; Taylor, P.

1996-01-01

The comparison of five X-ray observations of FO Aqr reveals that the morphology of the X-ray light curve changes considerably with time. Power spectra from 1988 and 1993 reveal a sideband component, while power spectra from 1990 do not. This suggests that the amount of disk overflow accretion varies as a function of time. From structured spin folded light curves, the presence of complex, multicomponent emitting regions near the white dwarf's surface can be inferred.

Equatorial ionization anomaly development as studied by GPS TEC and foF2 over Brazil: A comparison of observations with model results from SUPIM and IRI-2012

NASA Astrophysics Data System (ADS)

Nogueira, P. A. B.; Abdu, M. A.; Souza, J. R.; Batista, I. S.; Bailey, G. J.; Santos, A. M.; Takahashi, H.

2013-11-01

The equatorial ionization anomaly (EIA) development is studied using the total electron content (TEC) observed by the Global Positioning System (GPS) satellites, the F2-layer critical frequency (foF2) as measured by digisondes operated in the Brazilian sector, and by model simulation using the SUPIM (Sheffield University Plasmasphere Ionosphere Model). We have used two indices based on foF2 and TEC to represent the strength of the EIA Southern Anomaly Crest (SAC), which are denoted, respectively, by SAC(foF2) and SAC(TEC). Significant differences in the local time variations of the EIA intensity, as represented by these two indices, are investigated. The observed SAC indices are compared with their values modeled by the SUPIM and also by the International Reference Ionosphere (IRI)-2012. The SUPIM simulations that use the standard E×B plasma drift and neutral air wind models are found to provide acceptable representations of the observed foF2 and TEC, and hence the indices SAC(foF2) and SAC(TEC) during daytime, whereas the IRI-2012 model is not, except during the post-midnight/sunrise hours. It is found that the differences in the local time variations between the SAC(foF2) and SAC(TEC) can be reduced by limiting the TEC integrations in height up to an altitude of 630 km in the SUPIM calculations. It is also found that when the EIA intensity is calculated for an intermediate dip latitude (12°S) the difference between the local time variation patterns of the two corresponding indices in the experimental data and in the SUPIM results is reduced. For the IRI-2012 values, the subequatorial station modification does not appear to have any effect.

Fudecalone, a new anticoccidial agent produced by Penicillium sp. FO-2030.

PubMed

Tabata, N; Tomoda, H; Masuma, R; Iwai, Y; Omura, S

1995-01-01

Penicillium sp. FO-2030, a soil isolate, was found to produce a new anticoccidial compound. The active compound, designated fudecalone, was isolated from the fermentation broth of the producing strain by solvent extraction, silica gel column chromatography and preparative HPLC. The structure of fudecalone was elucidated to be 3,3a,6,6a,7,8,9,10-octahydro-1-hydroxy-4,7,7-trimethyl-1H-naphtho[1,8a- c]furan-6-one mainly by spectroscopic studies including various NMR measurements. The anticoccidial activity using cell systems indicated that schizont formation of monensin-resistant Eimeria tenella was completely inhibited by fudecalone at concentrations more than 16 microM.

Identification and comparative quantification of bio-active phthalides in essential oils from si-wu-tang, fo-shou-san, radix angelica and rhizoma chuanxiong.

PubMed

Tang, Yuping; Zhu, Min; Yu, Sheng; Hua, Yongqing; Duan, Jin-Ao; Su, Shulan; Zhang, Xu; Lu, Yin; Ding, Anwei

2010-01-15

Phthalides are important bio-active constituents in Si-Wu-Tang and Fo-Shou-San, two commonly used Traditional Chinese Medicine (TCM) combined prescriptions mainly derived from Radix Angelica and Rhizoma Chuanxiong. In this paper, the contents of eight phthalides, including Z-ligustilide, E-ligustilide, Z-butylenephthalide, E-butylene-phthalide, 3-butylphthalide, neocnidilide and senkyunolide A were determined or estimated by gas chromatography-mass spectrometry (GC-MS). The results showed GC-MS was a simple, rapid, and high sensitive method for analyzing phthalides in Si-Wu-Tang, Fo-Shou-San, Radix Angelica and Rhizoma Chuanxiong, and the extractable contents of each phthalides including Z-ligustilide, E-ligustilide, Z-butylenephthalide, etc. varied after Radix Angelica, Rhizoma Chuanxiong were combined into a formulation, such as Si-Wu-Tang and Fo-Shou-San. Furthermore, inhibition activity of essential oils from Si-Wu-Tang, Fo-Shou-San, Radix Angelica and Rhizoma Chuanxiong on uterine contraction was tested in an in vitro assay, and the results showed that the activity of the essential oil is higher as the content of the phthalides increase, which demonstrated that phthalides are possibly main active components inhibiting mice uterine contraction in vitro. All of the results suggested that comparative analysis of chemical components and pharmacological activities of each herb and formula is possibly helpful to elucidate the active components in traditional Chinese medicine, and to reveal the compatibility mechanism of TCM formulae.

Examining Metasomatism in Low fO2 Environments: Exploring Sulfidation Reactions in Various Planetary Bodies

NASA Technical Reports Server (NTRS)

Srinivasan, P.; Shearer, C. K.; McCubbin, F. M.; Bell, A. S.; Agee, C. B.

2016-01-01

Hydrothermal systems are common on Earth in a variety of tectonic environments and at different temperature and pressure conditions. These systems are commonly dominated by H2O, and they are responsible for element transport and the production of ore deposits. Unlike the Earth (fO2FMQ), many other planetary bodies (e.g., Moon and asteroids) have fO2 environments that are more reduced (IW+/-2), and H2O is not the important solvent responsible for element transport. One example of a texture that could result from element transport and metasomatism, which appears to occur on numerous planetary bodies, is sulfide-silicate intergrowths. These subsolidus assemblages are interpreted to form as a result of sulfidation reactions from a S-rich fluid phase. The composition of fluids may vary within and among parent bodies and could be sourced from magmatic (e.g. Moon) or impact processes (e.g. HED meteorites and Moon). For example, it has been previously demonstrated on the Moon that the interaction of olivine with a hydrogen- and sulfur-bearing vapor phase altered primary mineral assemblages, producing sulfides (e.g. troilite) and orthopyroxene. Formation of these types of "sulfidation" assemblages can be illustrated with the following reaction: Fe2SiO4(ol) + 1/2 S(2 system) = FeS(troi)+ FeSiO3(opx) + 1/2 O2 system. The products of this reaction, as seen in lunar rocks, is a vermicular or "worm-like" texture of intergrown orthopyroxene and troilite. Regardless of the provenance of the S-bearing fluid, the minerals in these various planetary environments reacted in the same manner to produce orthopyroxene and troilite. Although similar textures have been identified in a variety of parent bodies, a comparative study on the compositions and the origins of these sulfide-silicate assemblages has yet to be undertaken. The intent of this study is to examine and compare sulfide-silicate intergrowths from various planetary bodies to explore their petrogenesis and examine the nature

A new ionospheric storm scale based on TEC and foF2 statistics

NASA Astrophysics Data System (ADS)

Nishioka, Michi; Tsugawa, Takuya; Jin, Hidekatsu; Ishii, Mamoru

2017-01-01

In this paper, we propose the I-scale, a new ionospheric storm scale for general users in various regions in the world. With the I-scale, ionospheric storms can be classified at any season, local time, and location. Since the ionospheric condition largely depends on many factors such as solar irradiance, energy input from the magnetosphere, and lower atmospheric activity, it had been difficult to scale ionospheric storms, which are mainly caused by solar and geomagnetic activities. In this study, statistical analysis was carried out for total electron content (TEC) and F2 layer critical frequency (foF2) in Japan for 18 years from 1997 to 2014. Seasonal, local time, and latitudinal dependences of TEC and foF2 variabilities are excluded by normalizing each percentage variation using their statistical standard deviations. The I-scale is defined by setting thresholds to the normalized numbers to seven categories: I0, IP1, IP2, IP3, IN1, IN2, and IN3. I0 represents a quiet state, and IP1 (IN1), IP2 (IN2), and IP3 (IN3) represent moderate, strong, and severe positive (negative) storms, respectively. The proposed I-scale can be used for other locations, such as polar and equatorial regions. It is considered that the proposed I-scale can be a standardized scale to help the users to assess the impact of space weather on their systems.

Fiber-optic Fourier transform infrared (FO-FTIR) spectroscopy for detecting endotoxin contamination in ophthalmic viscosurgical devices (OVDS) (Conference Presentation)

NASA Astrophysics Data System (ADS)

Hassan, Moinuddin; Ilev, Ilko

2016-03-01

Ophthalmic Viscosurgical Devices (OVDs) in clinical setting are a major health risk factor for potential endotoxin contamination in the eye, due to their extensive applications in cataract surgery for space creation, stabilization and protection of intraocular tissue and intraocular lens (IOL) during implantation. Endotoxin contamination of OVDs is implicated in toxic anterior syndrome (TASS), a severe complication of cataract surgery that leads to intraocular damage and even blindness. Current standard methods for endotoxin contamination detection utilize rabbit assay or Limulus amoebocyte lysate (LAL) assays. These endotoxin detection strategies are extremely difficult for gel-like type devices such as OVDs. To overcome the endotoxin detection limitations in OVDs, we have developed an alternative optical detection methodology for label-free and real-time sensing of bacterial endotoxin in OVDs, based on fiber-optic Fourier transform infrared (FO-FTIR) transmission spectrometry in the mid-IR spectral range from 2.5 micron to 12 micron. Endotoxin contaminated OVD test samples were prepared by serial dilutions of endotoxins on OVDs. The major results of this study revealed two salient spectral peak shifts (in the regions 2925 to 2890 cm^-1 and 1125 to 1100 cm^-1), which are associated with endotoxin in OVDs. In addition, FO-FTIR experimental results processed using a multivariate analysis confirmed the observed specific peak shifts associated with endotoxin contamination in OVDs. Thus, employing the FO-FTIR sensing methodology integrated with a multivariate analysis could potentially be used as an alternative endotoxin detection technique in OVD.

foF2 vs solar indices for the Rome station: Looking for the best general relation which is able to describe the anomalous minimum between cycles 23 and 24

NASA Astrophysics Data System (ADS)

Perna, L.; Pezzopane, M.

2016-10-01

Analyses of the dependence of the F2layer critical frequency, foF2, on five widely used solar activity indices (F10.7, Lym-α, MgII, R and EUV0.1-50)are carried out considering noon values manually validated at the ionospheric station of Rome (41.8°N, 12.5°E, Italy) between January 1976 and December 2013, a period of time covering the last three solar cycles and including the prolonged and anomalous minimum of solar cycle 23/24 (years 2008-2009). After applying a 1-year running mean to both foF2 and solar activity indices time series, a second order polynomial fitting proves to perform better than a linear one, and this is specifically due to the very low solar activity of the last solar minimum and to the remaining saturation effect characterizing the high solar activity. A comparison between observed and synthetic foF2 values, the latter calculated by using the analytical relations found for every index, and some considerations made on the R parameter introduced by Solomon et al. (2013), suggest that MgII is the best index to describe the dependence of foF2 on the solar activity. Three main reasons justify this result: (1) the good sensibility of MgII to the variations of foF2 for low solar activity; (2) the reduced saturation effect characterizing MgII at high solar activity; (3) the poor influence of the hysteresis effect characterizing MgII at medium solar activity. On the other hand, the F10.7 index, widely used as input parameter for numerous ionospheric models, does not represent properly the last minimum; specifically, it is not able to describe the variations of foF2 under a solar activity level of F10.7=82·10-22 [J Hz-1 s-1 m-2].

Physiology, Biochemistry, and Applications of F420- and Fo-Dependent Redox Reactions

PubMed Central

Ahmed, F. Hafna; Mohamed, A. Elaaf; Lee, Brendon M.; Pandey, Gunjan; Warden, Andrew C.; Scott, Colin; Oakeshott, John G.; Taylor, Matthew C.

2016-01-01

SUMMARY 5-Deazaflavin cofactors enhance the metabolic flexibility of microorganisms by catalyzing a wide range of challenging enzymatic redox reactions. While structurally similar to riboflavin, 5-deazaflavins have distinctive and biologically useful electrochemical and photochemical properties as a result of the substitution of N-5 of the isoalloxazine ring for a carbon. 8-Hydroxy-5-deazaflavin (Fo) appears to be used for a single function: as a light-harvesting chromophore for DNA photolyases across the three domains of life. In contrast, its oligoglutamyl derivative F420 is a taxonomically restricted but functionally versatile cofactor that facilitates many low-potential two-electron redox reactions. It serves as an essential catabolic cofactor in methanogenic, sulfate-reducing, and likely methanotrophic archaea. It also transforms a wide range of exogenous substrates and endogenous metabolites in aerobic actinobacteria, for example mycobacteria and streptomycetes. In this review, we discuss the physiological roles of F420 in microorganisms and the biochemistry of the various oxidoreductases that mediate these roles. Particular focus is placed on the central roles of F420 in methanogenic archaea in processes such as substrate oxidation, C1 pathways, respiration, and oxygen detoxification. We also describe how two F420-dependent oxidoreductase superfamilies mediate many environmentally and medically important reactions in bacteria, including biosynthesis of tetracycline and pyrrolobenzodiazepine antibiotics by streptomycetes, activation of the prodrugs pretomanid and delamanid by Mycobacterium tuberculosis, and degradation of environmental contaminants such as picrate, aflatoxin, and malachite green. The biosynthesis pathways of Fo and F420 are also detailed. We conclude by considering opportunities to exploit deazaflavin-dependent processes in tuberculosis treatment, methane mitigation, bioremediation, and industrial biocatalysis. PMID:27122598

Physiology, Biochemistry, and Applications of F420- and Fo-Dependent Redox Reactions.

PubMed

Greening, Chris; Ahmed, F Hafna; Mohamed, A Elaaf; Lee, Brendon M; Pandey, Gunjan; Warden, Andrew C; Scott, Colin; Oakeshott, John G; Taylor, Matthew C; Jackson, Colin J

2016-06-01

5-Deazaflavin cofactors enhance the metabolic flexibility of microorganisms by catalyzing a wide range of challenging enzymatic redox reactions. While structurally similar to riboflavin, 5-deazaflavins have distinctive and biologically useful electrochemical and photochemical properties as a result of the substitution of N-5 of the isoalloxazine ring for a carbon. 8-Hydroxy-5-deazaflavin (Fo) appears to be used for a single function: as a light-harvesting chromophore for DNA photolyases across the three domains of life. In contrast, its oligoglutamyl derivative F420 is a taxonomically restricted but functionally versatile cofactor that facilitates many low-potential two-electron redox reactions. It serves as an essential catabolic cofactor in methanogenic, sulfate-reducing, and likely methanotrophic archaea. It also transforms a wide range of exogenous substrates and endogenous metabolites in aerobic actinobacteria, for example mycobacteria and streptomycetes. In this review, we discuss the physiological roles of F420 in microorganisms and the biochemistry of the various oxidoreductases that mediate these roles. Particular focus is placed on the central roles of F420 in methanogenic archaea in processes such as substrate oxidation, C1 pathways, respiration, and oxygen detoxification. We also describe how two F420-dependent oxidoreductase superfamilies mediate many environmentally and medically important reactions in bacteria, including biosynthesis of tetracycline and pyrrolobenzodiazepine antibiotics by streptomycetes, activation of the prodrugs pretomanid and delamanid by Mycobacterium tuberculosis, and degradation of environmental contaminants such as picrate, aflatoxin, and malachite green. The biosynthesis pathways of Fo and F420 are also detailed. We conclude by considering opportunities to exploit deazaflavin-dependent processes in tuberculosis treatment, methane mitigation, bioremediation, and industrial biocatalysis. Copyright © 2016, American Society for

Escherichia coli F1Fo-ATP synthase with a b/δ fusion protein allows analysis of the function of the individual b subunits.

PubMed

Gajadeera, Chathurada S; Weber, Joachim

2013-09-13

The "stator stalk" of F1Fo-ATP synthase is essential for rotational catalysis as it connects the nonrotating portions of the enzyme. In Escherichia coli, the stator stalk consists of two (identical) b subunits and the δ subunit. In mycobacteria, one of the b subunits and the δ subunit are replaced by a b/δ fusion protein; the remaining b subunit is of the shorter b' type. In the present study, it is shown that it is possible to generate a functional E. coli ATP synthase containing a b/δ fusion protein. This construct allowed the analysis of the roles of the individual b subunits. The full-length b subunit (which in this case is covalently linked to δ in the fusion protein) is responsible for connecting the stalk to the catalytic F1 subcomplex. It is not required for interaction with the membrane-embedded Fo subcomplex, as its transmembrane helix can be removed. Attachment to Fo is the function of the other b subunit which in turn has only a minor (if any at all) role in binding to δ. Also in E. coli the second b subunit can be shortened to a b' type.

An Effective Design of Electrically Conducting Thin-Film Composite (TFC) Membranes for Bio and Organic Fouling Control in Forward Osmosis (FO).

PubMed

Liu, Qing; Qiu, Guanglei; Zhou, Zhengzhong; Li, Jingguo; Amy, Gary Lee; Xie, Jianping; Lee, Jim Yang

2016-10-04

The organic foulants and bacteria in secondary wastewater treatment can seriously impair the membrane performance in a water treatment plant. The embedded electrode approach using an externally applied potential to repel organic foulants and inhibit bacterial adhesion can effectively reduce the frequency of membrane replacement. Electrode embedment in membranes is often carried out by dispensing a conductor (e.g., carbon nanotubes, or CNTs) in the membrane substrate, which gives rise to two problems: the leaching-out of the conductor and a percolation-limited membrane conductivity that results in an added energy cost. This study presents a facile method for the embedment of a continuous electrode in thin-film composite (TFC) forward osmosis (FO) membranes. Specifically, a conducting porous carbon paper is used as the understructure for the formation of a membrane substrate by the classical phase inversion process. The carbon paper and the membrane substrate polymer form an interpenetrating structure with good stability and low electrical resistance (only about 1Ω/□). The membrane-electrode assembly was deployed as the cathode of an electrochemical cell, and showed good resistance to organic and microbial fouling with the imposition of a 2.0 V DC voltage. The carbon paper-based FO TFC membranes also possess good mechanical stability for practical use.

Grazing incidence angle based sensing approach integrated with fiber-optic Fourier transform infrared (FO-FTIR) spectroscopy for remote and label-free detection of medical device contaminations.

PubMed

Hassan, Moinuddin; Ilev, Ilko

2014-10-01

Contamination of medical devices has become a critical and prevalent public health safety concern since medical devices are being increasingly used in clinical practices for diagnostics, therapeutics and medical implants. The development of effective sensing methods for real-time detection of pathogenic contamination is needed to prevent and reduce the spread of infections to patients and the healthcare community. In this study, a hollow-core fiber-optic Fourier transform infrared spectroscopy methodology employing a grazing incidence angle based sensing approach (FO-FTIR-GIA) was developed for detection of various biochemical contaminants on medical device surfaces. We demonstrated the sensitivity of FO-FTIR-GIA sensing approach for non-contact and label-free detection of contaminants such as lipopolysaccharide from various surface materials relevant to medical device. The proposed sensing system can detect at a minimum loading concentration of approximately 0.7 μg/cm(2). The FO-FTIR-GIA has the potential for the detection of unwanted pathogen in real time.

Grazing incidence angle based sensing approach integrated with fiber-optic Fourier transform infrared (FO-FTIR) spectroscopy for remote and label-free detection of medical device contaminations

NASA Astrophysics Data System (ADS)

Hassan, Moinuddin; Ilev, Ilko

2014-10-01

Contamination of medical devices has become a critical and prevalent public health safety concern since medical devices are being increasingly used in clinical practices for diagnostics, therapeutics and medical implants. The development of effective sensing methods for real-time detection of pathogenic contamination is needed to prevent and reduce the spread of infections to patients and the healthcare community. In this study, a hollow-core fiber-optic Fourier transform infrared spectroscopy methodology employing a grazing incidence angle based sensing approach (FO-FTIR-GIA) was developed for detection of various biochemical contaminants on medical device surfaces. We demonstrated the sensitivity of FO-FTIR-GIA sensing approach for non-contact and label-free detection of contaminants such as lipopolysaccharide from various surface materials relevant to medical device. The proposed sensing system can detect at a minimum loading concentration of approximately 0.7 μg/cm2. The FO-FTIR-GIA has the potential for the detection of unwanted pathogen in real time.

Grazing incidence angle based sensing approach integrated with fiber-optic Fourier transform infrared (FO-FTIR) spectroscopy for remote and label-free detection of medical device contaminations

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hassan, Moinuddin, E-mail: moinuddin.hassan@fda.hhs.gov; Ilev, Ilko

2014-10-15

Contamination of medical devices has become a critical and prevalent public health safety concern since medical devices are being increasingly used in clinical practices for diagnostics, therapeutics and medical implants. The development of effective sensing methods for real-time detection of pathogenic contamination is needed to prevent and reduce the spread of infections to patients and the healthcare community. In this study, a hollow-core fiber-optic Fourier transform infrared spectroscopy methodology employing a grazing incidence angle based sensing approach (FO-FTIR-GIA) was developed for detection of various biochemical contaminants on medical device surfaces. We demonstrated the sensitivity of FO-FTIR-GIA sensing approach for non-contactmore » and label-free detection of contaminants such as lipopolysaccharide from various surface materials relevant to medical device. The proposed sensing system can detect at a minimum loading concentration of approximately 0.7 μg/cm{sup 2}. The FO-FTIR-GIA has the potential for the detection of unwanted pathogen in real time.« less

An Inhibitor of the δPKC Interaction with the d Subunit of F1Fo ATP Synthase Reduces Cardiac Troponin I Release from Ischemic Rat Hearts: Utility of a Novel Ammonium Sulfate Precipitation Technique

PubMed Central

Ogbi, Mourad; Obi, Ijeoma; Johnson, John A.

2013-01-01

We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n = 5) percentage of maximal cTnI release was 30±7 and 60±17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60–150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts. PMID:23936451

Integrating free-space optical communication links with existing WiFi (WiFO) network

NASA Astrophysics Data System (ADS)

Liverman, S.; Wang, Q.; Chu, Y.; Duong, T.; Nguyen-Huu, D.; Wang, S.; Nguyen, T.; Wang, A. X.

2016-02-01

Recently, free-space optical (FSO) systems have generated great interest due to their large bandwidth potential and a line-of-sight physical layer of protection. In this paper, we propose WiFO, a novel hybrid system, FSO downlink and WiFi uplink, which will integrate currently available WiFi infrastructure with inexpensive infrared light emitting diodes. This system takes full advantage of the mobility inherent in WiFi networks while increasing the downlink bandwidth available to each end user. We report the results of our preliminary investigation that show the capabilities of our prototype design in terms of bandwidth, bit error rates, delays and transmission distances.

Confined wetting of FoCa clay powder/pellet mixtures: Experimentation and numerical modeling

NASA Astrophysics Data System (ADS)

Maugis, Pascal; Imbert, Christophe

Potential geological nuclear waste disposals must be properly sealed to prevent contamination of the biosphere by radionuclides. In the framework of the RESEAL project, the performance of a bentonite shaft seal is currently studied at Mol (Belgium). This paper focuses on the hydro-mechanical physical behavior of centimetric, unsaturated samples of the backfilling material - a mixture of FoCa-clay powder and pellets - during oedometer tests. The hydro-mechanical response of the samples is observed experimentally, and then compared to numerical simulations performed by our Cast3M Finite Element code. The generalized Darcy’s law and the Barcelona Basic Model mechanical model formed the physical basis of the numerical model and the interpretation. They are widely used in engineered barriers modeling. Vertical swelling pressure and water intake were measured throughout the test. Although water income presents a monotonous increase, the swelling pressure evolution is marked by a peak, and then a local minimum before increasing again to an asymptotic value. This unexpected behavior is explained by yielding rather than by heterogeneity. It is satisfactorily reproduced by the model after parameter calibration. Several samples with different heights ranging from 5 to 12 cm show the same hydro-mechanical response, apart from a dilatation of the time scale. The interest of the characterization of centimetric samples to predicting the efficiency of a metric sealing is discussed.

Micro-XANES Determination Fe Speciation in Natural Basalts at Mantle-Relevant fO2

NASA Astrophysics Data System (ADS)

Fischer, R.; Cottrell, E.; Lanzirotti, A.; Kelley, K. A.

2007-12-01

We demonstrate that the oxidation state of iron (Fe3+/ΣFe) can be determined with a precision of ±0.02 (10% relative) on natural basalt glasses at mantle-relevant fO2 using Fe K-edge X-ray absorption near edge structure (XANES) spectroscopy. This is equivalent to ±0.25 log unit resolution relative to the QFM buffer. Precise determination of the oxidation state over this narrow range (Fe3+/ΣFe=0.06-0.30) and at low fO2 (down to QFM-2) relies on appropriate standards, high spectral resolution, and highly reproducible methods for extracting the pre-edge centroid position. We equilibrated natural tholeiite powder in a CO/CO2 gas mixing furnace at 1350°C from QFM-3 to QFM+2 to create six glasses of known Fe3+/ΣFe, independently determined by Mössbauer spectroscopy. XANES spectra were collected at station X26A at NSLS, Brookhaven Natl. Lab, in fluorescence mode (9 element Ge array detector) using both Si(111) and Si(311) monochromators. Generally, the energy position of the 1s→3d (pre-edge) transition centroid is the most sensitive monitor of Fe oxidation state using XANES. For the mixture of Fe oxidation states in these glasses and the resulting coordination geometries, the pre-edge spectra are best defined by two multiple 3d crystal field transitions. The Si(311) monochromator, with higher energy resolution, substantially improved spectral resolution for the 1s→3d transition. Dwell times of 5s at 0.1eV intervals across the pre-edge region yielded spectra with the 1s→3d transition peaks clearly resolved. The pre-edge centroid position is highly sensitive to the background subtraction and peak fitting procedures. Differences in fitting models result in small but significant differences in the calculated peak area of each pre-edge multiplet, and the relative contribution of each peak to the calculated centroid. We assessed several schemes and obtained robust centroid positions by simultaneously fitting the background with a damped harmonic oscillator (DHO

Study of TEC and foF2 with the Help of GPS and Ionosonde Data over Maitri, Antarctica

NASA Astrophysics Data System (ADS)

Khatarkar, Prakash; Gwal, Ashok Kumar

Prakash Khatarkar, Purusottam Bhaware, Azad Ahmad Mansoori, Varsha Kachneria, Shweta Thakur, and A. K. Gwal Abstract The behavior of ionosphere can be diagnosed by a number of techniques. The common techniques used are the space based Global Positioning System and the ground based Ionosonde. We have compared the variability of ionospheric parameters by using two different techniques GPS and Ionosonde, during December 2009 to November 2010 at the Indian base station Maitri (11.45E, 70.45S). The comparison between the measurements of two techniques was realized through the Total Electron Content (TEC) parameters derived by using different methods. The comparison was made diurnally, seasonally, polar day and polar night variations and the annually. From our analysis we found that a strong correlation exists between the GPS derived TEC and Ionosonde derived foF2 during the day period while during the night time the correlation is insignificant. At the same time we found that a strong correlation exists between the Ionosonde and GPS derived TEC. The pattern of variation of ionospheric parameters derived from two techniques is strikingly similar indicating that the high degree of synchronization between them. This has a practical applicability by allowing calculating the error in one technique by comparing with other. Keywords: Ionosphere, Ionosonde, GPS, foF2, TEC.

What GRACE/GRACE-FO satellite gravity may tell about the atmosphere (and what not)

NASA Astrophysics Data System (ADS)

Eicker, Annette; Springer, Anne; Hense, Andreas; Panet, Isabelle; Kusche, Jürgen

2017-04-01

In this presentation we would like to discuss the present benefit and future potential of satellite gravity observations, as obtained from the satellite mission GRACE and its successor GRACE-Follow-On (GRACE-FO), for studying the atmospheric water cycle. In the first part of the presentation, we will show recent results of using GRACE to constrain atmospheric water budgets. GRACE-derived water storage changes (in combination with observed runoff) can be used to solve for the vertical water flux deficit of precipitation (P) minus evapotranspiration (E), which links the terrestrial and the atmospheric water balance equations. This relates gravity change to moisture flux divergence and water vapor change and thus provides, in principle, a link between GRACE/GRACE-FO and (area-averaged) GNSS integrated water vapor observations that may be exploited in the future. We will show that such an independent estimate of P minus E can be used to constrain land-atmosphere fluxes from monthly time scales to decadal trends and even provides meaningful flux information down to daily time steps. In the second part of the presentation, we would like to give an outlook towards the potential of using satellite gravity data directly for the estimation of atmospheric water mass changes. On the basis of ERA-Interim data, we provide a first assessment which suggests that an anticipated future double-pair gravity mission with enhanced temporal and spatial resolution would be sensitive to 'feeling' atmospheric water mass (water vapor) variations. However, whether these (faster) variations could be separated from dry air mass variations through modeling needs to be investigated. If possible, this would offer a completely new tool for validating atmospheric analyses and for improving engergy and mass budgets in models.

Andrastins A-C, new protein farnesyltransferase inhibitors produced by Penicillium sp. FO-3929. I. Producing strain, fermentation, isolation, and biological activities.

PubMed

Omura, S; Inokoshi, J; Uchida, R; Shiomi, K; Masuma, R; Kawakubo, T; Tanaka, H; Iwai, Y; Kosemura, S; Yamamura, S

1996-05-01

New protein farnesyltransferase inhibitors, andrastins A-C, have been discovered in the cultured broth of Penicillium sp. FO-3929. Andrastins extracted from broth supernatant were purified by silica gel chromatography, ODS chromatography and HPLC. The IC50 of andrastins A, B, and C against protein farnesyltransferase were 24.9, 47.1, and 13.3 microM, respectively.

The disappearance and reformation of the accretion disc during a low state of FO Aquarii

NASA Astrophysics Data System (ADS)

Hameury, J.-M.; Lasota, J.-P.

2017-09-01

Context. FO Aquarii, an asynchronous magnetic cataclysmic variable (intermediate polar) went into a low state in 2016, from which it slowly and steadily recovered without showing dwarf nova outbursts. This requires explanation since in a low state, the mass-transfer rate is in principle too low for the disc to be fully ionised and the disc should be subject to the standard thermal and viscous instability observed in dwarf novae. Aims: We investigate the conditions under which an accretion disc in an intermediate polar could exhibit a luminosity drop of two magnitudes in the optical band without showing outbursts. Methods: We use our numerical code for the time evolution of accretion discs, including other light sources from the system (primary, secondary, hot spot). Results: We show that although it is marginally possible for the accretion disc in the low state to stay on the hot stable branch, the required mass-transfer rate in the normal state would then have to be extremely high, of the order of 1019 g s-1 or even larger. This would make the system so intrinsically bright that its distance should be much larger than allowed by all estimates. We show that observations of FO Aqr are well accounted for by the same mechanism that we have suggested as explaining the absence of outbursts during low states of VY Scl stars: during the decay, the magnetospheric radius exceeds the circularisation radius, so that the disc disappears before it enters the instability strip for dwarf nova outbursts. Conclusions: Our results are unaffected, and even reinforced, if accretion proceeds both via the accretion disc and directly via the stream during some intermediate stages; the detailed process through which the disc disappears still requires investigation.

Discovery Of Low Oxygen Fugacity (fo2) Mineral And Fluid Phases In Lower Mantle -Derived Early Pulse Of The Deccan Flood Basalts

NASA Astrophysics Data System (ADS)

Basu, A. R.; Das, S.

2017-12-01

Estimation of Earth's lower mantle mineralogy and oxygen fugacity are principally based on indirect geophysical and experimental studies. According to these studies, the mantle becomes increasingly reducing from upper to lower mantle due to the distribution of ferric (Fe3+) and ferrous (Fe2+) iron in perovskite, the dominant mineral phase in the lower mantle. However, the natural occurrence of low oxygen fugacity (fO2), lower mantle mineral and fluid phases are rare, except some for discrete inclusions in superdeep diamonds. In this study, we document that some rocks associated with plume volcanism, such as the Deccan flood basalt volcanic province, preserve the lower mantle mineral phases. We document here unusual primary texture - bearing minerals in olivine-clinopyroxene bearing picrite intrusives associated with the Deccan Traps. The olivine and clinopyroxene of these rocks have high 3He/4He ratio (R/RA 14) as well as Nd, Sr and Pb isotopes identical to those of the Réunion plume, clearly indicating their lower mantle - derivation. These rocks are the initial pulse at 68Ma of the Deccan Trap eruption [1]. Presence of unusual exsolved lamella and rectangular, vermicular intergrowths of diopside and magnetite in olivine indicate a precursory phase with higher Fe3+. The diopside part in rectangular intergrowth show presence of hydrocarbon. Trails of small graphitic carbon crystals are also present both in the cores of these olivine and diopside. We suggest that the hydrocarbons are derived from the lower mantle having much lesser fO2 than the upper mantle. This study unequivocally indicates that direct lower mantle mineralogical signature, including their fo2 can be obtained from early pulse of plume volcanism. References: [1] Basu A R, Renne P R, Dasgupta D K, Teichmann F, Poreda R J, Science 261, 902 - 906; 1993.

Comparison of ionospheric F2 peak parameters foF2 and hmF2 with IRI2001 at Hainan

NASA Astrophysics Data System (ADS)

Wang, X.; Shi, J. K.; Wang, G. J.; Gong, Y.

2009-06-01

Monthly median values of foF2, hmF2 and M(3000)F2 parameters, with quarter-hourly time interval resolution for the diurnal variation, obtained with DPS4 digisonde at Hainan (19.5°N, 109.1°E; Geomagnetic coordinates: 178.95°E, 8.1°N) are used to investigate the low-latitude ionospheric variations and comparisons with the International Reference Ionosphere (IRI) model predictions. The data used for the present study covers the period from February 2002 to April 2007, which is characterized by a wide range of solar activity, ranging from high solar activity (2002) to low solar activity (2007). The results show that (1) Generally, IRI predictions follow well the diurnal and seasonal variation patterns of the experimental values of foF2, especially in the summer of 2002. However, there are systematic deviation between experimental values and IRI predictions with either CCIR or URSI coefficients. Generally IRI model greatly underestimate the values of foF2 from about noon to sunrise of next day, especially in the afternoon, and slightly overestimate them from sunrise to about noon. It seems that there are bigger deviations between IRI Model predictions and the experimental observations for the moderate solar activity. (2) Generally the IRI-predicted hmF2 values using CCIR M(3000)F2 option shows a poor agreement with the experimental results, but there is a relatively good agreement in summer at low solar activity. The deviation between the IRI-predicted hmF2 using CCIR M(3000)F2 and observed hmF2 is bigger from noon to sunset and around sunrise especially at high solar activity. The occurrence time of hmF2 peak (about 1200 LT) of the IRI model predictions is earlier than that of observations (around 1500 LT). The agreement between the IRI hmF2 obtained with the measured M(3000)F2 and the observed hmF2 is very good except that IRI overestimates slightly hmF2 in the daytime in summer at high solar activity and underestimates it in the nighttime with lower values near

Erabulenols, inhibitors of cholesteryl ester transfer protein produced by Penicillium sp. FO-5637. I.Production, isolation and biological properties.

PubMed

Tomoda, H; Tabata, N; Masuma, R; Si, S Y; Omura, S

1998-07-01

Penicillium sp. FO-5637, a soil isolate, was found to produce a series of inhibitors of cholesteryl ester transfer protein (CETP). Novel active compounds, designated erabulenols A and B, were isolated from the fermentation broth of the producing strain by solvent extraction, ODS column chromatography and HPLC. Erabulenols A and B inhibit human CETP activity with IC50 values of 47.7 and 58.2 microM in an in vitro assay system containing 200 microM BSA, respectively.

Bacillus safensis FO-36b and Bacillus pumilus SAFR-032: a whole genome comparison of two spacecraft assembly facility isolates.

PubMed

Tirumalai, Madhan R; Stepanov, Victor G; Wünsche, Andrea; Montazari, Saied; Gonzalez, Racquel O; Venkateswaran, Kasturi; Fox, George E

2018-06-08

Bacillus strains producing highly resistant spores have been isolated from cleanrooms and space craft assembly facilities. Organisms that can survive such conditions merit planetary protection concern and if that resistance can be transferred to other organisms, a health concern too. To further efforts to understand these resistances, the complete genome of Bacillus safensis strain FO-36b, which produces spores resistant to peroxide and radiation was determined. The genome was compared to the complete genome of B. pumilus SAFR-032, and the draft genomes of B. safensis JPL-MERTA-8-2 and the type strain B. pumilus ATCC7061 T . Additional comparisons were made to 61 draft genomes that have been mostly identified as strains of B. pumilus or B. safensis. The FO-36b gene order is essentially the same as that in SAFR-032 and other B. pumilus strains. The annotated genome has 3850 open reading frames and 40 noncoding RNAs and riboswitches. Of these, 307 are not shared by SAFR-032, and 65 are also not shared by MERTA and ATCC7061 T . The FO-36b genome has ten unique open reading frames and two phage-like regions, homologous to the Bacillus bacteriophage SPP1 and Brevibacillus phage Jimmer1. Differing remnants of the Jimmer1 phage are found in essentially all B. safensis / B. pumilus strains. Seven unique genes are part of these phage elements. Whole Genome Phylogenetic Analysis of the B. pumilus, B. safensis and other Firmicutes genomes, separate them into three distinct clusters. Two clusters are subgroups of B. pumilus while one houses all the B. safensis strains. The Genome-genome distance analysis and a phylogenetic analysis of gyrA sequences corroborated these results. It is not immediately obvious that the presence or absence of any specific gene or combination of genes is responsible for the variations in resistance seen. It is quite possible that distinctions in gene regulation can alter the expression levels of key proteins thereby changing the organism

Sensor System Fo4r Buried Waste Containment Sites

DOEpatents

Smith, Ann Marie; Gardner, Bradley M.; Kostelnik, Kevin M.; Partin, Judy K.; Lancaster, Gregory D.; Pfeifer, Mary Catherine

2003-11-18

A sensor system for a buried waste containment site having a bottom wall barrier and sidewall barriers, for containing hazardous waste. The sensor system includes one or more sensor devices disposed in one or more of the barriers for detecting a physical parameter either of the barrier itself or of the physical condition of the surrounding soils and buried waste, and for producing a signal representing the physical parameter detected. Also included is a signal processor for receiving signals produced by the sensor device and for developing information identifying the physical parameter detected, either for sounding an alarm, displaying a graphic representation of a physical parameter detected on a viewing screen and/or a hard copy printout. The sensor devices may be deployed in or adjacent the barriers at the same time the barriers are deployed and may be adapted to detect strain or cracking in the barriers, leakage of radiation through the barriers, the presence and leaking through the barriers of volatile organic compounds, or similar physical conditions.

Sensor System Fo4r Buried Waste Containment Sites

DOEpatents

Smith, Ann Marie; Gardner, Bradley M.; Kostelnik, Kevin M.; Partin, Judy K.; Lancaster, Gregory D.; Pfeifer, Mary Catherine

2005-09-27

A sensor system for a buried waste containment site having a bottom wall barrier and/or sidewall barriers, for containing hazardous waste. The sensor system includes one or more sensor devices disposed in one or more of the barriers for detecting a physical parameter either of the barrier itself or of the physical condition of the surrounding soils and buried waste, and for producing a signal representing the physical parameter detected. Also included is a signal processor for receiving signals produced by the sensor device and for developing information identifying the physical parameter detected, either for sounding an alarm, displaying a graphic representation of a physical parameter detected on a viewing screen and/or a hard copy printout. The sensor devices may be deployed in or adjacent the barriers at the same time the barriers are deployed and may be adapted to detect strain or cracking in the barriers, leakage of radiation through the barriers, the presence and leaking through the barriers of volatile organic compounds, or similar physical conditions.

Water treatment capacity of forward osmosis systems utilizing power plant waste heat

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhou, Xingshi; Gingerich, Daniel B.; Mauter, Meagan S.

Forward osmosis (FO) has the potential to improve the energy efficiency of membrane-based water treatment by leveraging waste heat from steam electric power generation as the primary driving force for separation. In this study, we develop a comprehensive FO process model, consisting of membrane separation, heat recovery, and draw solute regeneration (DSR) models. We quantitatively characterize three alternative processes for DSR: distillation, steam stripping, and air stripping. We then construct a mathematical model of the distillation process for DSR that incorporates hydrodynamics, mass and heat transport resistances, and reaction kinetics, and we integrate this into a model for the fullmore » FO process. Finally, we utilize this FO process model to derive a first-order approximation of the water production capacity given the rejected heat quantity and quality available at U.S. electric power facilities. We find that the upper bound of FO water treatment capacity using low-grade heat sources at electric power facilities exceeds process water treatment demand for boiler water make-up and flue gas desulfurization wastewater systems.« less

Water treatment capacity of forward osmosis systems utilizing power plant waste heat

DOE PAGES

Zhou, Xingshi; Gingerich, Daniel B.; Mauter, Meagan S.

2015-06-11

Forward osmosis (FO) has the potential to improve the energy efficiency of membrane-based water treatment by leveraging waste heat from steam electric power generation as the primary driving force for separation. In this study, we develop a comprehensive FO process model, consisting of membrane separation, heat recovery, and draw solute regeneration (DSR) models. We quantitatively characterize three alternative processes for DSR: distillation, steam stripping, and air stripping. We then construct a mathematical model of the distillation process for DSR that incorporates hydrodynamics, mass and heat transport resistances, and reaction kinetics, and we integrate this into a model for the fullmore » FO process. Finally, we utilize this FO process model to derive a first-order approximation of the water production capacity given the rejected heat quantity and quality available at U.S. electric power facilities. We find that the upper bound of FO water treatment capacity using low-grade heat sources at electric power facilities exceeds process water treatment demand for boiler water make-up and flue gas desulfurization wastewater systems.« less

Coupling proton movements to c-ring rotation in F(1)F(o) ATP synthase: aqueous access channels and helix rotations at the a-c interface.

PubMed

Fillingame, Robert H; Angevine, Christine M; Dmitriev, Oleg Y

2002-09-10

F(1)F(o) ATP synthases generate ATP by a rotary catalytic mechanism in which H(+) transport is coupled to rotation of a ring of c subunits within the transmembrane sector of the enzyme. Protons bind to and then are released from the aspartyl-61 residue of subunit c at the center of the membrane. Proton access channels to and from aspartyl-61 are thought to form in subunit a of the F(o) sector. Here, we summarize new information on the structural organization of subunit a and the mapping of aqueous accessible residues in the fourth and fifth transmembrane helices (TMHs). Cysteine substituted residues, lying on opposite faces of aTMH-4, preferentially react with either N-ethyl-maleimide (NEM) or Ag(+). We propose that aTMH-4 rotates to alternately expose each helical face to aspartyl-61 of subunit c during the proton transport cycle. The concerted helical rotation of aTMH-4 and cTMH-2 are proposed to be coupled to the stepwise mechanical movement of the c-rotor.

Ascorbate supplementation inhibits growth and metastasis of B16FO melanoma and 4T1 breast cancer cells in vitamin C-deficient mice.

PubMed

Cha, John; Roomi, M Waheed; Ivanov, Vadim; Kalinovsky, Tatiana; Niedzwiecki, Aleksandra; Rath, Matthias

2013-01-01

Degradation of the extracellular matrix (ECM) plays a critical role in the formation of tumors and metastasis and has been found to correlate with the aggressiveness of tumor growth and invasiveness of cancer. Ascorbic acid, which is known to be essential for the structural integrity of the intercellular matrix, is not produced by humans and must be obtained from the diet. Cancer patients have been shown to have very low reserves of ascorbic acid. Our main objective was to determine the effect of ascorbate supplementation on metastasis, tumor growth and tumor immunohistochemistry in mice unable to synthesize ascorbic acid [gulonolactone oxidase (gulo) knockout (KO)] when challenged with B16FO melanoma or 4T1 breast cancer cells. Gulo KO female mice 36-38 weeks of age were deprived of or maintained on ascorbate in food and water for 4 weeks prior to and 2 weeks post intraperitoneal (IP) injection of 5x105 B16FO murine melanoma cells or to injection of 5x105 4T1 breast cancer cells into the mammary pad of mice. Ascorbate-supplemented gulo KO mice injected with B16FO melanoma cells demonstrated significant reduction (by 71%, p=0.005) in tumor metastasis compared to gulo KO mice on the control diet. The mean tumor weight in ascorbate supplemented mice injected with 4T1 cells was reduced by 28% compared to tumor weight in scorbutic mice. Scorbutic tumors demonstrated large dark cores, associated with increased necrotic areas and breaches to the tumor surface, apoptosis and matrix metalloproteinase-9 (MMP-9), and weak, disorganized or missing collagen I tumor capsule. In contrast, the ascorbate-supplemented group tumors had smaller fainter colored cores and confined areas of necrosis/apoptosis with no breaches from the core to the outside of the tumor and a robust collagen I tumor capsule. In both studies, ascorbate supplementation of gulo KO mice resulted in profoundly decreased serum inflammatory cytokine interleukin (IL)-6 (99% decrease, p=0.01 in the B16F0

Development and implementation of outreach strategies for breast and cervical cancer prevention among African American women. FoCaS Project. Forsyth County Cancer Screening.

PubMed

Tatum, C; Wilson, A; Dignan, M; Paskett, E D; Velez, R

1997-01-01

The purpose of the FoCaS (Forsyth County Cancer Screening) Project was to develop and implement strategies that would improve the beliefs, attitudes, and preventive health habits of populations typically considered hard to reach. Conventional health education methods have not produced substantial results; thus, innovative and unusual strategies are needed. The FoCaS project implemented specific methods to reach the targeted population of African American women aged 40 and older that resides in public housing communities. Five outreach strategies were used: 1) educational classes (group setting and one-on-one sessions) on various topics that relate not to breast and cervical cancer but to women's issues in general; 2) media campaigns strategically scheduled throughout the year; 3) the inclusion of religion in educational classes and community outreach; 4) the use of information centers to distribute materials; and 5) a community-wide cancer-awareness event. These strategies reached women in nonthreatening environments that permitted heavy involvement and easy understanding of the importance of breast and cervical cancer screening. The effects of these strategies on promoting screening will be evaluated using data from the follow-up survey conducted during the spring of 1996.

Secure Data Aggregation in Wireless Sensor Network-Fujisaki Okamoto(FO) Authentication Scheme against Sybil Attack.

PubMed

Nirmal Raja, K; Maraline Beno, M

2017-07-01

In the wireless sensor network(WSN) security is a major issue. There are several network security schemes proposed in research. In the network, malicious nodes obstruct the performance of the network. The network can be vulnerable by Sybil attack. When a node illicitly assertions multiple identities or claims fake IDs, the WSN grieves from an attack named Sybil attack. This attack threatens wireless sensor network in data aggregation, synchronizing system, routing, fair resource allocation and misbehavior detection. Henceforth, the research is carried out to prevent the Sybil attack and increase the performance of the network. This paper presents the novel security mechanism and Fujisaki Okamoto algorithm and also application of the work. The Fujisaki-Okamoto (FO) algorithm is ID based cryptographic scheme and gives strong authentication against Sybil attack. By using Network simulator2 (NS2) the scheme is simulated. In this proposed scheme broadcasting key, time taken for different key sizes, energy consumption, Packet delivery ratio, Throughput were analyzed.

Optimized green fluorescent protein fused to FoF1-ATP synthase for single-molecule FRET using a fast anti-Brownian electrokinetic trap

NASA Astrophysics Data System (ADS)

Dienerowitz, Maria; Ilchenko, Mykhailo; Su, Bertram; Deckers-Hebestreit, Gabriele; Mayer, Günter; Henkel, Thomas; Heitkamp, Thomas; Börsch, Michael

2016-02-01

Observation times of freely diffusing single molecules in solution are limited by the photophysics of the attached fluorescence markers and by a small observation volume in the femtolitre range that is required for a sufficient signal-to-background ratio. To extend diffusion-limited observation times through a confocal detection volume, A. E. Cohen and W. E. Moerner have invented and built the ABELtrap -- a microfluidic device to actively counteract Brownian motion of single nanoparticles with an electrokinetic trap. Here we present a version of an ABELtrap with a laser focus pattern generated by electro-optical beam deflectors and controlled by a programmable FPGA chip. This ABELtrap holds single fluorescent nanoparticles for more than 100 seconds, increasing the observation time of fluorescent nanoparticles compared to free diffusion by a factor of 10000. To monitor conformational changes of individual membrane proteins in real time, we record sequential distance changes between two specifically attached dyes using Förster resonance energy transfer (smFRET). Fusing the a-subunit of the FoF1-ATP synthase with mNeonGreen results in an improved signal-to-background ratio at lower laser excitation powers. This increases our measured trap duration of proteoliposomes beyond 2 s. Additionally, we observe different smFRET levels attributed to varying distances between the FRET donor (mNeonGreen) and acceptor (Alexa568) fluorophore attached at the a- and c-subunit of the FoF1-ATP synthase respectively.

Teaching treatment planning for protons with educational open-source software: experience with FoCa and matRad.

PubMed

Sanchez-Parcerisa, Daniel; Udías, Jose

2018-05-12

Open-source, MATLAB-based treatment planning systems FoCa and matRAD were used in a pilot project for training prospective medical physicists and postgraduate physics students in treatment planning and beam modeling techniques for proton therapy. In the four exercises designed, students learnt how proton pencil beams are modeled and how dose is calculated in three-dimensional voxelized geometries, how pencil beam scanning plans (PBS) are constructed, the rationale behind the choice of spot spacing in patient plans, and the dosimetric differences between photon IMRT and proton PBS plans. Sixty students of two courses participated in the pilot project, with over 90% of satisfactory rating from student surveys. The pilot experience will certainly be continued. © 2018 The Authors. Journal of Applied Clinical Medical Physics published by Wiley Periodicals, Inc. on behalf of American Association of Physicists in Medicine.

Citrulline protects Streptococcus pyogenes from acid stress using the arginine deiminase pathway and the F1Fo-ATPase.

PubMed

Cusumano, Zachary T; Caparon, Michael G

2015-04-01

A common stress encountered by both pathogenic and environmental bacteria is exposure to a low-pH environment, which can inhibit cell growth and lead to cell death. One major defense mechanism against this stress is the arginine deiminase (ADI) pathway, which catabolizes arginine to generate two ammonia molecules and one molecule of ATP. While this pathway typically relies on the utilization of arginine, citrulline has also been shown to enter into the pathway and contribute to protection against acid stress. In the pathogenic bacterium Streptococcus pyogenes, the utilization of citrulline has been demonstrated to contribute to pathogenesis in a murine model of soft tissue infection, although the mechanism underlying its role in infection is unknown. To gain insight into this question, we analyzed a panel of mutants defective in different steps in the ADI pathway to dissect how arginine and citrulline protect S. pyogenes in a low-pH environment. While protection provided by arginine utilization occurred through the buffering of the extracellular environment, citrulline catabolism protection was pH independent, requiring the generation of ATP via the ADI pathway and a functional F1Fo-ATP synthase. This work demonstrates that arginine and citrulline catabolism protect against acid stress through distinct mechanisms and have unique contributions to virulence during an infection. An important aspect of bacterial pathogenesis is the utilization of host-derived nutrients during an infection for growth and virulence. Previously published work from our lab identified a unique role for citrulline catabolism in Streptococcus pyogenes during a soft tissue infection. The present article probes the role of citrulline utilization during this infection and its contribution to protection against acid stress. This work reveals a unique and concerted action between the catabolism of citrulline and the F1Fo-ATPase that function together to provide protection for bacteria in a low

Recycling of Oceanic Lithosphere: Water, fO2 and Fe-isotope Constraints

NASA Technical Reports Server (NTRS)

Bizmis, M.; Peslier, A. H.; McCammon, C. A.; Keshav, S.; Williams, H. M.

2014-01-01

Spinel peridotite and garnet pyroxenite xenoliths from Hawaii provide important clues about the composition of the oceanic lithosphere, and can be used to assess its contribution to mantle heterogeneity upon recycling. The peridotites have lower bulk H2O (approximately 70-114 ppm) than the MORB source, qualitatively consistent with melt depletion. The garnet pyroxenites (high pressure cumulates) have higher H2O (200-460 ppm, up to 550 ppm accounting for phlogopite) and low H2O/Ce ratios (less than 100). The peridotites have relatively light Fe-isotopes (delta Fe -57 = -0.34 to 0.13) that decrease with increasing depletion, while the pyroxenites are significantly heavier (delta Fe-57 up to 0.3). The observed xenolith, as well as MORB and OIB total Fe-isotope variability is larger that can be explained by existing melting models. The high H2O and low H2O/Ce ratios of pyroxenites are similar to estimates of EM-type OIB sources, while their heavy delta Fe-57 are similar to some Society and Cook-Austral basalts. Therefore, recycling of mineralogically enriched oceanic lithosphere (i.e. pyroxenites) may contribute to OIB sources and mantle heterogeneity. The Fe(3+)/Sigma? systematics of these xenoliths also suggest that there might be lateral redox gradients within the lithosphere, between juxtaposed oxidized spinel peridotites (deltaFMQ = -0.7 to 1.6, at 15 kb) and more reduced pyroxenites (deltaFMQ = -2 to -0.4, at 20-25kb). Such mineralogically and compositionally imposed fO2 gradients may generate local redox melting due to changes in fluid speciation (e.g. reduced fluids from pyroxenite encountering more oxidized peridotite). Formation of such incipient, small degree melts could further contribute to metasomatic features seen in peridotites, mantle heterogeneity, as well as the low velocity and high electrical conductivity structures near the base of the lithosphere and upper mantle.

Observing conformations of single FoF1-ATP synthases in a fast anti-Brownian electrokinetic trap

NASA Astrophysics Data System (ADS)

Su, Bertram; Düser, Monika G.; Zarrabi, Nawid; Heitkamp, Thomas; Starke, Ilka; Börsch, Michael

2015-03-01

To monitor conformational changes of individual membrane transporters in liposomes in real time, we attach two fluorophores to selected domains of a protein. Sequential distance changes between the dyes are recorded and analyzed by Förster resonance energy transfer (FRET). Using freely diffusing membrane proteins reconstituted in liposomes, observation times are limited by Brownian motion through the confocal detection volume. A. E. Cohen and W. E. Moerner have invented and built microfluidic devices to actively counteract Brownian motion of single nanoparticles in electrokinetic traps (ABELtrap). Here we present a version of an ABELtrap with a laser focus pattern generated by electro-optical beam deflectors and controlled by a programmable FPGA. This ABELtrap could hold single fluorescent nanobeads for more than 100 seconds, increasing the observation times of a single particle more than 1000-fold. Conformational changes of single FRET-labeled membrane enzymes FoF1-ATP synthase can be detected in the ABELtrap.

Mitochondrial F1Fo-ATP synthase translocates to cell surface in hepatocytes and has high activity in tumor-like acidic and hypoxic environment.

PubMed

Ma, Zhan; Cao, Manlin; Liu, Yiwen; He, Yiqing; Wang, Yingzhi; Yang, Cuixia; Wang, Wenjuan; Du, Yan; Zhou, Muqing; Gao, Feng

2010-08-01

F1Fo-ATP synthase was originally thought to exclusively locate in the inner membrane of the mitochondria. However, recent studies prove the existence of ectopic F1Fo-ATP synthase on the outside of the cell membrane. Ectopic ATP synthase was proposed as a marker for tumor target therapy. Nevertheless, the protein transport mechanism of the ectopic ATP synthase is still unclear. The specificity of the ectopic ATP synthase, with regard to tumors, is questioned because of its widespread expression. In the current study, we constructed green fluorescent protein-ATP5B fusion protein and introduced it into HepG2 cells to study the localization of the ATP synthase. The expression of ATP5B was analyzed in six cell lines with different 'malignancies'. These cells were cultured in both normal and tumor-like acidic and hypoxic conditions. The results suggested that the ectopic expression of ATP synthase is a consequence of translocation from the mitochondria. The expression and catalytic activity of ectopic ATP synthase were similar on the surface of malignant cells as on the surface of less malignant cells. Interestingly, the expression of ectopic ATP synthase was not up-regulated in tumor-like acidic and hypoxic microenvironments. However, the catalytic activity of ectopic ATP synthase was up-regulated in tumor-like microenvironments. Therefore, the specificity of ectopic ATP synthase for tumor target therapy relies on the high level of catalytic activity that is observed in acidic and hypoxic microenvironments in tumor tissues.

Inhibition of pulmonary metastasis of melanoma b16fo cells in C57BL/6 mice by a nutrient mixture consisting of ascorbic Acid, lysine, proline, arginine, and green tea extract.

PubMed

Roomi, M Waheed; Roomi, Nusrath; Ivanov, Vadim; Kalinovsky, Tatiana; Niedzwiecki, Aleksandra; Rath, Matthias

2006-01-01

The authors investigated the effect of a nutrient mixture (NM) on lung metastasis by B16F0 melanoma cells in C57BL/6 female mice. Mice were divided into equal groups (1 to 6) and injected via tail vein with B16F0 cells (groups 1 to 4), B16FO cells pretreated with NM (group 5), or saline (group 6). Groups 1, 3, 4, 5, and 6 were fed the control diet and group 2 the 0.5% NM supplemented diet. Groups 3 and 4 received NM intraperitoneally (IP) and intravenously (IV), respectively. Two weeks later, pulmonary metastatic colonies were counted. Pulmonary colonization was reduced by 63% in mice supplemented with NM diet, by 86% in mice receiving NM by IP and IV injections, and completely inhibited in mice injected with melanoma cells pretreated with NM. These results show that NM is effective in inhibiting the metastasis of B16FO melanoma cells.

Technoeconomic Optimization of Waste Heat Driven Forward Osmosis for Flue Gas Desulfurization Wastewater Treatment

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gingerich, Daniel B; Bartholomew, Timothy V; Mauter, Meagan S

With the Environmental Protection Agency’s recent Effluent Limitation Guidelines for Steam Electric Generators, power plants are having to install and operate new wastewater technologies. Many plants are evaluating desalination technologies as possible compliance options. However, the desalination technologies under review that can reduce wastewater volume or treat to a zero-liquid discharges standard have a significant energy penalty to the plant. Waste heat, available from the exhaust gas or cooling water from coal-fired power plants, offers an opportunity to drive wastewater treatment using thermal desalination technologies. One such technology is forward osmosis (FO). Forward osmosis utilizes an osmotic pressure gradient tomore » passively pull water from a saline or wastewater stream across a semi-permeable membrane and into a more concentrated draw solution. This diluted draw solution is then fed into a distillation column, where the addition of low temperature waste heat can drive the separation to produce a reconcentrated draw solution and treated water for internal plant reuse. The use of low-temperature waste heat decouples water treatment from electricity production and eliminates the link between reducing water pollution and increasing air emissions from auxiliary electricity generation. In order to evaluate the feasibility of waste heat driven FO, we first build a model of an FO system for flue gas desulfurization (FGD) wastewater treatment at coal-fired power plants. This model includes the FO membrane module, the distillation column for draw solution recovery, and waste heat recovery from the exhaust gas. We then add a costing model to account for capital and operating costs of the forward osmosis system. We use this techno-economic model to optimize waste heat driven FO for the treatment of FGD wastewater. We apply this model to three case studies: the National Energy Technology Laboratory (NETL) 550 MW model coal fired power plant without

Observation of the solar eclipse of 20 March 2015 at the Pruhonice station

NASA Astrophysics Data System (ADS)

Mošna, Zbyšek; Boška, Josef; Knížová, Petra Koucká; Šindelářová, Tereza; Kouba, Daniel; Chum, Jaroslav; Rejfek, Luboš; Potužníková, Kateřina; Arikan, Feza; Toker, Cenk

2018-06-01

Response of the atmosphere to the Solar Eclipse on 20 March 2015 is described for mid-latitude region of Czech Republic. For the first time we show join analysis using Digisonde vertical sounding, manually processed Digisonde drift measurement, and Continuous Doppler Sounding for the solar eclipse study. The critical frequencies foE, foF1 and foF2 show changes with different time offset connected to the solar eclipse. Digisonde drift measurement shows significant vertical plasma drifts in F2 region deviating from daily mean course with amplitudes reaching 15-20 m/s corresponding to the time of solar eclipse. Continuous Doppler Sounding shows propagation of waves in the NE direction with velocities between 70 and 100 m/s with a peak 30 min after first contact. We observed increased and persistent wave activity at heights between 150 and 250 km at time about 20-40 min after beginning of SE with central period 65 min.

Fluid-mediated redox transfer in subduction zones: Measuring the intrinsic fO2 of slab fluids in the lab

NASA Astrophysics Data System (ADS)

Iacovino, K.; Till, C. B.

2017-12-01

It is widely observed that arc magmas are the most oxidized magmas on Earth. One frequently cited explanation calls on the flux of aqueous fluid from the highly oxidized down-going slab to catalyze sub-arc mantle melting and impose a highly oxidized redox signature on the mantle wedge. Fluid inclusions from sub-arc mantle xenoliths provide evidence that "slab fluids" may be highly oxidizing (fO2 QFM+1.5; Brandon & Draper, 1996; Frost and Ballhaus, 1998), but for decades, determination of the precise reactive mechanism potentially responsible for the transfer of O2 from slab to mantle has been elusive. Pure H2O has been shown to have insufficient oxidizing capacity to affect mantle redox, but H2O-rich fluids may facilitate the mobilization of Fe3+ or other multivalent cations and/or O2 transfer via the reduction of sulfate, particularly if such fluids are hypersaline. Here we present the first results from experiments designed to investigate fluid-mediated element transfer, including redox reactions, at the slab-mantle interface. These data include the first direct measurements of the intrinsic oxygen fugacity of fluids released during slab dehydration using sliding binary alloy redox sensors. Experiments were performed on natural Fe3+-bearing antigorite serpentinite at 1-2 GPa and 800°C in a piston cylinder at Arizona State University, analogous to conditions in a subducting slab and sufficient to cause the breakdown of starting material into forsteritic olivine, Mg-rich clinopyroxene, magnetite, and aqueous fluid. Experimental time series allow for the detection of (and correction for) any buffering effect on the sample by the experimental assembly. Initial results indicate that the dehydration of sulfur-free antigorite serpentinite can generate fluids with fO2 several orders of magnitude above that of MORB mantle and similar to those observed in natural sub-arc fluid inclusions. Careful measurements of the chemistry of fluid and solid run products will elucidate

TOXICITY APPROACHES TO ASSESSING MINING IMPACTS AND MINE WASTE TREATMENT EFFECTIVENESS

EPA Science Inventory

The USEPA Office of Research and Development's National Exposure Research Laboratory and National Risk Management Research Laboratory have been evaluating the impact of mining sites on receiving streams and the effectiveness of waste treatment technologies in removing toxicity fo...

Beating oxygen: chronic anoxia exposure reduces mitochondrial F1FO-ATPase activity in turtle (Trachemys scripta) heart

PubMed Central

Galli, Gina L. J.; Lau, Gigi Y.; Richards, Jeffrey G.

2013-01-01

SUMMARY The freshwater turtle Trachemys scripta can survive in the complete absence of O2 (anoxia) for periods lasting several months. In mammals, anoxia leads to mitochondrial dysfunction, which culminates in cellular necrosis and apoptosis. Despite the obvious clinical benefits of understanding anoxia tolerance, little is known about the effects of chronic oxygen deprivation on the function of turtle mitochondria. In this study, we compared mitochondrial function in hearts of T. scripta exposed to either normoxia or 2 weeks of complete anoxia at 5°C and during simulated acute anoxia/reoxygenation. Mitochondrial respiration, electron transport chain activities, enzyme activities, proton conductance and membrane potential were measured in permeabilised cardiac fibres and isolated mitochondria. Two weeks of anoxia exposure at 5°C resulted in an increase in lactate, and decreases in ATP, glycogen, pH and phosphocreatine in the heart. Mitochondrial proton conductance and membrane potential were similar between experimental groups, while aerobic capacity was dramatically reduced. The reduced aerobic capacity was the result of a severe downregulation of the F1FO-ATPase (Complex V), which we assessed as a decrease in enzyme activity. Furthermore, in stark contrast to mammalian paradigms, isolated turtle heart mitochondria endured 20 min of anoxia followed by reoxygenation without any impact on subsequent ADP-stimulated O2 consumption (State III respiration) or State IV respiration. Results from this study demonstrate that turtle mitochondria remodel in response to chronic anoxia exposure and a reduction in Complex V activity is a fundamental component of mitochondrial and cellular anoxia survival. PMID:23926310

The costs of fluid overload in the adult intensive care unit: is a small-volume infusion model a proactive solution?

PubMed Central

Child, Debra L; Cao, Zhun; Seiberlich, Laura E; Brown, Harold; Greenberg, Jordan; Swanson, Anne; Sewall, Martha R; Robinson, Scott B

2015-01-01

Purpose Fluid overload (FO) in critically ill patients remains a challenging clinical dilemma, and many continuous intravenous (IV) medications in the US are being delivered as a dilute solution, adding significantly to a patient’s daily intake. This study describes the costs and outcomes of FO in patients receiving multiple continuous infusions. Materials and methods A retrospective study was conducted using a hospital administrative database covering >500 US hospitals. An FO cohort included adult intensive care unit (ICU) patients with a central line receiving IV loop diuretics and 2+ continuous IV infusions on 50%+ of their ICU days; a directly matched non-FO cohort included patients without IV diuretic use. The primary outcome of the study was total hospitalization costs per visit. Additional outcomes were ICU costs, mortality, total and ICU length of stay (LOS), 30-day readmission rates, and ventilator use. Unadjusted descriptive analysis was performed using chi-squared or paired t-tests to compare outcomes between the two cohorts. Results A total of 63,974 patients were identified in each cohort. The total hospitalization cost per visit for the FO cohort was US$15,344 higher than the non-FO cohort (US$42,386 vs US$27,042), and the ICU cost for the FO cohort was US$5,243 higher than the non-FO cohort (US$10,902 vs US$5,659). FO patients had higher mortality (20% vs 16.8%), prolonged LOS (11.5 vs 8.0 days), longer ICU LOS (6.2 vs 3.6 days), higher risk of 30-day readmission (21.8% vs 21.3%), and ventilator usage (47.7% vs 28.3%) than the non-FO cohort (all P<0.05). Conclusion In patients receiving multiple continuous infusions, FO is associated with increased health care resources and costs. Maximally concentrating medications and proactively providing continuous medications in small-volume infusions (SVI) could be a potential solution to prevent iatrogenic FO in critically ill patients. Further prospective research is warranted to assess the impact of the

PHYTOREMEDIATION OF CONTAMINATED SOIL AND GROUND WATER AT HAZARDOUS WASTE SITES

EPA Science Inventory

The purpose of this issue paper is to provide a concise discussion of the processes associated with the use of phytoremediation as a cleanup or containment technique for remediation of hazardous waste sites. Introductory material on plant processes is provided. The different fo...

Examination of marine and vegetable oil oxidation data from a multi-year, third-party database.

PubMed

De Boer, Anna A; Ismail, Adam; Marshall, Keri; Bannenberg, Gerard; Yan, Kevin L; Rowe, William J

2018-07-15

Fish oil (FO) products constitute good sources of omega-3 fats. Oxidation data from a large third-party database of 1900 + globally-sourced FO samples were assessed. In FO products, for peroxide value (PV), 13.9% exceeded 5 mEq O 2 /kg (2.2% >10); for acid value (AcV) 2.1% exceeded 3 mg KOH/g, while for p-anisidine value (pAV) in unflavoured oils, 6.1% exceeded 20, (3.8% >30), and 8.8% exceeded TOTOX limits (26). Additionally, we compared FO with other dietary oils. The FO median PV was similar to those of algal and sunflower oils, 4.8-fold greater than krill oil, and 5.2-fold less than extra-virgin olive oil. The median pAV differed non-significantly among oils. The FO median AcV was similar to those of algal and extra-virgin olive oils, 3.4-fold greater than sunflower oil, and 11.9-fold less than krill oil. This study has provided new insight that retail FO products predominantly meet regulatory guidelines and are comparable in oxidative status to other dietary oils. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

Chemical, biochemical, and environmental fiber sensors IV; Proceedings of the Meeting, Boston, MA, Sept. 8, 9, 1992

NASA Astrophysics Data System (ADS)

Lieberman, Robert A.

Various paper on chemical, biochemical, and environmental fiber sensors are presented. Some of the individual topics addressed include: evanescent-wave fiber optic (FO) biosensor, refractive-index sensors based on coupling to high-index multimode overlays, advanced technique in FO sensors, design of luminescence-based temperature sensors, NIR fluorescence in FO applications, FO sensor based on microencapsulated reagents, emitters and detectors for optical gas and chemical sensing, tunable fiber laser source for methane detection at 1.68 micron, FO fluorometer based on a dual-wavelength laser excitation source, thin polymer films as active components of FO chemical sensors, submicron optical sources for single macromolecule detection, nanometer optical fiber pH sensor. Also discussed are: microfabrication of optical sensor array, luminescent FO sensor for the measurement of pH, time-domain fluorescence methods as applied to pH sensing, characterization of a sol-gel-entrapped artificial receptor, FO technology for nuclear waste cleanup, spectroscopic gas sensing with IR hollow waveguides, dissolved-oxygen quenching of in situ fluorescence measurements.

Comparative analysis of GPS-derived TEC estimates and foF2 observations during storm conditions towards the expansion of ionospheric forecasting capabilities over Europe

NASA Astrophysics Data System (ADS)

Tsagouri, Ioanna; Belehaki, Anna; Elias, Panagiotis

2017-04-01

This paper builts the discussion on the comparative analysis of the variations in the peak electron density at F2 layer and the TEC parameter during a significant number of geomagnetic storm events that occurred in the present solar cycle 24. The ionospheric disturbances are determined through the comparison of actual observations of the foF2 critical frequency and GPS-TEC estimates obtained over European locations with the corresponding median estimates, and they are analysed in conjunction to the solar wind conditions at L1 point that are monitored by the ACE spacecraft. The quantification of the storm impact on the TEC parameter in terms of possible limitations introduced by different TEC derivation methods is carefully addressed.The results reveal similarities and differences in the response of the two parameters with respect to the solar wind drivers of the storms, as well as the local time and the latitude of the observation point. The aforementioned dependences drive the storm-time forecasts of the SWIF model (Solar Wind driven autorgressive model for Ionospheric short-term Forecast), which is operationally implemented in the DIAS system (http://dias.space.noa.gr) and extensively tested in performance at several occassions. In its present version, the model provides alerts and warnings for upcoming ionospheric disturbances, as well as single site and regional forecasts of the foF2 characteristic over Europe up to 24 hours ahead based on the assesment of the solar wind conditions at ACE location. In that respect, the results obtained above support the upgrade of the SWIF's modeling technique in forecasting the storm-time TEC variation within an operational environment several hours in advance. Preliminary results on the evaluation of the model's efficiency in TEC prediction are also discussed, giving special attention in the assesment of the capabilities through the TEC-derivation uncertanties for future discussions.

Effect of changes of femoral offset on abductor and joint reaction forces in total hip arthroplasty.

PubMed

Rüdiger, Hannes A; Guillemin, Maïka; Latypova, Adeliya; Terrier, Alexandre

2017-11-01

Anatomical reconstruction in total hip arthroplasty (THA) allows for physiological muscle function, good functional outcome and implant longevity. Quantitative data on the effect of a loss or gain of femoral offset (FO) are scarce. The aim of this study was to quantitatively describe the effect of FO changes on abductor moment arms, muscle and joint reactions forces. THA was virtually performed on 3D models built from preoperative CT scans of 15 patients undergoing THA. Virtual THA was performed with a perfectly anatomical reconstruction, a loss of 20% of FO (-FO), and a gain of 20% of FO (+FO). These models were combined with a generic musculoskeletal model (OpenSim) to predict moment arms, muscle and joint reaction forces during normal gait cycles. In average, with -FO reconstructions, muscle moment arms decreased, while muscle and hip forces increased significantly (p < 0.001). We observed the opposite with +FO reconstructions. Gluteus medius was more affected than gluteus minimus. -FO had more effect than +FO. A change of 20% of FO induced an average change 8% of abductor moment arms, 16% of their forces, and 6% of the joint reaction force. To our knowledge, this is the first report providing quantitative data on the effect of FO changes on muscle and joint forces during normal gait. A decrease of FO necessitates an increase of abductor muscle force to maintain normal gait, which in turn increases the joint reaction force. This effect underscores the importance of an accurate reconstruction of the femoral offset.

Experimental study of Gas Phase Formation and Evolution in Low fO2 Planetary Basalts.

NASA Astrophysics Data System (ADS)

Rutherford, M. J.; Wetzel, D. T.; Saal, A. E.; Hauri, E. H.

2012-12-01

The existence of a gas phase in planetary basaltic magmas is demonstrated by the ubiquitous presence of vesicles in returned lunar samples and meteorites as well as basalts from Earth and Mars. Additionally, formation of the fine-grained glass bead deposits during eruption of lunar picritic glasses required a large gas-bubble volume (> 90%) at the time of eruption/fragmentation. Up to 100-200 ppm levels of H, S, Cl and F still remain as diffusion-loss profiles in individual lunar glass beads SIMS (1), and higher volatile concentrations occur in olivine melt inclusions (2). The composition and origin of such volcanic gases were investigated by experiments on a volatile (C-O-H-S-Cl-F)-bearing picritic glass composition as a function of fO2 near iron-wustite (IW). The C-O-H species dissolved in gas-saturated basaltic melt above IW-0.5 are carbonate, OH and H2O with 100 to 10,000 ppm H2O in the sample; below IW-0.5, the C-species present (Raman and FTIR) are Fe(CO)5 (iron pentacarbonyl) and lesser CH4 [3]. The change in melt speciation in part reflects a change in calculated speciation in the coexisting gas [4]. The carbon solubility in these experimental melts increases linearly with increasing pressure; the more oxidized glasses contain 32-620 ppm C for pressures of 98 to 980 MPa, the reduced glasses contain 8-240 ppm C for pressures between 36 and 900 MPa. Thus, the C solubility of the more reduced Fe-carbonyl and CH4 is about one-half that of carbonate at the same pressure, and indicates the carrying capacity for C in reduced (i.e., lunar) magmas is much lower than it is in present day terrestrial magmas. Varioles up to 200 um in diameter formed in some experiments with higher dissolved water contents (1%); they have radiating crystalline textures (olivine, glass and poorly crystallized graphite) initiated at a central nucleation site. A sharp peak in the variole Ramen spectra indicates methane as well as CO is released during variole formation and a reaction such

Essential arginine in subunit a and aspartate in subunit c of FoF1 ATP synthase: effect of repositioning within helix 4 of subunit a and helix 2 of subunit c.

PubMed

Langemeyer, Lars; Engelbrecht, Siegfried

2007-07-01

FoF1 ATP synthase couples proton flow through the integral membrane portion Fo (ab2c10) to ATP-synthesis in the extrinsic F1-part ((alphabeta)3gammadeltaepsilon) (Escherichia coli nomenclature and stoichiometry). Coupling occurs by mechanical rotation of subunits c10gammaepsilon relative to (alphabeta)3deltaab2. Two residues were found to be essential for proton flow through ab2c10, namely Arg210 in subunit a (aR210) and Asp61 in subunits c (cD61). Their deletion abolishes proton flow, but "horizontal" repositioning, by anchoring them in adjacent transmembrane helices, restores function. Here, we investigated the effects of "vertical" repositioning aR210, cD61, or both by one helical turn towards the N- or C-termini of their original helices. Other than in the horizontal the vertical displacement changes the positions of the side chains within the depth of the membrane. Mutant aR210A/aN214R appeared to be short-circuited in that it supported proton conduction only through EF1-depleted EFo, but not in EFoEF1, nor ATP-driven proton pumping. Mutant cD61N/cM65D grew on succinate, retained the ability to synthesize ATP and supported passive proton conduction but apparently not ATP hydrolysis-driven proton pumping.

Development of an aerosol microphysical module: Aerosol Two-dimensional bin module for foRmation and Aging Simulation (ATRAS)

NASA Astrophysics Data System (ADS)

Matsui, H.; Koike, M.; Kondo, Y.; Fast, J. D.; Takigawa, M.

2014-09-01

Number concentrations, size distributions, and mixing states of aerosols are essential parameters for accurate estimations of aerosol direct and indirect effects. In this study, we develop an aerosol module, designated the Aerosol Two-dimensional bin module for foRmation and Aging Simulation (ATRAS), that can explicitly represent these parameters by considering new particle formation (NPF), black carbon (BC) aging, and secondary organic aerosol (SOA) processes. A two-dimensional bin representation is used for particles with dry diameters from 40 nm to 10 μm to resolve both aerosol sizes (12 bins) and BC mixing states (10 bins) for a total of 120 bins. The particles with diameters between 1 and 40 nm are resolved using additional eight size bins to calculate NPF. The ATRAS module is implemented in the WRF-Chem model and applied to examine the sensitivity of simulated mass, number, size distributions, and optical and radiative parameters of aerosols to NPF, BC aging, and SOA processes over East Asia during the spring of 2009. The BC absorption enhancement by coating materials is about 50% over East Asia during the spring, and the contribution of SOA processes to the absorption enhancement is estimated to be 10-20% over northern East Asia and 20-35% over southern East Asia. A clear north-south contrast is also found between the impacts of NPF and SOA processes on cloud condensation nuclei (CCN) concentrations: NPF increases CCN concentrations at higher supersaturations (smaller particles) over northern East Asia, whereas SOA increases CCN concentrations at lower supersaturations (larger particles) over southern East Asia. The application of ATRAS in East Asia also shows that the impact of each process on each optical and radiative parameter depends strongly on the process and the parameter in question. The module can be used in the future as a benchmark model to evaluate the accuracy of simpler aerosol models and examine interactions between NPF, BC aging, and SOA

Development of an aerosol microphysical module: Aerosol Two-dimensional bin module for foRmation and Aging Simulation (ATRAS)

DOE Office of Scientific and Technical Information (OSTI.GOV)

Matsui, H.; Koike, Makoto; Kondo, Yutaka

2014-09-30

Number concentrations, size distributions, and mixing states of aerosols are essential parameters for accurate estimation of aerosol direct and indirect effects. In this study, we developed an aerosol module, designated Aerosol Two-dimensional bin module for foRmation and Aging Simulation (ATRAS), that can represent these parameters explicitly by considering new particle formation (NPF), black carbon (BC) aging, and secondary organic aerosol (SOA) processes. A two-dimensional bin representation is used for particles with dry diameters from 40 nm to 10 µm to resolve both aerosol size (12 bins) and BC mixing state (10 bins) for a total of 120 bins. The particlesmore » with diameters from 1 to 40 nm are resolved using an additional 8 size bins to calculate NPF. The ATRAS module was implemented in the WRF-chem model and applied to examine the sensitivity of simulated mass, number, size distributions, and optical and radiative parameters of aerosols to NPF, BC aging and SOA processes over East Asia during the spring of 2009. BC absorption enhancement by coating materials was about 50% over East Asia during the spring, and the contribution of SOA processes to the absorption enhancement was estimated to be 10 – 20% over northern East Asia and 20 – 35% over southern East Asia. A clear north-south contrast was also found between the impacts of NPF and SOA processes on cloud condensation nuclei (CCN) concentrations: NPF increased CCN concentrations at higher supersaturations (smaller particles) over northern East Asia, whereas SOA increased CCN concentrations at lower supersaturations (larger particles) over southern East Asia. Application of ATRAS to East Asia also showed that the impact of each process on each optical and radiative parameter depended strongly on the process and the parameter in question. The module can be used in the future as a benchmark model to evaluate the accuracy of simpler aerosol models and examine interactions between NPF, BC aging, and SOA

Effect of dietary fish oil supplements alone or in combination with sunflower and linseed oil on ruminal lipid metabolism and bacterial populations in lactating cows.

PubMed

Kairenius, P; Leskinen, H; Toivonen, V; Muetzel, S; Ahvenjärvi, S; Vanhatalo, A; Huhtanen, P; Wallace, R J; Shingfield, K J

2018-04-01

Fish oil (FO) alters ruminal biohydrogenation causing trans fatty acid (FA) intermediates to accumulate, but the effects of 18-carbon polyunsaturated FA supply on ruminal long-chain FA metabolism and microbial communities in cattle fed FO are not well established. Four cows fitted with rumen cannula were used in a 4 × 4 Latin square with 21-d experimental periods to evaluate the effects of FO alone or in combination with plant oils high in 18:2n-6 or 18:3n-3 on rumen microbial ecology and flow of FA at the omasum. Treatments comprised a basal grass silage-based diet containing no additional oil (control) or supplements of FO (200 g/d) or FO (200 g/d) plus 500 g/d of sunflower oil (SFO) or linseed oil (LFO). Flow of FA was determined using the omasal sampling technique. The relative abundance of key biohydrogenating bacteria was assessed by quantitative PCR on 16S rRNA genes in omasal digesta. Fish oil-supplemented treatments increased the amounts of trans-18:1, trans-18:2, and 20- to 22-carbon polyunsaturated FA escaping the rumen. Relative to the control, oil supplements had no effect on the amount of 18:0 leaving the rumen, but LFO decreased the flow of 18:0 at the omasum compared with SFO. Both SFO and LFO increased trans-18:1 relative to FO, whereas LFO resulted in the highest trans-18:2 and 20- to 22-carbon FA flow. Supplements of FO plus plant oils shifted biohydrogenation toward trans-10 18:1 formation. Compared with FO alone, the ruminal metabolism of 22:6n-3 in the rumen of lactating cows is more extensive on diets containing higher amounts of 18-carbon polyunsaturated FA. However, the biohydrogenation of 22:5n-3 was less extensive in LFO than SFO, but showed no difference between FO and diets containing plant oils. Ruminal outflow of 20:5n-3 was not altered when plant oils were added to FO. Alterations in the amount of intermediates at the omasum or ruminal biohydrogenation pathways were not accompanied by major changes in analyzed bacterial populations

Influence of cafeteria diet and fish oil in pregnancy and lactation on pups' body weight and fatty acid profiles in rats.

PubMed

Sánchez-Blanco, Clara; Amusquivar, Encarnación; Bispo, Kenia; Herrera, Emilio

2016-06-01

The aim was to determine the effects of cafeteria diet (CD) and fish oil supplements given to pregnant and lactating rats on the birth weight and fatty acid profiles of their offspring. Female rats were given standard diet (STD) or CD for 22 days before pregnancy. After mating, some animals remained on STD or CD; for some CD rats, the diet was supplemented with 8.78 % fish oil (CD-FO). After 12 days, half the CD-FO group returned to CD (CD-FO12) and the others remained on CD-FO. At birth, body weights of pups of the three CD groups were lower than STD, maintained until 21 days in the CD-FO group only. At the end of lactation, dams of the CD groups had increased plasma triacylglycerols (TAG), non-esterified fatty acids, and glycerol concentrations, whereas most n-6 long-chain polyunsaturated fatty acids (LCPUFA) were decreased, the effect being greatest in the CD-FO group, where most n-3 LCPUFA were increased and indices of Δ(5) and Δ(6) desaturase activities decreased. The 21-day-old pups of the CD group had increased plasma TAG, not present in the CD-FO group, which had increased 3-hydroxybutyrate concentrations. In both 2- and 21-day-old CD pups, plasma concentrations of ARA were lower than STD, and even lower in the two CD-FO groups. The effect of CD and CD-FO decreasing pups body weight could be related to decreased concentrations of ARA, caused by the inhibition of the Δ(5) and Δ(6) desaturases in the pathway of n-6 LCPUFA biosynthesis.

9 CFR 592.20 - Kinds of services available.

Code of Federal Regulations, 2014 CFR

2014-01-01

... 9 Animals and Animal Products 2 2014-01-01 2014-01-01 false Kinds of services available. 592.20 Section 592.20 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EGG PRODUCTS INSPECTION VOLUNTARY INSPECTION OF EGG PRODUCTS General § 592.20 Kinds of services available. The regulations in this part provide fo...

9 CFR 592.20 - Kinds of services available.

Code of Federal Regulations, 2013 CFR

2013-01-01

... 9 Animals and Animal Products 2 2013-01-01 2013-01-01 false Kinds of services available. 592.20 Section 592.20 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EGG PRODUCTS INSPECTION VOLUNTARY INSPECTION OF EGG PRODUCTS General § 592.20 Kinds of services available. The regulations in this part provide fo...

9 CFR 592.20 - Kinds of services available.

Code of Federal Regulations, 2011 CFR

2011-01-01

... 9 Animals and Animal Products 2 2011-01-01 2011-01-01 false Kinds of services available. 592.20 Section 592.20 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EGG PRODUCTS INSPECTION VOLUNTARY INSPECTION OF EGG PRODUCTS General § 592.20 Kinds of services available. The regulations in this part provide fo...

9 CFR 592.20 - Kinds of services available.

Code of Federal Regulations, 2012 CFR

2012-01-01

... 9 Animals and Animal Products 2 2012-01-01 2012-01-01 false Kinds of services available. 592.20 Section 592.20 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EGG PRODUCTS INSPECTION VOLUNTARY INSPECTION OF EGG PRODUCTS General § 592.20 Kinds of services available. The regulations in this part provide fo...

Comparative Study of foF2 Measurements with IRI-2007 Model Predictions During Extended Solar Minimum

NASA Technical Reports Server (NTRS)

Zakharenkova, I. E.; Krankowski, A.; Bilitza, D.; Cherniak, Iu.V.; Shagimuratov, I.I.; Sieradzki, R.

2013-01-01

The unusually deep and extended solar minimum of cycle 2324 made it very difficult to predict the solar indices 1 or 2 years into the future. Most of the predictions were proven wrong by the actual observed indices. IRI gets its solar, magnetic, and ionospheric indices from an indices file that is updated twice a year. In recent years, due to the unusual solar minimum, predictions had to be corrected downward with every new indices update. In this paper we analyse how much the uncertainties in the predictability of solar activity indices affect the IRI outcome and how the IRI values calculated with predicted and observed indices compared to the actual measurements.Monthly median values of F2 layer critical frequency (foF2) derived from the ionosonde measurements at the mid-latitude ionospheric station Juliusruh were compared with the International Reference Ionosphere (IRI-2007) model predictions. The analysis found that IRIprovides reliable results that compare well with actual measurements, when the definite (observed and adjusted) indices of solar activityare used, while IRI values based on earlier predictions of these indices noticeably overestimated the measurements during the solar minimum.One of the principal objectives of this paper is to direct attention of IRI users to update their solar activity indices files regularly.Use of an older index file can lead to serious IRI overestimations of F-region electron density during the recent extended solar minimum.

Hydrothermal carbonization of autoclaved municipal solid waste pulp and anaerobically treated pulp digestate

USDA-ARS?s Scientific Manuscript database

In this study, the autoclaved organic fraction of municipal solid waste pulp (OFMSW) and the digestate from OFMSW pulp after anaerobic digestion (AD) were processed by hydrothermal carbonization (HTC) at 200, 250, and 300 °C for 30 min and 2 h. The focus of this work was to evaluate the potential fo...

Production and assay of forskolin antibodies

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ho, L.T.; Ho, R.J.

1986-05-01

Forskolin (Fo), a cardiovascular active diterpene of plant origin, has been widely used as a research tool in regulation of the catalytic activity of adenylate cyclase (AC). A linear relationship of Fo binding to plasma membrane with activation of AC has been reported. The present abstract describes the production and assay of Fo antibodies (AB). 7-0-Hemisuccinyl-7-deacetyl Fo, coupled to either human serum albumin or goat IgG, was injected into goats to elicit AB to Fo haptan. AB to Fo in antiserum or an isolated IgG fraction was tested by two assay methods, a radioimmunoassay using /sup 3/H-Fo as a tracermore » and a colorimetric enzyme-linked immunosorbent assay (ELISA) using horse radish peroxidase-rabbit anti goat IgG as indicator. The titers for Fo antiserum were 4000-10,000. In the defined assay condition, approximately 20-25% of the added /sup 3/H-Fo was found to bind to AB. The bound radioactivity was displaced by Fo-HSA or Fo-goat IgG or free unlabelled Fo ranging from 0.5-50 pmol/tube, or 5-500 nM. The IC/sub 50/ was approximately 8-10 pmol/tube or 80-100 nM. The binding of HRP-rabbit anti goat IgG in the ELISA was inhibited by proper Fo conjugate. The development of methods for production and assay for Fo AB may be useful in the study of mechanism of activation of AC by Fo and Fo-like compound.« less

A hybrid method for quasi-three-dimensional slope stability analysis in a municipal solid waste landfill.

PubMed

Yu, L; Batlle, F

2011-12-01

Limited space for accommodating the ever increasing mounds of municipal solid waste (MSW) demands the capacity of MSW landfill be maximized by building landfills to greater heights with steeper slopes. This situation has raised concerns regarding the stability of high MSW landfills. A hybrid method for quasi-three-dimensional slope stability analysis based on the finite element stress analysis was applied in a case study at a MSW landfill in north-east Spain. Potential slides can be assumed to be located within the waste mass due to the lack of weak foundation soils and geosynthetic membranes at the landfill base. The only triggering factor of deep-seated slope failure is the higher leachate level and the relatively high and steep slope in the front. The valley-shaped geometry and layered construction procedure at the site make three-dimensional slope stability analyses necessary for this landfill. In the finite element stress analysis, variations of leachate level during construction and continuous settlement of the landfill were taken into account. The "equivalent" three-dimensional factor of safety (FoS) was computed from the individual result of the two-dimensional analysis for a series of evenly spaced cross sections within the potential sliding body. Results indicate that the hybrid method for quasi-three-dimensional slope stability analysis adopted in this paper is capable of locating roughly the spatial position of the potential sliding mass. This easy to manipulate method can serve as an engineering tool in the preliminary estimate of the FoS as well as the approximate position and extent of the potential sliding mass. The result that FoS obtained from three-dimensional analysis increases as much as 50% compared to that from two-dimensional analysis implies the significance of the three-dimensional effect for this study-case. Influences of shear parameters, time elapse after landfill closure, leachate level as well as unit weight of waste on FoS were also

Role of afferent input in load-dependent plasticity of rat muscle

NASA Astrophysics Data System (ADS)

Kawano, F.; Umemoto, S.; Higo, Y.; Kawabe, N.; Wang, X. D.; Lan, Y. B.; Ohira, Y.

We have been studying the role of afferent input in the plasticity of skeletal muscles. The present study was performed to investigate the mechanisms responsible for the deafferentation-related inhibition of the compensatory hypertrophy in rat soleus muscle. Adult male Wistar rats were randomly separated into the control, functionally overloaded (FO), and functionally overloaded + deafferentation (FO+DA) group. The tendons of plantaris and gastrocnemius muscles were transected in the FO rats. The dorsal roots of the spinal cord at the L4-5 segmental levels were additionally transected in the FO+DA rats. The sampling of the soleus was performed 2 weeks after the surgery and ambulation recovery. The single muscle fibers were isolated in low-calcium relaxing solution. Further, the myonuclei or argyrophilic nucleolar organizer regions (AgNORs) were stained. Significant increase of the fiber cross-sectional area (CSA) was seen in the FO, but not in the FO+DA, rats. The myonuclear number in fiber was significantly decreased by FO. Addition of DA to FO further promoted the reduction of myonuclear number. The mean nucleus size and DNA content in single nucleus in all groups were identical. Although a single or double AgNORs were seen in ~90% of myonuclei in the control rats, their distributions were 72 and 76% in the FO and FO+DA rats, respectively (p<0.05). More myonuclei containing 3-5 AgNORs were noted in the FO and FO+DA rats. The mean number of the AgNORs per myonucleus was 1.7 in the control, 2.1 in both FO and FO+DA rats (p<0.05). It was suggested that the FO-related increase of the number of AgNORs may be responsible for the induction of compensatory hypertrophy. It was also indicated that intact afferent input plays an essential role in these phenomena.

Maintenance of myonuclear domain size in rat soleus after overload and growth hormone/IGF-I treatment

NASA Technical Reports Server (NTRS)

McCall, G. E.; Allen, D. L.; Linderman, J. K.; Grindeland, R. E.; Roy, R. R.; Mukku, V. R.; Edgerton, V. R.

1998-01-01

The purpose of this study was to determine the effects of functional overload (FO) combined with growth hormone/insulin-like growth factor I (GH/IGF-I) administration on myonuclear number and domain size in rat soleus muscle fibers. Adult female rats underwent bilateral ablation of the plantaris and gastrocnemius muscles and, after 7 days of recovery, were injected three times daily for 14 days with GH/IGF-I (1 mg/kg each; FO + GH/IGF-I group) or saline vehicle (FO group). Intact rats receiving saline vehicle served as controls (Con group). Muscle wet weight was 32% greater in the FO than in the Con group: 162 +/- 8 vs. 123 +/- 16 mg. Muscle weight in the FO + GH/IGF-I group (196 +/- 14 mg) was 59 and 21% larger than in the Con and FO groups, respectively. Mean soleus fiber cross-sectional area of the FO + GH/IGF-I group (2,826 +/- 445 microm2) was increased compared with the Con (2,044 +/- 108 microm2) and FO (2,267 +/- 301 microm2) groups. The difference in fiber size between the FO and Con groups was not significant. Mean myonuclear number increased in FO (187 +/- 15 myonuclei/mm) and FO + GH/IGF-I (217 +/- 23 myonuclei/mm) rats compared with Con (155 +/- 12 myonuclei/mm) rats, although the difference between FO and FO + GH/IGF-I animals was not significant. The mean cytoplasmic volume per myonucleus (myonuclear domain) was similar across groups. These results demonstrate that the larger mean muscle weight and fiber cross-sectional area occurred when FO was combined with GH/IGF-I administration and that myonuclear number increased concomitantly with fiber volume. Thus there appears to be some mechanism(s) that maintains the myonuclear domain when a fiber hypertrophies.

A Combination of Flaxseed Oil and Astaxanthin Improves Hepatic Lipid Accumulation and Reduces Oxidative Stress in High Fat-Diet Fed Rats

PubMed Central

Xu, Jiqu; Rong, Shuang; Gao, Hui; Chen, Chang; Yang, Wei; Deng, Qianchun; Huang, Qingde; Xiao, Lingyun; Huang, Fenghong

2017-01-01

Hepatic lipid accumulation and oxidative stress are crucial pathophysiological mechanisms for non-alcoholic fatty liver disease (NAFLD). Thus, we examined the effect of a combination of flaxseed oil (FO) and astaxanthin (ASX) on hepatic lipid accumulation and oxidative stress in rats fed a high-fat diet. ASX was dissolved in flaxseed oil (1 g/kg; FO + ASX). Animals were fed diets containing 20% fat, where the source was lard, or 75% lard and 25% FO + ASX, or 50% lard and 50% FO + ASX, or FO + ASX, for 10 weeks. Substitution of lard with FO + ASX reduced steatosis and reduced hepatic triacylglycerol and cholesterol. The combination of FO and ASX significantly decreased hepatic sterol regulatory element-binding transcription factor 1 and 3-hydroxy-3-methylglutaryl-CoA reductase but increased peroxisome proliferator activated receptor expression. FO + ASX significantly suppressed fatty acid synthase and acetyl CoA carboxylase but induced carnitine palmitoyl transferase-1 and acyl CoA oxidase expression. FO + ASX also significantly elevated hepatic SOD, CAT and GPx activity and GSH, and markedly reduced hepatic lipid peroxidation. Thus, FO and ASX may reduce NAFLD by reversing hepatic steatosis and reducing lipid accumulation and oxidative stress. PMID:28335388

The effects of dietary fish oil on exercising skeletal muscle vascular and metabolic control in chronic heart failure rats.

PubMed

Holdsworth, Clark T; Copp, Steven W; Hirai, Daniel M; Ferguson, Scott K; Sims, Gabrielle E; Hageman, Karen S; Stebbins, Charles L; Poole, David C; Musch, Timothy I

2014-03-01

Impaired vasomotor control in chronic heart failure (CHF) is due partly to decrements in nitric oxide synthase (NOS) mediated vasodilation. Exercising muscle blood flow (BF) is augmented with polyunsaturated fatty acid (PUFA) supplementation via fish oil (FO) in healthy rats. We hypothesized that FO would augment exercising muscle BF in CHF rats via increased NO-bioavailability. Myocardial infarction (coronary artery ligation) induced CHF in Sprague-Dawley rats which were subsequently randomized to dietary FO (20% docosahexaenoic acid, 30% eicosapentaenoic acid, n = 15) or safflower oil (SO, 5%, n = 10) for 6-8 weeks. Mean arterial pressure (MAP), blood [lactate], and hindlimb muscles BF (radiolabeled microspheres) were determined at rest, during treadmill exercise (20 m·min(-1), 5% incline) and exercise + N(G)-nitro-l-arginine-methyl-ester (l-NAME) (a nonspecific NOS inhibitor). FO did not change left ventricular end-diastolic pressure (SO: 14 ± 2; FO: 11 ± 1 mm Hg, p > 0.05). During exercise, MAP (SO: 128 ± 3; FO: 132 ± 3 mm Hg) and blood [lactate] (SO: 3.8 ± 0.4; FO: 4.6 ± 0.5 mmol·L(-1)) were not different (p > 0.05). Exercising hindlimb muscle BF was lower in FO than SO (SO: 120 ± 11; FO: 93 ± 4 mL·min(-1)·100 g(-1), p < 0.05) but was not differentially affected by l-NAME. Specifically, 17 of 28 individual muscle BF's were lower (p < 0.05) in FO demonstrating that PUFA supplementation with FO in CHF rats does not augment muscle BF during exercise but may lower metabolic cost.

Fullerenes, Organics and the Diffuse Interstellar Bands

NASA Astrophysics Data System (ADS)

Foing, Bernard H.

2016-07-01

The status of DIB research has strongly advanced since 20 years [1], as well as the quest for fullerenes, PAHs and large organics in space. In 1994 we reported the discovery of two near IR diffuse bands coincident with C60+, confirmed in subsequent years [2-6] and now by latest laboratory experiments. A number of DIB observational studies have been published, dealing with: DIB surveys [1,7-10]; measurements of DIB families, correlations and environment dependences [11-14]; extragalactic DIBs [15, 16]. Resolved substructures were detected [17,18] and compared to predicted rotational contours by large molecules [19]. Polarisation studies provided upper limits constraints [20, 21]. DIBs carriers have been linked with organic molecules observed in the interstellar medium [22-25] such as IR bands (assigned to PAHs), Extended Red Emission or recently detected Anomalous Microwave Emission (AME, assigned to spinning dust) and with spectroscopic IR emission bands measured with ISO or Spitzer. Fullerenes and PAHs have been proposed to explain some DIBs and specific molecules were searched in DIB spectra [eg 2-6, 26-31]. These could be present in various dehydrogenation and ionisation conditions [32,33]. Experiments in the laboratory and in space [eg 34-36] allow to measure the survival and by-products of these molecules. We review DIB observational results and their interpretation, and discuss the presence of large organics, fullerenes, PAHs, graphenes in space. References [1] Herbig, G. 1995 ARA&A33, 19; [2] Foing, B. & Ehrenfreund, P. 1994 Natur 369, 296; [3] Foing, B. & Ehrenfreund, P. 1997 A&A317, L59; [4] Foing, B. & Ehrenfreund, P. 1995 ASSL202, 65; [5] Ehrenfreund, P., Foing, B. H. 1997 AdSpR19, 1033; [6] Galazutdinov, G. A. et al. 2000 MNRAS317, 750; [7] Jenniskens, P., Desert, F.-X. 1994 A&AS106, 39; [8] Ehrenfreund, P. et al. 1997 A&A318, L28; [9] Tuairisg, S. Ó. et al. 2000 A&AS142, 225; [10] Cox, N. et al. 2005 A&A438, 187; [11] Cami, J. et al. 1997A&A.326, 822

Medium-chain triglycerides and monounsaturated fatty acids potentiate the beneficial effects of fish oil on selected cardiovascular risk factors in rats.

PubMed

Kondreddy, Vijay Kumar Reddy; Anikisetty, Maheswaraiah; Naidu, Kamatham Akhilender

2016-02-01

Fish oil (FO) rich in eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) is known to reduce the risk of cardiovascular diseases (CVDs). Little information is known regarding the influence of lipid composition in the background diet on the modulatory effect of FO supplementation on CVDs. The present study was designed to investigate the influence of various background dietary lipids and FO on selected cardiovascular risk factors in rats. Adult Wistar rats were fed semisynthetic diet with FO at 1.0% or 2.0% along with other lipids, namely, medium-chain triacylglycerols (MCTs), monounsaturated fatty acids (MUFAs), n-6 polyunsaturated fatty acids (PUFAs) and n-3 PUFAs, for 5 weeks. Some of the potent CVD risk factors were estimated in the rats. FO at 1.0% and 2.0% has significantly reduced serum lipid peroxides, total cholesterol, triglycerides (TAGs), tumor necrosis factor-α, interleukin-6 and C-reactive protein; liver and adipose TAG and cholesterol levels in MCT, MUFA and n-6 PUFA diet groups. Notably, these alterations were comparatively higher in 1.0% FO-substituted MCT and MUFA diet groups. Interestingly, feeding of FO along with n-3 PUFAs did not show additive effect in attenuation of these factors. Serum liver EPA and DHA levels were remarkably elevated in rats fed FO-enriched MCT or MUFA diets. Our results suggest that MCTs or MUFAs in the background diet might promote the beneficial effects of FO on CVDs. Copyright © 2015 Elsevier Inc. All rights reserved.

Electrostatic Accelerometer for the Gravity Recovery and Climate Experiment Follow-On Mission (GRACE FO)

NASA Astrophysics Data System (ADS)

Perrot, Eddy; Boulanger, Damien; Christophe, Bruno; Foulon, Bernard; Liorzou, Françoise; Lebat, Vincent

2014-05-01

The GRACE FO mission, led by the JPL (Jet Propulsion Laboratory), is an Earth-orbiting gravity mission, continuation of the GRACE mission, that will produce an accurate model of the Earth's gravity field variation providing global climatic data during five year at least. The mission involves two satellites in a loosely controlled tandem formation, with a micro-wave link, and optionally a laser link, measuring the inter-satellites distance variation. Non-uniformities in the distribution of the Earth's mass cause the distance between the two satellites to vary. This variation is measured to recover gravity, after subtracting the non-gravitational contributors, as the residual drag. ONERA (the French Aerospace Lab) is developing, manufacturing and testing electrostatic accelerometers measuring this residual drag applied on the satellites. The accelerometer is composed of two main parts: the Sensor Unit (including the Sensor Unit Mechanics - SUM - and the Front-End Electronic Unit - FEEU) and the Interface Control Unit. In the Accelerometer Core, located in the Sensor Unit Mechanics, the proof mass is levitated and maintained in a center of an electrode cage by electrostatic forces. Thus, any drag acceleration applied on the satellite involves a variation on the servo-controlled electrostatic suspension of the mass. The voltage on the electrodes providing this electrostatic force is the measurement output of the accelerometer. The Preliminary Design Review was achieved successfully on November 2013. The FEEU Engineering Model is under test. Preliminary results on electronic unit will be compared with the expected performance. The integration of the SUM Engineering Model and the first ground levitation of the proof-mass will be presented. The impact of the accelerometer defaults (geometry, electronic and parasitic forces) leads to bias, misalignment and scale factor error, non-linearity and noise. Some of these accelerometer defaults are characterized by tests with

Foramen ovale puncture, lesioning accuracy, and avoiding complications: microsurgical anatomy study with clinical implications.

PubMed

Peris-Celda, Maria; Graziano, Francesca; Russo, Vittorio; Mericle, Robert A; Ulm, Arthur J

2013-11-01

Foramen ovale (FO) puncture allows for trigeminal neuralgia treatment, FO electrode placement, and selected biopsy studies. The goals of this study were to demonstrate the anatomical basis of complications related to FO puncture, and provide anatomical landmarks for improvement of safety, selective lesioning of the trigeminal nerve (TN), and optimal placement of electrodes. Both sides of 50 dry skulls were studied to obtain the distances from the FO to relevant cranial base references. A total of 36 sides from 18 formalin-fixed specimens were dissected for Meckel cave and TN measurements. The best radiographic projection for FO visualization was assessed in 40 skulls, and the optimal trajectory angles, insertion depths, and topographies of the lesions were evaluated in 17 specimens. In addition, the differences in postoperative pain relief after the radiofrequency procedure among different branches of the TN were statistically assessed in 49 patients to determine if there was any TN branch less efficiently targeted. Most severe complications during FO puncture are related to incorrect needle placement intracranially or extracranially. The needle should be inserted 25 mm lateral to the oral commissure, forming an approximately 45° angle with the hard palate in the lateral radiographic view, directed 20° medially in the anteroposterior view. Once the needle reaches the FO, it can be advanced by 20 mm, on average, up to the petrous ridge. If the needle/radiofrequency electrode tip remains more than 18 mm away from the midline, injury to the cavernous carotid artery is minimized. Anatomically there is less potential for complications when the needle/radiofrequency electrode is advanced no more than 2 mm away from the clival line in the lateral view, when the needle pierces the medial part of the FO toward the medial part of the trigeminal impression in the petrous ridge, and no more than 4 mm in the lateral part. The 40°/45° inferior transfacial-20° oblique

CO2 Solubility in Rhyolitic Melts as a Function of P, T, and fO2 - Implications for Carbon Flux in Subduction Zones

NASA Astrophysics Data System (ADS)

Duncan, M. S.; Dasgupta, R.

2013-12-01

Understanding the balance between subduction inputs vs. arc output of carbon is critical for constraining the global carbon cycle. However, the agent of carbon transfer from slab to sub-arc mantle is not constrained [1]. Partial melt of ocean-floor sediments is thought to be a key agent of mass transfer in subduction zones, accounting for the trace element characteristics of arc magmas [2]. Yet the carbon carrying capacity of rhyolitic partial melts of sediments remains unknown at sub-arc depths. In our previous work [3], we constrained CO2 solubility of natural rhyolite from 1.5-3.0 GPa, 1300 °C and logfO2 at FMQ×1.0. However, the effects of T and fO2 on CO2 solubility remain unconstrained. In particular, for sediments with organic carbon, graphite stability is expected and the fO2 of C-dissolution can be lower, which may affect the solubility. Thus it is critical to constrain the CO2 solubility of sediment partial melts under graphite-saturated conditions. We determined CO2 solubility of a model rhyolite composition, similar to partial melt composition of natural metapelite [4], at graphite saturation, using Pt/Gr capsules and a piston cylinder device. Experiments were conducted at 1.5-3.0 GPa and 1100-1400 °C. FTIR was employed to measure the concentrations of CO2 and H2O in doubly polished experimental glasses. Raman and SIMS were used to determine the presence of reduced carbon species and total carbon, respectively. FTIR spectra reveal that CO2 is dissolved as both molecular CO2 (CO2mol.) and carbonates (CO32-). For graphite-saturated, hydrous melts with measured H2O ~2.0 wt.%, CO2tot. (CO2mol.+CO32-) values increase with increasing P from ~0.6 to 1.2 wt.% from 1.5 to 3.0 GPa at 1300 °C. These values are lower than more oxidized melts with the same water content, which were 0.85 to 1.99 wt.% CO2 as P increased. At 3 GPa, graphite-saturated experiments from 1100 to 1300 °C yield CO2tot. value of 1.18-1.20 wt.%, suggesting minor effect of temperature in

Recovery of nitrogen and water from landfill leachate by a microbial electrolysis cell-forward osmosis system.

PubMed

Qin, Mohan; Molitor, Hannah; Brazil, Brian; Novak, John T; He, Zhen

2016-01-01

A microbial electrolysis cell (MEC)-forward osmosis (FO) system was previously reported for recovering ammonium and water from synthetic solutions, and here it has been advanced with treating landfill leachate. In the MEC, 65.7±9.1% of ammonium could be recovered in the presence of cathode aeration. Without aeration, the MEC could remove 54.1±10.9% of ammonium from the leachate, but little ammonia was recovered. With 2M NH4HCO3 as the draw solution, the FO process achieved 51% water recovery from the MEC anode effluent in 3.5-h operation, higher than that from the raw leachate. The recovered ammonia was used as a draw solute in the FO for successful water recovery from the treated leachate. Despite the challenges with treating returning solution from the FO, this MEC-FO system has demonstrated the potential for resource recovery from wastes, and provide a new solution for sustainable leachate management. Copyright © 2015 Elsevier Ltd. All rights reserved.

Short-term effects of military fog oil on the fountain darter (Etheostoma fonticola).

PubMed

Ryan, T A; Kohl, A N; Soucek, D J; Smith, T S; Brandt, T M; Bonner, T H; Cropek, D M

2013-11-01

Toxicity tests evaluated chronic and sublethal effects of fog oil (FO) on a freshwater endangered fish. FO is released during military training as an obscurant smoke that can drift into aquatic habitats. Fountain darters, Etheostoma fonticola, of four distinct life stages were exposed under laboratory conditions to three forms of FO. FO was vaporized into smoke and allowed to settle onto water, violently agitated with water, and dosed onto water followed by photo-oxidization by ultraviolet irradiation. Single smoke exposures of spawning adult fish did not affect egg production, egg viability, or adult fish survival in 21-day tests. Multiple daily smoke exposures induced mortality after 5 days for larvae fish. Larvae and juvenile fish were more sensitive than eggs in 96-h lethal concentration (LC50) tests with FO–water mixtures and photo-oxidized FO. Water-soluble FO components photo-modified by ultraviolet radiation were the most toxic, thus indicating the value of examining weathering and aging of chemicals for the best determination of environmental impact.

The effects of physicochemical wastewater treatment operations on forward osmosis.

PubMed

Hey, Tobias; Bajraktari, Niada; Vogel, Jörg; Hélix Nielsen, Claus; la Cour Jansen, Jes; Jönsson, Karin

2017-09-01

Raw municipal wastewater from a full-scale wastewater treatment plant was physicochemically pretreated in a large pilot-scale system comprising coagulation, flocculation, microsieve and microfiltration operated in various configurations. The produced microsieve filtrates and microfiltration permeates were then concentrated using forward osmosis (FO). Aquaporin Inside TM FO membranes were used for both the microsieve filtrate and microfiltration permeates, and Hydration Technologies Inc.-thin-film composite membranes for the microfiltration permeate using only NaCl as the draw solution. The FO performance was evaluated in terms of the water flux, water flux decline and solute rejections of biochemical oxygen demand, and total and soluble phosphorus. The obtained results were compared with the results of FO after only mechanical pretreatment. The FO permeates satisfied the Swedish discharge demands for small and medium-sized wastewater treatment plants. The study demonstrates that physicochemical pretreatment can improve the FO water flux by up to 20%. In contrast, the solute rejection decreases significantly compared to the FO-treated wastewater with mechanical pretreatment.

Effects of fO2, fH2O and aoxide on formation and density of extended planar defects in olivine

NASA Astrophysics Data System (ADS)

Burgess, K.; Cooper, R. F.

2011-12-01

Melt inclusions are used in geochemistry to inform our understanding of many physiochemical processes taking place in the mantle, such as melting, melt-rock interactions and magma mixing. Fundamental to this interpretation of melt inclusions is the assumption that they act as closed systems, i.e., they are chemically isolated after trapping and preserve primitive magma compositions. However, recent work indicates that volatiles (e.g., H and F) can be rapidly reset [Portnyagin et al., 2008], and the diffusion mechanisms and rates in tracer diffusion experiments, specifically of REEs, are a matter of some debate [Spandler and O'Neill, 2010; Cherniak, 2010]. The compendium of observations and experiments suggests a role of planar extended defects in effecting and affecting diffusion kinetics in olivine. Planar extended defects are the exothermic condensation of charged point defects into two-dimensional structures, their third dimension insufficient (i.e., sub-unit cell) to describe them as a unique phase. These planar defects, in a manner similar to mechanisms of "pipe" diffusion along dislocations and of grain boundary diffusion, can lead to measured diffusivities far greater than the lattice diffusivity, and their overall effect on flux is proportional to their spatial density [cf. Hart, 1957]. High-resolution TEM and AEM investigation of experimental olivine-basalt samples show the presence of planar defects near the olivine-melt interface, with the area fraction of the high-contrast defects in the images being greatest at high fO2 and/or fH2O while temperature has an effect on the defect dimensions but not total areal density. EDS analysis of the interface regions indicate high Ti/Ca and Ti/Al ratios compared to the glass; the stability of intercalated humite-type defects in olivine, a planar defect type found in some natural olivines [e.g., Risold et al., 2001; Hermann et al., 2007], is increased to higher temperature by the incorporation of Ti. Activities of

Evaluation of the ICET Test Stand to Assess the Performance of a Range of Ceramic Media Filter Elements in Support of ASME AG-1 Subsection FO

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schemmel, A.

High Efficiency Particulate Air (HEPA) filters are defined as extended-medium, dry-type filters with: (1) a minimum particle removal efficiency of no less than 99.97 percent for 0.3 micrometer particles, (2) a maximum, clean resistance of 1.0 inch water column (in. WC) when operated at 1,000 cubic feet per minute (CFM), and (3) a rigid casing that extends the full depth of the medium. Specifically, ceramic media HEPA filters provide better performance at elevated temperatures, are moisture resistant and nonflammable, can perform their function if wetted and exposed to greater pressures, and can be cleaned and reused. This paper describes themore » modification and design of a large scale test stand which properly evaluates the filtration characteristics of a range of ceramic media filters challenged with a nuclear aerosol agent in order to develop Section FO of ASME AG-1.« less

The growth performance of Jade Tiger cultured abalone fed diets supplemented with fish oil and vegetable oils.

PubMed

Mateos, Hintsa T; Lewandowski, Paul A; Su, Xiao Q

2013-04-01

The effects of fish oil (FO) supplementation and the dietary replacement of FO with flaxseed oil (FlaxO) and canola oil (CO) on the growth of cultured abalone was investigated. The study involved three growth experiments: (E1) diets containing 0.5, 1.0, 1.5, 2.0 and 2.5% of FO, respectively; (E2) diets in which FO was serially replaced by 25, 50, 75 and 100% FlaxO, respectively; and (E3) diets in which FO was serially replaced by 25, 50, 75 and 100% CO, respectively. In Experiment 1, abalone fed a diet supplemented with 1.5% FO showed a significantly higher (121.2 ± 1.1 mg day(-1)) daily growth rate of weight (DGRw ) compared to control (70.1 ± 1.71 mg day(-1)). In Experiment 2, abalone fed 1.5% FO diet and diets containing 25-75% FlaxO showed no significant differences in DGRw. The diet containing 100% FlaxO showed significantly lower (63.3 ± 6.7 mg day(-1)) DGRw. In Experiment 3, abalone fed diets containing 25% and 50% CO showed similar DGRw as those fed a 1.5% FO diet. The diet containing 75% and 100% CO showed significantly lower (63.7 ± 5.0 to 95.4 ± 5.1 mg day(-1)) DGRw. Supplementation with 1.5% of dietary FO can improve growth performance in cultured abalone. It is feasible to replace 75% of dietary FO with FlaxO and 50% of dietary FO with CO, without negative effect on growth performance. © 2012 Society of Chemical Industry.

Decreased survival of rainbow trout exposed to no. 2 fuel oil caused by sublethal preexposure

USGS Publications Warehouse

Steadman, B. L.; Stubblefield, W. A.; Lapoint, T. W.; Bergman, H.L.; Kaiser, M.S.

1991-01-01

Rainbow trout (Oncorhynchus mykiss) were exposed for 21 d to sublethal levels of No. 2 fuel oil (2FO). The four exposure concentrations ranged from 12 to 100 mg/L 2FO dispersed in water and resulted in 0 to 12% mortality. Following this exposure period (preexposure) the ability of preexposed trout to survive exposure to acutely lethal levels of 2FO was observed. Preexposure to either 50 or 100 mg/L 2FO consistently resulted in decreased survival and a lower LC50 for a given observation period. Unfortunately, because the LC50 determinations were not obtained independently, they could not be used to test statistically the effects of preexposure on survival. Therefore, two proportional hazard modeling techniques were applied to the data to test for effects due to preexposure. Both modeling techniques indicated that preexposure results in decreased survival of rainbow trout exposed to acutely toxic levels of 2FO. Thus, in contrast to preexposure to metals, which results in acclimation, preexposure to 2FO results in decreased survival.

21 CFR 170.39 - Threshold of regulation for substances used in food-contact articles.

Code of Federal Regulations, 2011 CFR

2011-04-01

... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Threshold of regulation for substances used in food-contact articles. 170.39 Section 170.39 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES Food Additive Safety § 170.39 Threshold of regulation fo...

21 CFR 170.39 - Threshold of regulation for substances used in food-contact articles.

Code of Federal Regulations, 2013 CFR

2013-04-01

... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Threshold of regulation for substances used in food-contact articles. 170.39 Section 170.39 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES Food Additive Safety § 170.39 Threshold of regulation fo...

21 CFR 170.39 - Threshold of regulation for substances used in food-contact articles.

Code of Federal Regulations, 2012 CFR

2012-04-01

... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Threshold of regulation for substances used in food-contact articles. 170.39 Section 170.39 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES Food Additive Safety § 170.39 Threshold of regulation fo...

Echium Oil Reduces Plasma Triglycerides by Increasing Intravascular Lipolysis in apoB100-Only Low Density Lipoprotein (LDL) Receptor Knockout Mice

PubMed Central

Forrest, Lolita M.; Lough, Christopher M.; Chung, Soonkyu; Boudyguina, Elena Y.; Gebre, Abraham K.; Smith, Thomas L.; Colvin, Perry L.; Parks, John S.

2013-01-01

Echium oil (EO), which is enriched in SDA (18:4 n-3), reduces plasma triglyceride (TG) concentrations in humans and mice. We compared mechanisms by which EO and fish oil (FO) reduce plasma TG concentrations in mildly hypertriglyceridemic male apoB100-only LDLrKO mice. Mice were fed one of three atherogenic diets containing 0.2% cholesterol and palm oil (PO; 20%), EO (10% EO + 10% PO), or FO (10% FO + 10% PO). Livers from PO- and EO-fed mice had similar TG and cholesteryl ester (CE) content, which was significantly higher than in FO-fed mice. Plasma TG secretion was reduced in FO vs. EO-fed mice. Plasma very low density lipoprotein (VLDL) particle size was ordered: PO (63 ± 4 nm) > EO (55 ± 3 nm) > FO (40 ± 2 nm). Post-heparin lipolytic activity was similar among groups, but TG hydrolysis by purified lipoprotein lipase was significantly greater for EO and FO VLDL compared to PO VLDL. Removal of VLDL tracer from plasma was marginally faster in EO vs. PO fed mice. Our results suggest that EO reduces plasma TG primarily through increased intravascular lipolysis of TG and VLDL clearance. Finally, EO may substitute for FO to reduce plasma TG concentrations, but not hepatic steatosis in this mouse model. PMID:23857172

Echium oil reduces plasma triglycerides by increasing intravascular lipolysis in apoB100-only low density lipoprotein (LDL) receptor knockout mice.

PubMed

Forrest, Lolita M; Lough, Christopher M; Chung, Soonkyu; Boudyguina, Elena Y; Gebre, Abraham K; Smith, Thomas L; Colvin, Perry L; Parks, John S

2013-07-12

Echium oil (EO), which is enriched in SDA (18:4 n-3), reduces plasma triglyceride (TG) concentrations in humans and mice. We compared mechanisms by which EO and fish oil (FO) reduce plasma TG concentrations in mildly hypertriglyceridemic male apoB100-only LDLrKO mice. Mice were fed one of three atherogenic diets containing 0.2% cholesterol and palm oil (PO; 20%), EO (10% EO + 10% PO), or FO (10% FO + 10% PO). Livers from PO- and EO-fed mice had similar TG and cholesteryl ester (CE) content, which was significantly higher than in FO-fed mice. Plasma TG secretion was reduced in FO vs. EO-fed mice. Plasma very low density lipoprotein (VLDL) particle size was ordered: PO (63 ± 4 nm) > EO (55 ± 3 nm) > FO (40 ± 2 nm). Post-heparin lipolytic activity was similar among groups, but TG hydrolysis by purified lipoprotein lipase was significantly greater for EO and FO VLDL compared to PO VLDL. Removal of VLDL tracer from plasma was marginally faster in EO vs. PO fed mice. Our results suggest that EO reduces plasma TG primarily through increased intravascular lipolysis of TG and VLDL clearance. Finally, EO may substitute for FO to reduce plasma TG concentrations, but not hepatic steatosis in this mouse model.

Fear of falling as a risk factor of mobility disability in older people at five diverse sites of the IMIAS study.

PubMed

Auais, Mohammad; Alvarado, Beatriz E; Curcio, Carmen-Lucia; Garcia, Angeles; Ylli, Alban; Deshpande, Nandini

2016-01-01

Fear of falling (FoF) is a common health problem among older adults. Although the relationship between FoF and limitation in daily activities has been reported, FoF's relationship to mobility disability, a transitional phase to end-stage disability, is not yet understood. We examined the relationship between FoF and mobility disability among community-dwelling older adults and explored the differences in this relationship among socio-culturally diverse sites. Cross-sectional study. Community. 1875 participants (65-74 years) were recruited from five sites and included in the analysis (Kingston, Canada: 394; St-Hyacinthe, Canada: 397; Tirana, Albania: 359; Manizales, Colombia: 341; and Natal, Brazil: 384). FoF was quantified using the Falls Efficacy Scale-International (FES-I, range: 16-64). Mobility disability was defined as difficulty climbing a flight of stairs or walking 400m without assistance. Overall, 21.5% of participants reported high FoF (FES-I>27). The average FoF scores were significantly different between the sites (p<0.001) and higher in women (p<0.001). In general, 36.2% of participants reported mobility disability. The distribution of mobility disability was significantly different at the five study sites (ranged from 19.8% at Kingston, Canada to 50.7% at Tirana, Albania, p<0.001). After adjusting for covariates, those with high and moderate FoF had about 3 times (95% CI: 2.59-3.83) and 2.5 times (95% CI: 1.99-2.91) higher risk of mobility disability, respectively, compared to those with no/low FoF. FoF was significantly associated with risk of mobility disability across the sites. The strength of this relationship appears to be different between the five sites. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Ventilatory Responses at Peak Exercise in Endurance-Trained Obese Adults

PubMed Central

Lorenzo, Santiago

2013-01-01

Background: Alterations in respiratory mechanics predispose healthy obese individuals to low lung volume breathing, which places them at risk of developing expiratory flow limitation (EFL). The high ventilatory demand in endurance-trained obese adults further increases their risk of developing EFL and increases their work of breathing. The objective of this study was to investigate the prevalence and magnitude of EFL in fit obese (FO) adults via measurements of breathing mechanics and ventilatory dynamics during exercise. Methods: Ten (seven women and three men) FO (mean ± SD, 38 ± 5 years, 38% ± 5% body fat) and 10 (seven women and three men) control obese (CO) (38 ± 5 years, 39% ± 5% body fat) subjects underwent hydrostatic weighing, pulmonary function testing, cycle exercise testing, and the determination of the oxygen cost of breathing during eucapnic voluntary hyperpnea. Results: There were no differences in functional residual capacity (43% ± 6% vs 40% ± 9% total lung capacity [TLC]), residual volume (21% ± 4% vs 21% ± 4% TLC), or FVC (111% ± 13% vs 104% ± 15% predicted) between FO and CO subjects, respectively. FO subjects had higher FEV1 (111% ± 13% vs 99% ± 11% predicted), TLC (106% ± 14% vs 94% ± 7% predicted), peak expiratory flow (123% ± 14% vs 106% ± 13% predicted), and maximal voluntary ventilation (128% ± 15% vs 106% ± 13% predicted) than did CO subjects. Peak oxygen uptake (129% ± 16% vs 86% ± 15% predicted), minute ventilation (128 ± 35 L/min vs 92 ± 25 L/min), and work rate (229 ± 54 W vs 166 ± 55 W) were higher in FO subjects. Mean inspiratory (4.65 ± 1.09 L/s vs 3.06 ± 1.21 L/s) and expiratory (4.15 ± 0.95 L/s vs 2.98 ± 0.76L/s) flows were greater in FO subjects, which yielded a greater breathing frequency (51 ± 8 breaths/min vs 41 ± 10 breaths/min) at peak exercise in FO subjects. Mechanical ventilatory constraints in FO subjects were similar to those in CO subjects despite the greater ventilatory demand in FO

Ventilatory responses at peak exercise in endurance-trained obese adults.

PubMed

Lorenzo, Santiago; Babb, Tony G

2013-10-01

Alterations in respiratory mechanics predispose healthy obese individuals to low lung volume breathing, which places them at risk of developing expiratory flow limitation (EFL). The high ventilatory demand in endurance-trained obese adults further increases their risk of developing EFL and increases their work of breathing. The objective of this study was to investigate the prevalence and magnitude of EFL in fit obese (FO) adults via measurements of breathing mechanics and ventilatory dynamics during exercise. Ten (seven women and three men) FO (mean ± SD, 38 ± 5 years, 38% ± 5% body fat) and 10 (seven women and three men) control obese (CO) (38 ± 5 years, 39% ± 5% body fat) subjects underwent hydrostatic weighing, pulmonary function testing, cycle exercise testing, and the determination of the oxygen cost of breathing during eucapnic voluntary hyperpnea. There were no differences in functional residual capacity (43% ± 6% vs 40% ± 9% total lung capacity [TLC]), residual volume (21% ± 4% vs 21% ± 4% TLC), or FVC (111% ± 13% vs 104% ± 15% predicted) between FO and CO subjects, respectively. FO subjects had higher FEV1 (111% ± 13% vs 99% ± 11% predicted), TLC (106% ± 14% vs 94% ± 7% predicted), peak expiratory flow (123% ± 14% vs 106% ± 13% predicted), and maximal voluntary ventilation (128% ± 15% vs 106% ± 13% predicted) than did CO subjects. Peak oxygen uptake (129% ± 16% vs 86% ± 15% predicted), minute ventilation (128 ± 35 L/min vs 92 ± 25 L/min), and work rate (229 ± 54 W vs 166 ± 55 W) were higher in FO subjects. Mean inspiratory (4.65 ± 1.09 L/s vs 3.06 ± 1.21 L/s) and expiratory (4.15 ± 0.95 L/s vs 2.98 ± 0.76 L/s) flows were greater in FO subjects, which yielded a greater breathing frequency (51 ± 8 breaths/min vs 41 ± 10 breaths/min) at peak exercise in FO subjects. Mechanical ventilatory constraints in FO subjects were similar to those in CO subjects despite the greater ventilatory demand in FO subjects. FO individuals achieve

Effect of spray-drying with organic solvents on the encapsulation, release and stability of fish oil.

PubMed

Encina, Cristian; Márquez-Ruiz, Gloria; Holgado, Francisca; Giménez, Begoña; Vergara, Cristina; Robert, Paz

2018-10-15

Fish-oil (FO) was encapsulated with hydroxypropylcelullose (HPC) by conventional spray-drying with water (FO-water) and solvent spray-drying with ethanol (FO-EtOH), methanol (FO-MeOH) and acetone (FO-Acet) in order to study the effect of the solvent on the encapsulation efficiency (EE), microparticle properties and stability of FO during storage at 40 °C. Results showed that FO-Acet presented the highest EE of FO (92.0%), followed by FO-EtOH (80.4%), FO-MeOH (75.0%) and FO-water (71.1%). A decrease of the dielectric constant increased the EE of FO, promoting triglyceride-polymer interactions instead of oil-in-water emulsion retention. FO release profile in aqueous model was similar for all FO-microparticles, releasing only the surface FO, according to Higuchi model. Oxidative stability of FO significantly improved by spray-drying with MeOH, both in surface and encapsulated oil fractions. In conclusion, encapsulation of FO by solvent spray-drying can be proposed as an alternative technology for encapsulation of hydrophobic molecules. Copyright © 2018 Elsevier Ltd. All rights reserved.

Infrared spectroscopy of solid normal hydrogen doped with CH3F and O2 at 4.2 K: CH3F:O2 complex and CH3F migration

NASA Astrophysics Data System (ADS)

Abouaf-Marguin, L.; Vasserot, A.-M.

2011-04-01

Double doping of solid normal hydrogen with CH3F and O2 at about 4.2 K gives evidence of (ortho-H2)n:CH3F clusters and of O2:CH3F complex formation. FTIR analysis of the time evolution of the spectra in the region of the v3 C-F stretching mode indicates that these clusters behave very differently from (ortho-H2)n:H2O clusters. The main point is the observed migration of CH3F molecules in solid para-H2 at 4.2 K which differs from that of H2O under identical experimental conditions. This is confirmed by an increase over time of the integrated intensity of the CH3F:O2 complex with a rate constant K = 2.7(2) . 10-4 s-1.

Parenteral Lipid Dose Restriction With Soy Oil, Not Fish Oil, Preserves Retinal Function in Neonatal Piglets.

PubMed

Lansing, Marihan; Sauvé, Yves; Dimopoulos, Ioannis; Field, Catherine J; Suh, Miyoung; Wizzard, Pamela; Goruk, Susan; Lim, David; Muto, Mitsuru; Wales, Paul; Turner, Justine

2018-03-13

A dietary supply of docosahexaenoic acid (DHA) and arachidonic acid (AA) is critical for neonatal retinal development. Both are absent/minimal in parenteral nutrition (PN) using soy-oil emulsions ([SO] Intralipid®) traditionally used for neonatal intestinal failure. In contrast, fish-oil emulsions ([FO] Omegaven®) are enriched in DHA/AA. The aim of this study was to compare retinal function and fatty acid content in neonatal piglets fed PN with SO or FO. Two-5-day-old piglets were randomly allocated to SO (n = 4) or FO (n = 4), provided at equivalent doses (5g/kg/d). After 14 days of PN, retinal function was assessed by electroretinography and retinas were harvested for fatty acid content analysis. Sow-fed piglets served as a reference (REF). Light flash-elicited stoppage of cone and rod dark-currents (a-waves) and the ensuing postsynaptic activation of cone and rod ON bipolar cells (b-waves) were comparable between SO and REF. Responses recorded from FO were subnormal (P <0.001) when compared with both SO and REF. Retinal DHA content was similar in both groups (FO, 14.59% vs SO, 12.22%; P = 0.32); while AA was lower in FO (FO, 6.01% vs SO, 8.21%; P = .001). Paradoxically, FO containing more DHA and AA did not preserve retinal function when compared with the same low dose of SO. This may be due to the reduced AA enrichment in the retina with FO treatment. Further investigation into the ideal amounts of DHA and AA for optimal neonatal retinal function is required. © 2018 American Society for Parenteral and Enteral Nutrition.

Selection of aptamers against Ara h 1 protein for FO-SPR biosensing of peanut allergens in food matrices.

PubMed

Tran, Dinh T; Knez, Karel; Janssen, Kris P; Pollet, Jeroen; Spasic, Dragana; Lammertyn, Jeroen

2013-05-15

The rising prevalence to food allergies in the past two decades, together with the fact that the only existing therapy is avoidance of allergen-containing food next to the implementation of anti-allergic drugs, urges the need for improved performance of current assays to detect potential allergens in food products. Therein, the focus has been on aptamer-based biosensors in recent years. In this paper we report for the first time the selection of aptamers against one of the most important peanut allergens, Ara h 1. Several Ara h1 DNA aptamers were selected after eight selection rounds using capillary electrophoresis (CE)-SELEX. The selected aptamers specifically recognized Ara h 1 and did not significantly bind with other proteins, including another peanut allergen Ara h 2. The dissociation constant of a best performing aptamer was in the nanomolar range as determined independently by three different approaches, which are surface plasmon resonance, fluorescence anisotropy, and capillary electrophoresis (353 ± 82 nM, 419 ± 63 nM, and 450 ± 60 nM, respectively). Furthermore, the selected aptamer was used for bioassay development on a home-built fiber optic surface plasmon resonance (FO-SPR) biosensor platform for detecting Ara h 1 protein in both buffer and food matrix samples demonstrating its real potential for the development of novel, more accurate aptamer-based biosensors. In conclusion, the reported aptamer holds a great potential for the detection of Ara h 1 in both the medical field and the food sector due to its high affinity and specificity for the target protein. Copyright © 2012 Elsevier B.V. All rights reserved.

Effects of olive and fish oil Ca soaps in ewe diets on milk fat and muscle and subcutaneous tissue fatty-acid profiles of suckling lambs.

PubMed

Gallardo, B; Gómez-Cortés, P; Mantecón, A R; Juárez, M; Manso, T; de la Fuente, M A

2014-07-01

Enhancing healthy fatty acids (FAs) in ewe milk fat and suckling lamb tissues is an important objective in terms of improving the nutritional value of these foods for the consumer. The present study examined the effects of feeding-protected lipid supplements rich in unsaturated FAs on the lipid composition of ewe milk, and subsequently in the muscle and subcutaneous adipose tissues of lambs suckling such milk. Thirty-six pregnant Churra ewes with their new-born lambs were assigned to one of three experimental diets (forage/concentrate ratio 50 : 50), each supplemented with either 3% Ca soap FAs of palm (Control), olive (OLI) or fish (FO) oil. The lambs were nourished exclusively by suckling for the whole experimental period. When the lambs reached 11 kg BW, they were slaughtered and samples were taken from the Longissimus dorsi and subcutaneous fat depots. Although milk production was not affected by lipid supplementation, the FO diet decreased fat content (P0.05) and other trans-FAs between Control and FO treatments would indicate that FO treatment does not alter rumen biohydrogenation pathways under the assayed conditions. Changes in dam milk FA composition induced differences in the FA profiles of meat and fat depots of lambs, preferentially incorporated polyunsaturated FAs into the muscle rather than storing them in the adipose tissue. In the intramuscular fat of the FO treatment, all the n-3 FAs reached their highest concentrations: 0.97 (18:3 n-3), 2.72 (20:5 n-3), 2.21 (22:5 n-3) and 1.53% (22:6 n-3). In addition, not only did FO intramuscular fat have the most cis-9, trans-11 18:2 (1.66%) and trans-11 18:1 (3.75%), but also the lowest n-6/n-3 ratio (1.80) and saturated FA content were not affected. Therefore, FO exhibited the best FA profile from a nutritional point of view.

Status of Electrostatic Accelerometer Development for Gravity Recovery and Climate Experiment Follow-On Mission (GRACE FO)

NASA Astrophysics Data System (ADS)

Perrot, Eddy; Boulanger, Damien; Christophe, Bruno; Foulon, Bernard; Liorzou, Françoise; Lebat, Vincent; Huynh, Phuong-Anh

2015-04-01

The GRACE FO mission, led by the JPL (Jet Propulsion Laboratory), is an Earth-orbiting gravity mission, continuation of the GRACE mission, which will produce an accurate model of the Earth's gravity field variation providing global climatic data during five years at least. The mission involves two satellites in a loosely controlled tandem formation, with a micro-wave link measuring the inter-satellites distance variation. Earth's mass distribution non-uniformities cause variations of the inter-satellite distance. This variation is measured to recover gravity, after subtracting the non-gravitational contributors, as the residual drag. ONERA (the French Aerospace Lab) is developing, manufacturing and testing electrostatic accelerometers measuring this residual drag applied on the satellites. The accelerometer is composed of two main parts: the Sensor Unit (including the Sensor Unit Mechanics - SUM - and the Front-End Electronic Unit - FEEU) and the Interface Control Unit - ICU. In the Accelerometer Core, located in the Sensor Unit Mechanics, the proof mass is levitated and maintained at the center of an electrode cage by electrostatic forces. Thus, any drag acceleration applied on the satellite involves a variation on the servo-controlled electrostatic suspension of the mass. The voltage on the electrodes providing this electrostatic force is the measurement output of the accelerometer. The impact of the accelerometer defaults (geometry, electronic and parasitic forces) leads to bias, misalignment and scale factor error, non-linearity and noise. Some of these accelerometer defaults are characterized by tests with micro-gravity pendulum bench on ground and with drops in ZARM catapult. The Critical Design Review was achieved successfully on September 2014. The Engineering Model (EM) was integrated and tested successfully, with ground levitation, drops, Electromagnetic Compatibility and thermal vacuum. The integration of the first Flight Model has begun on December 2014

Status of Electrostatic Accelerometer Development for Gravity Recovery and Climate Experiment Follow-on Mission (GRACE FO)

NASA Astrophysics Data System (ADS)

Lebat, V.; Boulanger, D.; Christophe, B.; Foulon, B.; Liorzou, F.; Perrot, E.; Huynh, P. A.

2014-12-01

The GRACE FO mission, led by the JPL (Jet Propulsion Laboratory), is an Earth-orbiting gravity mission, continuation of the GRACE mission, which will produce an accurate model of the Earth's gravity field variation providing global climatic data during five years at least. The mission involves two satellites in a loosely controlled tandem formation, with a micro-wave link measuring the inter-satellites distance variation. Earth's mass distribution non-uniformities cause variations of the inter-satellite distance. This variation is measured to recover gravity, after subtracting the non-gravitational contributors, as the residual drag. ONERA (the French Aerospace Lab) is developing, manufacturing and testing electrostatic accelerometers measuring this residual drag applied on the satellites. The accelerometer is composed of two main parts: the Sensor Unit (including the Sensor Unit Mechanics - SUM - and the Front-End Electronic Unit - FEEU) and the Interface Control Unit - ICU. In the Accelerometer Core, located in the Sensor Unit Mechanics, the proof mass is levitated and maintained at the center of an electrode cage by electrostatic forces. Thus, any drag acceleration applied on the satellite involves a variation on the servo-controlled electrostatic suspension of the mass. The voltage on the electrodes providing this electrostatic force is the measurement output of the accelerometer. The impact of the accelerometer defaults (geometry, electronic and parasitic forces) leads to bias, misalignment and scale factor error, non-linearity and noise. Some of these accelerometer defaults are characterized by tests with micro-gravity pendulum bench on ground and with drops in ZARM catapult. The Preliminary Design Review was achieved successfully on November 2013. The Engineering Model (EM) was integrated successfully and is under test, with ground levitation, drops, Electromagnetic Compatibility and thermal vacuum. The complete EM tests will be achieved on October 2014. The

Electrostatic Accelerometer for the Gravity Recovery and Climate Experiment Follow-On Mission (GRACE FO)

NASA Astrophysics Data System (ADS)

Perrot, Eddy; Christophe, Bruno; Foulon, Bernard; Boulanger, Damien; Liorzou, Françoise; Lebat, Vincent

2013-04-01

The GRACE FO mission, led by the JPL (Jet Propulsion Laboratory), is an Earth-orbiting gravity mission, continuation of the GRACE mission, that will produce an accurate model of the Earth's gravity field variation providing global climatic data during five year at least. The mission involves two satellites in a loosely controlled tandem formation, with a micro-wave link measuring the inter-satellites distance variation. Non-uniformities in the distribution of the Earth's mass cause the distance between the two satellites to vary. This variation is measured to recover gravity, after substracting the non-gravitational contributors, as the residual drag. ONERA (the French Aerospace Lab) is developing and manufacturing electrostatic accelerometers measuring this residual drag applied on the satellites. The accelerometer is composed of two main parts: the Sensor Unit (including the Sensor Unit Mechanics and the Front-End Electronic Unit) and the Interface Control Unit. In the Accelerometer Core, located in the Sensor Unit Mechanics, the proof mass is levitated and maintained in a center of an electrode cage by electrostatic forces. Thus, any drag acceleration applied on the satellite involves a variation on the servo-controlled electrostatic suspension of the mass. The voltage on the electrodes providing this electrostatic force is the measurement output of the accelerometer. The impact of the accelerometer defaults (geometry, electronic and parasitic forces) leads to bias, misalignment and scale factor error, non-linearity and noise. Some of these accelerometer defaults are characterized by tests with micro-gravity pendulum bench and with drops in ZARM catapult. Besides, a thermal stability is needed for the accelerometer core and front-end electronics to avoid bias and scale factor variation. To reach this stability, the sensor unit is enclosed in a thermal box designed by Astrium, spacecraft manufacturer. The accelerometers are designed to endure mechanical

A series of substituted (2E)-3-(2-fluoro-4-phenoxyphenyl)-1-phenylprop-2-en-1-ones.

PubMed

Chopra, Deepak; Mohan, T P; Vishalakshi, B; Row, T N Guru

2007-12-01

In the molecular structures of a series of substituted chalcones, namely (2E)-3-(2-fluoro-4-phenoxyphenyl)-1-phenylprop-2-en-1-one, C21H15FO2, (I), (2E)-3-(2-fluoro-4-phenoxyphenyl)-1-(4-fluorophenyl)prop-2-en-1-one, C21H14F2O2, (II), (2E)-1-(4-chlorophenyl)-3-(2-fluoro-4-phenoxyphenyl)prop-2-en-1-one, C21H14ClFO2, (III), (2E)-3-(2-fluoro-4-phenoxyphenyl)-1-(4-methylphenyl)prop-2-en-1-one, C22H17FO2, (IV), and (2E)-3-(2-fluoro-4-phenoxyphenyl)-1-(4-methoxyphenyl)prop-2-en-1-one, C22H17FO3, (V), the configuration of the keto group with respect to the olefinic double bond is s-cis. The molecules pack utilizing weak C-H...O and C-H...pi intermolecular contacts. Identical packing motifs involving C-H...O interactions, forming both chains and dimers, along with C-H...pi dimers and pi-pi aromatic interactions are observed in the fluoro, chloro and methyl derivatives.

Fiber optic systems for mobile platforms IV; Proceedings of the Meeting, San Jose, CA, Sept. 18, 1990

NASA Astrophysics Data System (ADS)

Lewis, Norris E.; Moore, Emery L.

The present conference on fiber-optic (FO) systems discusses topics in shipboard, automotive, spacecraft, and aeronautical FO applications. Attention is given to an FO interferometric ellipsoidal shell hydrophone, an FO backbone for a submarine combat system, EM environmental effects on shipboard FO installations, and recent developments in polymeric FO systems for automotive use. Also discussed are a wavelength-multiplexed FO position encoder for aircraft control systems, a code-division multiple-access system for integrated modular avionics, fly-by-light systems for commercial aircraft, FO temperature sensors for aerospace applications, a hybrid FO/electrical network for launch vehicles, the effects of ionizing radiation on FO systems, and FO systems in liquid propellant rocket environments.

Water recovery from sewage using forward osmosis.

PubMed

Lutchmiah, Kerusha; Cornelissen, Emile R; Harmsen, Danny J H; Post, Jan W; Lampi, Keith; Ramaekers, Hans; Rietveld, Luuk C; Roest, Kees

2011-01-01

This research is part of the Sewer Mining project aimed at developing a new technological concept by extracting water from sewage by means of forward osmosis (FO). FO, in combination with a reconcentration system, e.g. reverse osmosis (RO) is used to recover high-quality water. Furthermore, the subsequent concentrated sewage (containing an inherent energy content) can be converted into a renewable energy (RE) source (i.e. biogas). The effectiveness of FO membranes in the recovery of water from sewage has been evaluated. Stable FO water flux values (>4.3 LMH) were obtained with primary effluent (screened, not treated) used as the feed solution. Fouling of the membrane was also induced and further investigated. Accumulated fouling was found to be apparent, but not irreversible. Sewer Mining could lead to a more economical and sustainable treatment of wastewater, facilitating the extraction of water and energy from sewage and changing the way it is perceived: not as waste, but as a resource.

Dietary fish oil supplements increase tissue n-3 fatty acid composition and expression of delta-6 desaturase and elongase-2 in Jade Tiger hybrid abalone.

PubMed

Mateos, Hintsa T; Lewandowski, Paul A; Su, Xiao Q

2011-08-01

This study was conducted to investigate the effects of fish oil (FO) supplements on fatty acid composition and the expression of ∆6 desaturase and elongase 2 genes in Jade Tiger abalone. Five test diets were formulated to contain 0.5, 1.0, 1.5, 2.0 and 2.5% of FO respectively, and the control diet was the normal commercial abalone diet with no additional FO supplement. The muscle, gonad and digestive glands (DG) of abalone fed with all of the five test diets showed significantly high levels of total n-3 polyunsaturated fatty acid (PUFA), eicosapentaenoic acid (EPA), docosapentaenoic acid n-3 (DPAn-3), and docosahexaenoic acid (DHA) than the control group. In all three types of tissue, abalone fed diet supplemented with 1.5% FO showed the highest level of these fatty acids (P < 0.05). For DPAn-3 the higher level was also found in muscle and gonad of abalone fed diet supplemented with 2% FO (P < 0.05). Elongase 2 expression was markedly higher in the muscle of abalone fed diet supplemented with 1.5% FO (P < 0.05), followed by the diet containing 2% FO supplement. For ∆6 desaturase, significantly higher expression was observed in muscle of abalone fed with diet containing 0.5% FO supplement (P < 0.05). Supplementation with FO in the normal commercial diet can significantly improve long chain n-3 PUFA level in cultured abalone, with 1.5% being the most effective supplementation level.

Life cycle cost of a hybrid forward osmosis - low pressure reverse osmosis system for seawater desalination and wastewater recovery.

PubMed

Valladares Linares, R; Li, Z; Yangali-Quintanilla, V; Ghaffour, N; Amy, G; Leiknes, T; Vrouwenvelder, J S

2016-01-01

In recent years, forward osmosis (FO) hybrid membrane systems have been investigated as an alternative to conventional high-pressure membrane processes (i.e. reverse osmosis (RO)) for seawater desalination and wastewater treatment and recovery. Nevertheless, their economic advantage in comparison to conventional processes for seawater desalination and municipal wastewater treatment has not been clearly addressed. This work presents a detailed economic analysis on capital and operational expenses (CAPEX and OPEX) for: i) a hybrid forward osmosis - low-pressure reverse osmosis (FO-LPRO) process, ii) a conventional seawater reverse osmosis (SWRO) desalination process, and iii) a membrane bioreactor - reverse osmosis - advanced oxidation process (MBR-RO-AOP) for wastewater treatment and reuse. The most important variables affecting economic feasibility are obtained through a sensitivity analysis of a hybrid FO-LPRO system. The main parameters taken into account for the life cycle costs are the water quality characteristics (similar feed water and similar water produced), production capacity of 100,000 m(3) d(-1) of potable water, energy consumption, materials, maintenance, operation, RO and FO module costs, and chemicals. Compared to SWRO, the FO-LPRO systems have a 21% higher CAPEX and a 56% lower OPEX due to savings in energy consumption and fouling control. In terms of the total water cost per cubic meter of water produced, the hybrid FO-LPRO desalination system has a 16% cost reduction compared to the benchmark for desalination, mainly SWRO. Compared to the MBR-RO-AOP, the FO-LPRO systems have a 7% lower CAPEX and 9% higher OPEX, resulting in no significant cost reduction per m(3) produced by FO-LPRO. Hybrid FO-LPRO membrane systems are shown to have an economic advantage compared to current available technology for desalination, and comparable costs with a wastewater treatment and recovery system. Based on development on FO membrane modules, packing density, and

High reduction of ozone and particulate matter during the 2016 G-20 summit in Hangzhou by forced emission controls of industry and traffic

EPA Science Inventory

Many regions in China experience air pollution episodes because of the rapid urbanization and industrialization over the past decades. Here we analyzed the effect of emission controls implemented during the G-20 2016 Hangzhou summit on air quality. Emission controls included a fo...

The role of postural instability/gait difficulty and fear of falling in predicting falls in non-demented older adults.

PubMed

Allali, Gilles; Ayers, Emmeline I; Holtzer, Roee; Verghese, Joe

Postural instability/gait difficulty (PIGD) and fear of falling (FoF) frequently co-exist, but their individual predictive values for falls have not been compared in aging. This study aims to determine both independent and combined effect of PIGD and FoF to falls in older adults without dementia. PIGD and other extrapyramidal signs were systematically assessed in 449 community-dwelling participants without Parkinson's disease (76.48±6.61 ys; 56.8% female) enrolled in this longitudinal cohort study. Presence of FoF was measured by a single-item question (Do you have a FoF?) and self-confidence by the Activities-specific Balance Confidence scale (ABC scale). One hundred sixty-nine participants (38%) had an incident fall over a mean follow-up of 20.1±12.2months. PIGD was present in 32% and FoF in 23% of the participants. Both PIGD (adjusted hazard ratio (aHR): 2.28; p=0.016) and self-confidence (aHR: 0.99; p=0.040) predicted falls when entered simultaneously in the Cox model. However, presence of FoF (aHR: 1.99; p=0.021) and self-confidence (aHR: 0.98; p=0.006) predicted falls only in individuals with PIGD. PIGD and FoF were associated with future falls in older adults without dementia but FoF was a fall's predictor only in individuals with PIGD. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Sulfur diffusion in dacitic melt at various oxidation states: Implications for volcanic degassing

NASA Astrophysics Data System (ADS)

Lierenfeld, Matthias Bernhard; Zajacz, Zoltán; Bachmann, Olivier; Ulmer, Peter

2018-04-01

The diffusivity of S in a hydrous dacitic melt (4.5-6.0 wt.% H2O) has been investigated in the temperature (T) and pressure (P) range of 950 °C to 1100 °C and 200 to 250 MPa, respectively. Three series of experiments were conducted at relatively low oxygen fugacity (fO2) conditions [0.8 log units below fayalite-magnetite-quartz equilibrium (FMQ -0.8); referred to as "low fO2"] and high fO2 conditions (FMQ +2.5; referred to as "high fO2") to determine if the diffusivity of S is affected by its oxidation state and speciation. Sulfur concentration profiles were measured by electron microprobe and the diffusion coefficient (D) was calculated by fitting these profiles. Sulfur diffusion is approximately one order of magnitude faster when S is dominantly present as sulfide species (low fO2) in comparison to the sulfate dominated experiments (high fO2). The following Arrhenian equations were obtained for high and low fO2 conditions at 200 MPa: high fO2: D = 10-5.92±0.86 * exp ({-137.3±21.5 kJ/mol}/{RT}) low fO2: D = 10-5.18±1.39 * exp ({-125.7±34.4 kJ/mol}/{RT}) where D is the average diffusion coefficient in m2 s-1, R is the gas constant in 8.3144 J mol-1 K-1 and T is the temperature in K. Our results demonstrate for the first time in natural melts that S diffusion is strongly sensitive to fO2. Our S diffusivities under low fO2 conditions are only slightly slower of those found for H2O, suggesting that S can be rather efficiently purged from reduced dacitic melts during volcanic eruptions. However, for more oxidized systems (e.g. subduction zones), S diffusion will be much slower and will hinder equilibrium syn-eruptive degassing during rapid decompression. Therefore, we conclude that the "excess" measured during many explosive volcanic eruptions in arcs is dominantly derived from S-rich bubble accumulation in the eruptible portion of the magma reservoir.

20 CFR 402.60 - Materials in field offices of the Office of Hearings and Appeals.

Code of Federal Regulations, 2010 CFR

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Materials in field offices of the Office of Hearings and Appeals. 402.60 Section 402.60 Employees' Benefits SOCIAL SECURITY ADMINISTRATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC § 402.60 Materials in field offices of the Office of Hearings and Appeals. (a) Materials available fo...

Comparison of Ionospheric Parameters during Similar Geomagnetic Storms

NASA Astrophysics Data System (ADS)

Blagoveshchensky, D. V.

2018-03-01

The degree of closeness of ionospheric parameters during one magnetic storm and of the same parameters during another, similar, storm is estimated. Overall, four storms—two pairs of storms close in structure and appearance according to recording of the magnetic field X-component—were analyzed. The examination was based on data from Sodankyla observatory (Finland). The f-graphs of the ionospheric vertical sounding, magnetometer data, and riometer data on absorption were used. The main results are as follows. The values of the critical frequencies foF2, foF1, and foE for different but similar magnetic storms differ insignificantly. In the daytime, the difference is on average 6% (from 0 to 11.1%) for all ionospheric layers. In the nighttime conditions, the difference for foF2 is 4%. The nighttime values of foEs differ on average by 20%. These estimates potentially make it possible to forecast ionospheric parameters for a particular storm.

Study of Ionospheric Indexes T and MF2 related to R12 for Solar Cycles 19-21

NASA Astrophysics Data System (ADS)

Villanueva, Lucia

2013-04-01

Modern worldwide communications are mainly based on satellite systems, remote communication networks, and advanced technologies. The most important space weather "meteorological" events produce negative effects on signal transmissions. Magnetic storm conditions that follow coronal mass ejections are particularly of great importance for radio communication at HF frequencies (3-30 MHz range), because the Ionization increase (or decrease), significantly over (or below), the Average Values. Nowadays new technologies make possible to establish Geophysical Observatories and monitor the sun almost in real time giving information about geomagnetic indices. Space Weather programs have interesting software predictions of foF2 producing maps and plots, every some minutes. The Average Values of the ionospheric parameters mainly depend on the position, hour, season and the phase of the 11-year cycle of the solar activity. Around 1990´s several ionospheric indexes were suggested to better predict the state of the foF2 monthly media, as: IF2, G, T and MF2, based on foF2 data from different latitude ionospheric observatories. They really show better seasonal changes than monthly solar indexes of solar flux F10.7 or the international sunspot numbers Ri. The main purpose of this paper is to present an analogic model for the ionospheric index MF2, to establish the average long term predictions of this index. Changes of phase from one cycle to the other of one component of the model is found to fit the data. The usefulness of this model could be the prediction of the ionospheric normal conditions for one entire solar cycle having just the prediction of the maximum of the next smooth sunspot number R12. In this presentation, comparisons of the Australian T index and and the Mikhailov MF2 index show an hysteresis variation with the solar monthly index Ri, such dependence is quite well represented by a polynomial fit of degree 6 for rising and decaying fases for solar cycles 19, 20 and

Rapid cellular enrichment of eicosapentaenoate after a single intravenous injection of a novel medium-chain triacylglycerol:fish-oil emulsion in humans123

PubMed Central

Carpentier, Yvon A; Hacquebard, Mirjam; Portois, Laurence; Dupont, Isabelle E; Deckelbaum, Richard J

2010-01-01

Background: Dietary deficiency in n−3 (omega-3) polyunsaturated fatty acids (PUFAs) prevails in Western populations and potentially results in adverse health outcomes. To circumvent the slow n−3 PUFA incorporation in phospholipids of key cells after oral supplementation, a new preparation for intravenous bolus injection was developed with 20 g triacylglycerols/100 mL of a mixture of 80% medium-chain triacylglycerols (MCTs) and 20% fish oil (FO) (wt:wt), and 0.4 g α-tocopherol/100 mL of the same mixture. Objective: Our objective was to document the enrichment of n−3 PUFAs in leukocyte and platelet phospholipids after a bolus intravenous injection of MCT:FO in men. Design: Twelve healthy male subjects received injections over a 5-min period of 50 mL of either MCT:FO or a control MCT:long-chain triacylglycerol (MCT:LCT) emulsion containing 20 g triacylglycerols/100 mL with equal amounts (wt:wt) of MCT and soybean triacylglycerols (LCT) and containing 0.02 g α-tocopherol/100 mL; after an 8-wk interval, the subjects received injections of the other preparation. Results: Clinical and biological variables that assessed tolerance and safety remained unchanged. Plasma elimination was faster for MCT:FO than for MCT:LCT (half-life: 24.5 ± 3.5 min compared with 32.9 ± 3.0 min; P < 0.025). This was associated with a greater increase in the plasma nonesterified fatty acid concentration. The content of n−3 PUFAs, specifically eicosapentaenoic acid (20:5n−3), increased in leukocyte and platelet phospholipids within 60 min and ≥24 h after MCT:FO injection. Conclusion: Bolus intravenous injection of a novel MCT:FO emulsion allows rapid enrichment of cells with n−3 PUFAs. PMID:20147473

Intrinsic oxygen fugacity measurements on seven chondrites, a pallasite, and a tektite and the redox state of meteorite parent bodies

USGS Publications Warehouse

Brett, R.; Sato, M.

1984-01-01

Intrinsic oxygen-fugacity (fO2) measurements were made on five ordinary chondrites, a carbonaceous chondrite, an enstatite chondrite, a pallasite, and a tektite. Results are of the form of linear log fO2 - 1 T plots. Except for the enstatite chondrite, measured results agree well with calculated estimates by others. The tektite produced fO2 values well below the range measured for terrestrial and lunar rocks. The lowpressure atmospheric regime that is reported to follow large terrestrial explosions, coupled with a very high temperature, could produce glass with fO2 in the range measured. The meteorite Salta (pallasite) has low fO2 and lies close to Hvittis (E6). Unlike the other samples, results for Salta do not parallel the iron-wu??stite buffer, but are close to the fayalite-quartz-iron buffer in slope. Minor reduction by graphite appears to have taken place during metamorphism of ordinary chondrites. fO2 values of unequilibrated chondrites show large scatter during early heating suggesting that the constituent phases were exposed to a range of fO2 conditions. The samples equilibrated with respect to fO2 in relatively short time on heating. Equilibration with respect to fO2 in ordinary chondrites takes place between grades 3 and 4 of metamorphism. Application of P - T - fO2 relations in the system C-CO-CO2 indicates that the ordinary chondrites were metamorphosed at pressures of 3-20 bars, as it appears that they lay on the graphite surface. A steep positive thermal gradient in a meteorite parent body lying at the graphite surface will produce thin reduced exterior, an oxidized near-surface layer, and an interior that is increasingly reduced with depth; a shallow thermal gradient will produce the reverse. A body heated by accretion on the outside will have a reduced exterior and oxidized interior. Meteorites from the same parent body clearly are not required to have similar redox states. ?? 1984.

Fiber optic smart structures and skins V; Proceedings of the Meeting, Boston, MA, Sept. 8, 9, 1992

NASA Technical Reports Server (NTRS)

Claus, Richard O. (Editor); Rogowski, Robert S. (Editor)

1993-01-01

The present conference discusses the materials used in applications of fiber-optics (F-O) to smart structures, extrinsic Fabry-Perot interferometric F-O sensors, sapphire F-O sensors, two-mode F-O sensors with photoinduced refractive index, an F-O accelerometer using two-mode fibers, and embedded F-O acoustic sensors for flaw detection. Also discussed are an optoelectronic smart structure interface, F-O sensors for simultaneous detection of strain and temperature, an optical Mach-Zehnder interferometer for smart skins, a split-cavity cross-coupled extrinsic fiber interferometer, and an embedded Bragg grating F-O sensor for composite flexbeams, an Er-doped ring-laser strain sensor.

What Influences Parents' Fear about Children's Independent Mobility? Evidence from a State-Wide Survey of Australian Parents.

PubMed

Bennetts, Shannon K; Cooklin, Amanda R; Crawford, Sharinne; D'Esposito, Fabrizio; Hackworth, Naomi J; Green, Julie; Matthews, Jan; Strazdins, Lyndall; Zubrick, Stephen R; Nicholson, Jan M

2018-03-01

To identify factors associated with generalized and stranger-specific parental fear (PF) about children's independent mobility (CIM), a critical aspect of physical activity. Cross-sectional survey; random sampling frame, minimum quotas of fathers, rural residents. State of Victoria, Australia. Parents of children aged 9 to 15 years (n = 1779), 71% response rate. Validated measures of PF and fear of strangers (FoS); parent, child, social, and environmental factors. Unadjusted and adjusted linear regression stratified by child age (9-10; 11-13; 14-15). Adjusted models explained a substantial proportion of variance across all age groups (PF: 33.6%-36.7%; FoS: 39.1%-44.0%). Perceived disapproval from others was consistently associated with both outcomes (PF: β =.11 to 23, p ≤ .05; FoS: β =.17-.21, p ≤ .001) as was parents' perception of children's competence to travel safely (PF: β = -.24 to -.11, p ≤ .05; FoS: β = -.16 to -.13, p ≤ .01). Factors associated with FoS included having a female child (β = -.21 to -.13, p ≤ .001), language other than English (β = .09 to.11, p ≤ .01), and low levels of parent education (β = -.14 to -08, p ≤ .05). The current study suggests that social norms, child competence, and perceptions about the benefits of CIM underpin PF. This evidence informs the development of interventions to reduce PF and promote CIM and children's physical activity.

Biochemical methane potential (BMP) of agro-food wastes from the Cider Region (Spain).

PubMed

Nieto, P P; Hidalgo, D; Irusta, R; Kraut, D

2012-01-01

An inventory of agro-food industry organic waste streams with a high potential for biogas transformation was studied in a logistically viable area (Cider Region, Asturias, Spain). Three industries were selected as the most viable ones: livestock, dairy and beverage. The potential for methane production from six wastes (beverage waste, BW; milled apple waste, MA; milk waste, MK; yogurt waste, YG; fats and oils from dairy wastewater treatment, F&O and cattle manure, CM) at five different substrate:inoculum ratios (0.25, 0.50, 0.75, 1.00 and 1.50) was evaluated in laboratory batch assays. Obtained methane yields ranged from 202-549 mL STP CH(4)·g VS waste(-1), and the methane content in biogas ranged from 58-76%. The ultimate practical biochemical methane potentials were slightly affected by the substrate:inoculum ratio. The estimation of the regional fluxes of waste and methane potentials suggests anaerobic digestion as a sustainable solution for the valorization of the organic wastes generated in this Region.

21 CFR 110.20 - Plant and grounds.

Code of Federal Regulations, 2012 CFR

2012-04-01

... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Plant and grounds. 110.20 Section 110.20 Food and... Facilities § 110.20 Plant and grounds. (a) Grounds. The grounds about a food plant under the control of the... litter and waste, and cutting weeds or grass within the immediate vicinity of the plant buildings or...

Electrostatic Accelerometer for the Gravity Recovery and Climate Experiment Follow-On Mission (GRACE FO)

NASA Astrophysics Data System (ADS)

Lebat, V.; Foulon, B.; Christophe, B.

2013-12-01

The GRACE FO mission, led by the JPL (Jet Propulsion Laboratory), is an Earth-orbiting gravity mission, continuation of the GRACE mission, that will produce an accurate model of the Earth's gravity field variation providing global climatic data during five year at least. The mission involves two satellites in a loosely controlled tandem formation, with a micro-wave link measuring the inter-satellites distance variation. Non-uniformities in the distribution of the Earth's mass cause the distance between the two satellites to vary. This variation is measured to recover gravity, after subtracting the non-gravitational contributors, as the residual drag. ONERA (the French Aerospace Lab) is developing, manufacturing and testing electrostatic accelerometers measuring this residual drag applied on the satellites. The accelerometer is composed of two main parts: the Sensor Unit (including the Sensor Unit Mechanics and the Front-End Electronic Unit) and the Interface Control Unit. In the Accelerometer Core, located in the Sensor Unit Mechanics, the proof mass is levitated and maintained in a center of an electrode cage by electrostatic forces. Thus, any drag acceleration applied on the satellite involves a variation on the servo-controlled electrostatic suspension of the mass. The voltage on the electrodes providing this electrostatic force is the measurement output of the accelerometer. The impact of the accelerometer defaults (geometry, electronic and parasitic forces) leads to bias, misalignment and scale factor error, non-linearity and noise. Some of these accelerometer defaults are characterized by tests with micro-gravity pendulum bench and with drops in ZARM catapult. Besides, a thermal stability is needed for the accelerometer core and front-end electronics to avoid bias and scale factor variation, and reached by a thermal box designed by Astrium, spacecraft manufacturer. The accelerometers are designed to endure the launch vibrations and the thermal environment at

Comments on "Long-Term Variations of Exospheric Temperature Inferred From foF1 Observations: A Comparison to ISR Ti Trend Estimates" by Perrone and Mikhailov

NASA Astrophysics Data System (ADS)

Zhang, Shun-Rong; Holt, John M.; Erickson, Philip J.; Goncharenko, Larisa P.

2018-05-01

Perrone and Mikhailov (2017, https://doi.org/10.1002/2017JA024193) and Mikhailov et al. (2017, https://doi.org/10.1002/2017JA023909) have recently examined thermospheric and ionospheric long-term trends using a data set of four thermospheric parameters (Tex, [O], [N2], and [O2]) and solar EUV flux. These data were derived from one single ionospheric parameter, foF1, using a nonlinear fitting procedure involving a photochemical model for the F1 peak. The F1 peak is assumed at the transition height ht with the linear recombination for atomic oxygen ions being equal to the quadratic recombination for molecular ions. This procedure has a number of obvious problems that are not addressed or not sufficiently justified. The potentially large ambiguities and biases in derived parameters make them unsuitable for precise quantitative ionospheric and thermospheric long-term trend studies. Furthermore, we assert that Perrone and Mikhailov (2017, https://doi.org/10.1002/2017JA024193) conclusions regarding incoherent scatter radar (ISR) ion temperature analysis for long-term trend studies are incorrect and in particular are based on a misunderstanding of the nature of the incoherent scatter radar measurement process. Large ISR data sets remain a consistent and statistically robust method for determining long term secular plasma temperature trends.

Fish Oil Supplementation Alleviates the Altered Lipid Homeostasis in Blood, Liver, and Adipose Tissues in High-Fat Diet-Fed Rats.

PubMed

Chiu, Chen-Yuan; Wang, Lou-Pin; Liu, Shing-Hwa; Chiang, Meng-Tsan

2018-04-25

This study investigated the effects of dietary supplementation of fish oil on the signals of lipid metabolism involved in hepatic cholesterol and triglyceride influx and excretion in high-fat diet (HFD)-fed rats. Fish oil (FO) repressed body (HFD, 533 ± 18.2 g; HFD+FO, 488 ± 28.0 g, p < 0.05) and liver weights (HFD, 5.7 ± 0.6 g/100 g of body weight; HFD+FO, 4.8 ± 0.4 g/100 g of body weight, p < 0.05) in HFD-fed rats. Fish oil could also improve HFD-induced imbalance of lipid metabolism in blood, liver, and adipose tissues including the significant decreases in plasma and liver total cholesterol (TC) (plasma-HFD, 113 ± 33.6 mg/dL; HFD+FO, 50.0 ± 5.95 mg/dL, p < 0.05; liver-HFD, 102 ± 13.0 mg/dL; HFD+FO, 86.6 ± 7.81 mg/dL, p < 0.05), blood, liver, and adipose triglyceride (TG) (blood-HFD, 52.5 ± 20.4 mg/dL; HFD+FO, 29.8 ± 4.30 mg/dL, p < 0.05; liver-HFD, 56.2 ± 10.0 mg/dL; HFD+FO, 30.3 ± 5.28 mg/dL, p < 0.05; adipose-HFD, 614 ± 73.2 mg/dL; HFD+FO, 409 ± 334 mg/dL, p < 0.05), and low density (HFD, 79.8 ± 40.9 mg/dL; HFD+FO, 16.6 ± 5.47 mg/dL, p < 0.05) and very-low-density (HFD, 49.7 ± 33.3 mg/dL; HFD+FO, 10.4 ± 3.45 mg/dL, p < 0.05) lipoprotein and the significant increases in fecal TC (HFD, 12.2 ± 0.67 mg/dL; HFD+FO, 16.3 ± 2.04 mg/dL, p < 0.05) and TG (HFD, 2.09 ± 0.10 mg/dL; HFD+FO, 2.38 ± 0.22 mg/dL, p < 0.05) and lipoprotein lipase activity of adipose tissues (HFD, 16.6 ± 3.64 μM p-nitrophenol; HFD+FO, 24.5 ± 4.19 μM p-nitrophenol, p < 0.05). Moreover, fish oil significantly activated the protein expressions of hepatic lipid metabolism regulators (AMPKα and PPARα) and significantly regulated the lipid-transport-related signaling molecules (ApoE, MTTP, ApoB, Angptl4, ApoCIII, ACOX1, and SREBPF1) in blood or liver of HFD-fed rats. These results suggest that fish oil supplementation improves HFD-induced imbalance of lipid homeostasis in blood, liver, and adipose tissues in rats.

Analysis of the Agger nasi cell and frontal sinus ostium sizes using computed tomography of the paranasal sinuses.

PubMed

Angélico, Fernando Veiga; Rapoport, Priscila Bogar

2013-01-01

The Agger nasi cell (ANC) and the frontal sinus ostium (FO) are important structures that can influence the anatomy and physiology of the frontal recess. The aim of this study was to evaluate the presence and size of ANC and the FO and correlate them according to gender, race and among themselves. A prospective study with 40 patients who underwent CT of the paranasal sinuses with sagittal reconstruction. ANC (APAN) anteroposterior diameter, ANC (CCAN) craniocaudal diameter, ANC (LLAN) side-to-side diameter, anteroposterior diameter of the FO (APFO) and side-to-side diameter of the FO (LLFO). Twenty-two patients were male and 18 females, mean age 33.7 years. Most patients were white (45%), followed by browns (32.5%), blacks (20%) and asians (2.5%). The ANC was present in 98.7% of patients. There was statistical difference for APAN on females and LLAN on females and on the total sample. There were no differences for all measurements regarding gender, as well as the race. ANC and FO measurements showed positive correlation, but poor or very poor. The prevalence of ANC in our sample was high and did not show a statistically significant difference for most measurements. The correlation between measurements of ANC and the FO was poor or very poor.

A new nanocomposite forward osmosis membrane custom-designed for treating shale gas wastewater

PubMed Central

Qin, Detao; Liu, Zhaoyang; Delai Sun, Darren; Song, Xiaoxiao; Bai, Hongwei

2015-01-01

Managing the wastewater discharged from oil and shale gas fields is a big challenge, because this kind of wastewater is normally polluted by high contents of both oils and salts. Conventional pressure-driven membranes experience little success for treating this wastewater because of either severe membrane fouling or incapability of desalination. In this study, we designed a new nanocomposite forward osmosis (FO) membrane for accomplishing simultaneous oil/water separation and desalination. This nanocomposite FO membrane is composed of an oil-repelling and salt-rejecting hydrogel selective layer on top of a graphene oxide (GO) nanosheets infused polymeric support layer. The hydrogel selective layer demonstrates strong underwater oleophobicity that leads to superior anti-fouling capability under various oil/water emulsions, and the infused GO in support layer can significantly mitigate internal concentration polarization (ICP) through reducing FO membrane structural parameter by as much as 20%. Compared with commercial FO membrane, this new FO membrane demonstrates more than three times higher water flux, higher removals for oil and salts (>99.9% for oil and >99.7% for multivalent ions) and significantly lower fouling tendency when investigated with simulated shale gas wastewater. These combined merits will endorse this new FO membrane with wide applications in treating highly saline and oily wastewaters. PMID:26416014

Petrography and geochemistry of volcanic rocks from the Niemodlin area (SW Poland)

NASA Astrophysics Data System (ADS)

Jakubiak, Artur; Pietranik, Anna; Łyczewska, Ewelina

2010-05-01

The Tertiary volcanic rocks of the Opole Silesia (SW Poland) belong to the easternmost part of the Central European Volcanic Province (CEVP). Various volcanic rocks occur in the Opole region including melanephelinites, melabasanites, nephelinites and nephelinite basalts. Radiometric ages (K - Ar method) of these rocks range from 21,2 to 30,5Ma [1]. Here, we characterize volcanic rocks from two active quarries 'Gracze' and 'Rutki - Ligota'. According to the TAS diagram, the rocks from 'Gracze' classify as nephelinites and those from 'Rutki-Ligota' as basanites. Mineral composition is very similar in both groups of rocks. Nephelinite consists of olivine, clinopyroxene, nepheline, Ti-Fe oxide and apatite. Basanite consists of olivine, clinopyroxene, nepheline, plagioclase, Ti-Fe oxide and apatite. Phenocrysts in both groups are olivine and clinopyroxene. The nephelinites from 'Gracze' contain more MgO (12,7 - 13,8 wt%) than the basanites from 'Rutki-Ligota' (MgO 10,8 - 12,0 wt%). However, chemical composition of minerals in the basanites and nephelinites is similar, though minerals in the nephelinites are more homogenous. Olivine phenocrysts in the nephelinites show compositional variations from Fo73to Fo87(?Fo = 14), Ca = 100-4600 ppm and Ni = 500-4700 ppm. In contrast, olivine phenocrysts in the basanites span a wider compositional range from Fo63- Fo88 (?Fo = 25), Ca = 1000-6350 ppm and Ni = 400-3150 ppm. In both groups of rocks the forsterite and Ni content is higher in the cores (Fo78 -Fo88,Ni = 500 - 3800ppm in nephelinites, Fo75 - Fo88, Ni = 500 - 3200ppm in basanites) and lower in the rims (Fo73 -Fo81,Ni = 550 - 4750ppm in nephelinites, Fo66 - Fo84, Ni = 300 - 2350ppm in basanites) while Ca content is lower in the cores (Ca = 100 - 3700ppmin nephelinites, Ca = 1000 - 3150ppm in basanites) and higher in the rims (Ca = 1850 - 4600ppm in nephelinites, Ca = 1400 - 5450ppm in basanites). However, the lowest contents of Ca (100 - 1000 ppm) were observed only in a

Optical fiber sensors: Systems and applications. Volume 2

NASA Astrophysics Data System (ADS)

Culshaw, Brian; Dakin, John

State-of-the-art fiber-optic (FO) sensors and their applications are described in chapters contributed by leading experts. Consideration is given to interferometers, FO gyros, intensity- and wavelength-based sensors and optical actuators, Si in FO sensors, point-sensor multiplexing principles, and distributed FO sensor systems. Also examined are chemical, biochemical, and medical sensors; physical and chemical sensors for process control; FO-sensor applications in the marine and aerospace industries; FO-sensor monitoring systems for security and safety, structural integrity, NDE, and the electric-power industry; and the market situation for FO-sensor technology. Diagrams, drawings, graphs, and photographs are provided.

Nonlinear Burning Stability of Solid Propellants.

DTIC Science & Technology

1983-12-31

de f()dO dX dO dX - dx d o d do d 20"--- - f( e ) 2- dX dX dX dX2 Therefore, the steady thermal profile for the same nondimensio- nal temperature...PF ,) C ( e ) de -H )-(1-r )Fo+q (0 gis 0 -C c o out s At the crossing of qg,s(P,R) with qg,s(P,Fo,®_ ), steady solutions R(P, Fo,1 ) vs qg,s are singled...PAGE (Wbrm Dets Entered) Is.-7 *0*" UNCLASSIFIED . " E C U R ITV C L A S S IF IC A T IO N O F T 0 IS P A G rwhI e D o ra E m, -- 20. Continued

Greater fluid overload and lower interdialytic weight gain are independently associated with mortality in a large international hemodialysis population.

PubMed

Hecking, Manfred; Moissl, Ulrich; Genser, Bernd; Rayner, Hugh; Dasgupta, Indranil; Stuard, Stefano; Stopper, Andrea; Chazot, Charles; Maddux, Franklin W; Canaud, Bernard; Port, Friedrich K; Zoccali, Carmine; Wabel, Peter

2018-04-20

Fluid overload and interdialytic weight gain (IDWG) are discrete components of the dynamic fluid balance in haemodialysis patients. We aimed to disentangle their relationship, and the prognostic importance of two clinically distinct, bioimpedance spectroscopy (BIS)-derived measures, pre-dialysis and post-dialysis fluid overload (FOpre and FOpost) versus IDWG. We conducted a retrospective cohort study on 38 614 incident patients with one or more BIS measurement within 90 days of haemodialysis initiation (1 October 2010 through 28 February 2015). We used fractional polynomial regression to determine the association pattern between FOpre, FOpost and IDWG, and multivariate adjusted Cox models with FO and/or IDWG as longitudinal and time-varying predictors to determine all-cause mortality risk. In analyses using 1-month averages, patients in quartiles 3 and 4 (Q3 and Q4) of FO had an incrementally higher adjusted mortality risk compared with reference Q2, and patients in Q1 of IDWG had higher adjusted mortality compared with Q2. The highest adjusted mortality risk was observed for patients in Q4 of FOpre combined with Q1 of IDWG [hazard ratio (HR) = 2.66 (95% confidence interval 2.21-3.20), compared with FOpre-Q2/IDWG-Q2 (reference)]. Using longitudinal means of FO and IDWG only slightly altered all HRs. IDWG associated positively with FOpre, but negatively with FOpost, suggesting a link with post-dialysis extracellular volume depletion. FOpre and FOpost were consistently positive risk factors for mortality. Low IDWG was associated with short-term mortality, suggesting perhaps an effect of protein-energy wasting. FOpost reflected the volume status without IDWG, which implies that this fluid marker is clinically most intuitive and may be best suited to guide volume management in haemodialysis patients.

Effects of ω-3 Polyunsaturated Fatty Acids on the Homeostasis of CD4+ T Cells and Lung Injury in Mice With Polymicrobial Sepsis.

PubMed

Chang, Yu-Fan; Hou, Yu-Chen; Pai, Man-Hui; Yeh, Sung-Ling; Liu, Jun-Jen

2017-07-01

Sepsis is a common cause of death in critically ill patients. An overwhelming inflammatory response and imbalance of helper T (Th) cells and regulatory T (Treg) cells are thought to be involved in the progression of sepsis. ω-3 Polyunsaturated fatty acids (PUFAs) were found to have anti-inflammatory and immunomodulatory properties. This study investigated the effects of ω-3 PUFAs on the balance of Th subsets, Treg cells, and the inflammatory response in septic mice. Mice were randomly assigned to soybean oil (SO) and fish oil (FO) groups. The 2 groups received an identical nutrient distribution except for the sources of the fat. The SO group was fed soybean oil, while part of the soybean oil was replaced by fish oil in the FO group. The FO group had an ω-6/ω-3 PUFA ratio of 2:1. After feeding the diets for 3 weeks, sepsis was induced by cecal ligation and puncture (CLP), and mice were sacrificed on days 0, 1, and 3. Compared with the SO group, the FO group had lower inflammatory mediator levels in the plasma and peritoneal lavage fluid after CLP. Also, the FO group had lower Th1, Th2, and Th17 percentages and a higher Th1/Th2 ratio in blood. In lung tissues, neutrophil infiltration was reduced, whereas peroxisome proliferator-activated receptor γ expression was upregulated. A fish oil diet with an ω-6/ω-3 PUFA ratio of 2:1 may elicit more balanced Th polarization, alleviate inflammatory responses, and attenuate lung injury in CLP-induced sepsis.

A short-term ionospheric forecasting empirical regional model (IFERM) to predict the critical frequency of the F2 layer during moderate, disturbed, and very disturbed geomagnetic conditions over the European area

NASA Astrophysics Data System (ADS)

Pietrella, M.

2012-02-01

A short-term ionospheric forecasting empirical regional model (IFERM) has been developed to predict the state of the critical frequency of the F2 layer (foF2) under different geomagnetic conditions. IFERM is based on 13 short term ionospheric forecasting empirical local models (IFELM) developed to predict foF2 at 13 ionospheric observatories scattered around the European area. The forecasting procedures were developed by taking into account, hourly measurements of foF2, hourly quiet-time reference values of foF2 (foF2QT), and the hourly time-weighted accumulation series derived from the geomagnetic planetary index ap, (ap(τ)), for each observatory. Under the assumption that the ionospheric disturbance index ln(foF2/foF2QT) is correlated to the integrated geomagnetic disturbance index ap(τ), a set of statistically significant regression coefficients were established for each observatory, over 12 months, over 24 h, and under 3 different ranges of geomagnetic activity. This data was then used as input to compute short-term ionospheric forecasting of foF2 at the 13 local stations under consideration. The empirical storm-time ionospheric correction model (STORM) was used to predict foF2 in two different ways: scaling both the hourly median prediction provided by IRI (STORM_foF2MED,IRI model), and the foF2QT values (STORM_foF2QT model) from each local station. The comparison between the performance of STORM_foF2MED,IRI, STORM_foF2QT, IFELM, and the foF2QT values, was made on the basis of root mean square deviation (r.m.s.) for a large number of periods characterized by moderate, disturbed, and very disturbed geomagnetic activity. The results showed that the 13 IFELM perform much better than STORM_foF2,sub>MED,IRI and STORM_foF2QT especially in the eastern part of the European area during the summer months (May, June, July, and August) and equinoctial months (March, April, September, and October) under disturbed and very disturbed geomagnetic conditions, respectively

DHA-rich Fish Oil Increases the Omega-3 Index and Lowers the Oxygen Cost of Physiologically Stressful Cycling in Trained Individuals.

PubMed

Hingley, Lachlan; Macartney, Michael J; Brown, Marc A; McLennan, Peter L; Peoples, Gregory E

2017-08-01

Dietary fish oil, providing docosahexaenoic acid (DHA) modulates oxygen consumption and fatigue in animal models. However, in humans predominately supplemented with high eicosapentaenoic acid (EPA), there is no evidence of endurance performance enhancement. Therefore, this study examined if DHA-rich fish oil could improve repeated bouts of physiologically stressful cycling and a subsequent time trial in a state of fatigue. Twenty-six trained males took part in a double-blind study and were supplemented with either 2 × 1g/day soy oil, Control) or DHA-rich tuna fish oil (Nu-Mega) (FO) (560mg DHA / 140mg eicosapentaenoic acid (EPA), for 8 weeks. Maximal cycling power (3 × 6s), isometric quadriceps strength (MVC), Wingate cycling protocol (6 × 30s) and a 5min cycling time-trial were assessed at baseline and eight weeks. The Omega-3 Index was not different at baseline (Control: 4.2 ± 0.2; FO: 4.7 ± 0.2%) and increased in the FO group after eight weeks (Control: 3.9 ± 0.2; FO: 6.3 ± 0.3%, p < .01). There was no effect of DHA-rich fish oil on power output of maximal 6s cycle sprinting (Control: Pre 1100 ± 49 Post 1067 ± 51; FO: Pre 1070 ± 46 Post 1042 ± 46W), during 5min time trail (Control: Pre 267 ± 19 Post 278 ± 20; FO: Pre 253 ± 16 Post 265 ± 16 W) or maximal voluntary contraction force (Control: Pre 273 ± 19 Post 251 ± 19; FO: Pre 287 ± 17 Post 283 ± 16 Nm). Nevertheless, relative oxygen consumption was reduced the FO group during the cycling time trial (Control: -23 ± 26; FO: -154 ± 59ml O2/min/100W p < .05) suggesting improved economy of cycling. We conclude that DHA-rich fish oil, successful at elevating the Omega-3 Index, and reflective of skeletal muscle membrane incorporation, can modulate oxygen consumption during intense exercise.

Internal medicine point-of-care ultrasound assessment of left ventricular function correlates with formal echocardiography.

PubMed

Johnson, Benjamin K; Tierney, David M; Rosborough, Terry K; Harris, Kevin M; Newell, Marc C

2016-02-01

Although focused cardiac ultrasonographic (FoCUS) examination has been evaluated in emergency departments and intensive care units with good correlation to formal echocardiography, accuracy for the assessment of left ventricular systolic function (LVSF) when performed by internal medicine physicians still needs independent evaluation. This prospective observational study in a 640-bed, academic, quaternary care center, included 178 inpatients examined by 10 internal medicine physicians who had completed our internal medicine bedside ultrasound training program. The ability to estimate LVSF with FoCUS as "normal," "mild to moderately decreased," or "severely decreased" was compared with left ventricular ejection fraction (>50%, 31-49%, and <31%, respectively) from formal echocardiography interpreted by a cardiologist. Sensitivity and specificity of FoCUS for any degree of LVSF impairment were 0.91 (95% confidence interval [CI] 0.80, 0.97) and 0.88 (95% CI 0.81, 0.93), respectively. The interrater agreement between internal medicine physician-performed FoCUS and formal echocardiography for any LVSF impairment was "good/substantial" with κ = 0.77 (p < 0.001), 95% CI (0.67, 0.87). Formal echocardiography was classified as "technically limited due to patient factors" in 20% of patients; however, echogenicity was sufficient in 100% of FoCUS exams to classify LVSF. Internal medicine physicians using FoCUS identify normal versus decreased LVSF with high sensitivity, specificity, and "good/substantial" interrater agreement when compared with formal echocardiography. These results support the role of cardiac FoCUS by properly trained internal medicine physicians for discriminating normal from reduced LVSF. © 2015 Wiley Periodicals, Inc.

Economic Evaluation of a Hybrid Desalination System Combining Forward and Reverse Osmosis

PubMed Central

Choi, Yongjun; Cho, Hyeongrak; Shin, Yonghyun; Jang, Yongsun; Lee, Sangho

2015-01-01

This study seeks to evaluate the performance and economic feasibility of the forward osmosis (FO)–reverse osmosis (RO) hybrid process; to propose a guideline by which this hybrid process might be more price-competitive in the field. A solution-diffusion model modified with film theory was applied to analyze the effects of concentration polarization, water, and salt transport coefficient on flux, recovery, seawater concentration, and treated wastewater of the FO process of an FO-RO hybrid system. A simple cost model was applied to analyze the effects of flux; recovery of the FO process; energy; and membrane cost on the FO-RO hybrid process. The simulation results showed that the water transport coefficient and internal concentration polarization resistance are very important factors that affect performance in the FO process; however; the effect of the salt transport coefficient does not seem to be large. It was also found that the flux and recovery of the FO process, the FO membrane, and the electricity cost are very important factors that influence the water cost of an FO-RO hybrid system. This hybrid system can be price-competitive with RO systems when its recovery rate is very high, the flux and the membrane cost of the FO are similar to those of the RO, and the electricity cost is expensive. The most important thing in commercializing the FO process is enhancing performance (e.g.; flux and the recovery of FO membranes). PMID:26729176

Assessment of an ensemble seasonal streamflow forecasting system for Australia

NASA Astrophysics Data System (ADS)

Bennett, James C.; Wang, Quan J.; Robertson, David E.; Schepen, Andrew; Li, Ming; Michael, Kelvin

2017-11-01

Despite an increasing availability of skilful long-range streamflow forecasts, many water agencies still rely on simple resampled historical inflow sequences (stochastic scenarios) to plan operations over the coming year. We assess a recently developed forecasting system called forecast guided stochastic scenarios (FoGSS) as a skilful alternative to standard stochastic scenarios for the Australian continent. FoGSS uses climate forecasts from a coupled ocean-land-atmosphere prediction system, post-processed with the method of calibration, bridging and merging. Ensemble rainfall forecasts force a monthly rainfall-runoff model, while a staged hydrological error model quantifies and propagates hydrological forecast uncertainty through forecast lead times. FoGSS is able to generate ensemble streamflow forecasts in the form of monthly time series to a 12-month forecast horizon. FoGSS is tested on 63 Australian catchments that cover a wide range of climates, including 21 ephemeral rivers. In all perennial and many ephemeral catchments, FoGSS provides an effective alternative to resampled historical inflow sequences. FoGSS generally produces skilful forecasts at shorter lead times ( < 4 months), and transits to climatology-like forecasts at longer lead times. Forecasts are generally reliable and unbiased. However, FoGSS does not perform well in very dry catchments (catchments that experience zero flows more than half the time in some months), sometimes producing strongly negative forecast skill and poor reliability. We attempt to improve forecasts through the use of (i) ESP rainfall forcings, (ii) different rainfall-runoff models, and (iii) a Bayesian prior to encourage the error model to return climatology forecasts in months when the rainfall-runoff model performs poorly. Of these, the use of the prior offers the clearest benefit in very dry catchments, where it moderates strongly negative forecast skill and reduces bias in some instances. However, the prior does

Effect of dietary seaweed extracts and fish oil supplementation in sows on performance, intestinal microflora, intestinal morphology, volatile fatty acid concentrations and immune status of weaned pigs.

PubMed

Leonard, S G; Sweeney, T; Bahar, B; Lynch, B P; O'Doherty, J V

2011-02-01

A 2x2 factorial experiment (ten sows per treatment) was conducted to investigate the effect of maternal dietary supplementation with a seaweed extract (SWE; 0 v. 10·0 g/d) and fish oil (FO; 0 v. 100 g/d) inclusion from day 109 of gestation until weaning (day 26) on pig performance post-weaning (PW) and intestinal morphology, selected microflora and immune status of pigs 9 d PW. The SWE contained laminarin (10 %), fucoidan (8 %) and ash (82 %) and the FO contained 40 % EPA and 25 % DHA. Pigs weaned from SWE-supplemented sows had higher daily gain (P=0·063) between days 0 and 21 PW and pigs weaned from FO-supplemented sows had higher daily gain (P<0·05) and gain to feed ratio (P<0·01) between days 7 and 14 PW. There was an interaction between maternal SWE and FO supplementation on caecal Escherichia coli numbers (P<0·05) and the villous height to crypt depth ratio in the ileum (P<0·01) and jejunum (P<0·05) in pigs 9 d PW. Pigs weaned from SWE-supplemented sows had lower caecal E. coli and a higher villous height to crypt depth ratio in the ileum and jejunum compared with non-SWE-supplemented sows (P<0·05). There was no effect of SWE on E. coli numbers and villous height to crypt depth ratio with FO inclusion. Maternal FO supplementation induced an increase in colonic mRNA abundance of IL-1α and IL-6 (P<0·05), while SWE supplementation induced an increase in ileal TNF-α (P<0·01) and colonic TFF3 mRNA expression (P<0·05). In conclusion, these results demonstrate that SWE and FO supplementation to the maternal diet influenced the gastrointestinal environment and performance of the weaned pig.

Tests Results of the Electrostatic Accelerometer Flight Models for Gravity Recovery and Climate Experiment Follow-On Mission (GRACE FO)

NASA Astrophysics Data System (ADS)

Perrot, E.; Boulanger, D.; Christophe, B.; Foulon, B.; Lebat, V.; Huynh, P. A.; Liorzou, F.

2015-12-01

The GRACE FO mission, led by the JPL (Jet Propulsion Laboratory), is an Earth-orbiting gravity mission, continuation of the GRACE mission, which will produce an accurate model of the Earth's gravity field variation providing global climatic data during five years at least. The mission involves two satellites in a loosely controlled tandem formation, with a micro-wave link measuring the inter-satellites distance variation. Earth's mass distribution non-uniformities cause variations of the inter-satellite distance. This variation is measured to recover gravity, after subtracting the non-gravitational contributors, as the residual drag. ONERA (the French Aerospace Lab) is developing, manufacturing and testing electrostatic accelerometers measuring this residual drag applied on the satellites. The accelerometer is composed of two main parts: the Sensor Unit (including the Sensor Unit Mechanics - SUM - and the Front-End Electronic Unit - FEEU) and the Interface Control Unit - ICU. In the Accelerometer Core, located in the Sensor Unit Mechanics, the proof mass is levitated and maintained at the center of an electrode cage by electrostatic forces. Thus, any drag acceleration applied on the satellite involves a variation on the servo-controlled electrostatic suspension of the mass. The voltage on the electrodes providing this electrostatic force is the output measurement of the accelerometer. The impact of the accelerometer defaults (geometry, electronic and parasitic forces) leads to bias, misalignment and scale factor error, non-linearity and noise. Some of these accelerometer defaults are characterized by tests with micro-gravity pendulum bench on ground and with drops in ZARM catapult. The Critical Design Review was achieved successfully on September 2014. The Engineering Model (EM) was integrated and tested successfully, with ground levitation, drops, Electromagnetic Compatibility and thermal vacuum. The integration of the two Flight Models was done on July 2015. The

Crystal structure of the mineral (Na,Ca,K)2(Ca,Na)4(Mg,Fe)5(Mg,Fe,Ti)5[Si12Al4O44](F,O)4: a triclinic representative of the amphibole family

NASA Astrophysics Data System (ADS)

Rastsvetaeva, R. K.; Aksenov, S. M.

2012-05-01

A mineral belonging to the amphibole family found at the Rothenberg paleovolcano (Eifel, Germany) was studied by single-crystal X-ray diffraction. The triclinic pseudomonoclinic unit-cell parameters are a = 5.3113(1) Å, b = 18.0457(3) Å; c = 9.8684(2) Å, α = 90.016(2)°, β = 105.543(4)°, γ = 89.985(2)°. The structure was solved by direct methods in sp. gr. P1 and refined to the R factor of 2.7% based on 6432 reflections with | F| > 3σ( F) taking into account twinning. The mineral with the idealized formula (Na,Ca,K)2(Ca,Na)4(Mg,Fe)5(Mg,Fe,Ti)5[Si12Al4O44](F,O)4 has some symmetry and structural features that distinguish it from other minerals of this family.

A novel α-galactosidase from Fusarium oxysporum and its application in determining the structure of the gum arabic side chain.

PubMed

Maruta, Akiho; Yamane, Mirei; Matsubara, Midori; Suzuki, Shiho; Nakazawa, Masami; Ueda, Mitsuhiro; Sakamoto, Tatsuji

2017-08-01

We previously reported that Fusarium oxysporum 12S produces two bifunctional proteins, FoAP1 and FoAP2, with α-d-galactopyranosidase (GPase) and β-l-arabinopyranosidase (APase) activities. The aim of this paper was to purify a third GPase, FoGP1, from culture supernatant of F. oxysporum 12S, to characterize it, and to determine its mode of action towards gum arabic. A cDNA encoding FoGP1 was cloned and the protein was overexpressed in Escherichia coli. Module sequence analysis revealed the presence of a GH27 domain in FoGP1. The recombinant enzyme (rFoGP1) showed a GPase/APase activity ratio of 330, which was quite different from that of FoAP1 (1.7) and FoAP2 (0.2). Among the natural substrates tested, rFoGP1 showed the highest activity towards gum arabic. In contrast to other well-characterized GPases, rFoGP1 released a small amount of galactose from α-galactosyl oligosaccharides such as raffinose and exhibited no activity toward galactomannans, which are highly substituted with α-galactosyl side chains. This indicated that FoGP1 is an unusual type of GPase. rFoGP1 released 30% of the total galactose from gum arabic, suggesting the existence of a large number of α-galactosyl residues at the non-reducing ends of gum arabic side chains. Together, rFoGP1 and α-l-arabinofuranosidase released four times more arabinose than α-l-arabinofuranosidase acting alone. This suggested that a large number of α-l-arabinofuranosyl residues is capped by α-galactosyl residues. 1 H NMR experiments revealed that rFoGP1 hydrolyzed the α-1,3-galactosidic linkage within the side chain structure of [α-d-Galp-(1→3)-α-l-Araf-(1→] in gum arabic. In conclusion, rFoGP1 is highly active toward α-1,3-galactosyl linkages but negligibly or not active toward α-1,6-galactosyl linkages. The novel FoGP1 might be used to modify the physical properties of gum arabic, which is an industrially important polysaccharide used as an emulsion stabilizer and coating agent. Copyright © 2017

Fetal myocardial deformation in maternal diabetes mellitus and obesity.

PubMed

Kulkarni, A; Li, L; Craft, M; Nanda, M; Lorenzo, J M M; Danford, D; Kutty, S

2017-05-01

Experimental evidence suggests that changes in the fetal myocardium result from intrauterine effects of maternal diabetes mellitus and obesity. The aim of this study was to assess fetal cardiac function using two-dimensional speckle-tracking echocardiography to determine the effects of maternal diabetes and obesity on the fetal myocardium. Comparative cross-sectional evaluation of myocardial function in fetuses of mothers with diabetes mellitus (FDM) or obesity (FO) and normal gestational age-matched control fetuses (FC) was performed using two-dimensional speckle-tracking echocardiography at two centers. In total, 178 fetuses (82 FDM, 26 FO and 70 FC) met the enrolment criteria. Mean gestational age at assessment was similar among groups: 25.3 ± 5.1 weeks for FDM, 25.0 ± 4.6 weeks for FO and 25.1 ± 4.9 weeks for FC. Mean maternal body mass index was significantly higher in FDM and FO groups compared with the FC group. Statistically significant differences in fetal cardiac function were detected between FDM and FC for global longitudinal strain (mean ± SD, -21.4 ± 6.5% vs -27.0 ± 5.2%; P < 0.001), global circumferential strain (mean ± SD, -22.6 ± 6.5% vs -26.2 ± 6.8%; P = 0.002), average longitudinal systolic strain rate (median, -1.4 (interquartile range (IQR), -1.7 to -1.1)/s vs -1.6 (IQR, -2.0 to -1.4)/s; P = 0.001) and average circumferential systolic strain rate (median, -1.4 (IQR, -1.9 to -1.1)/s vs -1.6 (IQR, -2.1 to -1.3)/s; P = 0.006). Cases of non-obese FDM also had abnormal strain parameters compared with FC. Global longitudinal strain (mean ± SD, -21.1 ± 7.5%) and average circumferential systolic strain rate (median, -1.3 (IQR, -1.8 to -1.1)/s) were significantly lower in FO compared with FC. Unfavorable changes occur in the fetal myocardium in response to both maternal diabetes mellitus and obesity. The long-term prognostic implications of these changes require further study

Description of the Main Ionospheric Trough by the SM-MIT Model. European Longitudinal Sector

NASA Astrophysics Data System (ADS)

Leshchinskaya, T. Yu.; Pustovalova, L. V.

2018-05-01

Due to the selection of exsisting ionospheric models for incorporation into the created System of Ionospheric Monotoring and Prediction of the Russian Federation, the model of the main ionospheric trough (SM-MIT) is tested with the data from ground-based ionospheric observations in the European longitudinal sector. It is shown that the SM-MIT model does not give an increase in accuracy in comparison to the foF2 monthly median upon a description of the equatorial wall of the MIT. The model describes the foF2 values in the MIT minimum with higher accuracy than the foF2 monthly median or the median IRI model; however, at the same time, the deviations of the model foF2 values from the observed values are high enough: 20-30%. In the MIT minimum, the decrease in the model foF2 values relative to the median values is on average only 10%, which is substantially less than the observed depth of MIT in the evening sector. The verification results have shown that the available SM-MIT model must be completed for practical use.

Comparison of biofouling mechanisms between cellulose triacetate (CTA) and thin-film composite (TFC) polyamide forward osmosis membranes in osmotic membrane bioreactors.

PubMed

Wang, Xinhua; Zhao, Yanxiao; Yuan, Bo; Wang, Zhiwei; Li, Xiufen; Ren, Yueping

2016-02-01

There are two types of popular forward osmosis (FO) membrane materials applied for researches on FO process, cellulose triacetate (CTA) and thin film composite (TFC) polyamide. However, performance and fouling mechanisms of commercial TFC FO membrane in osmotic membrane bioreactors (OMBRs) are still unknown. In current study, its biofouling behaviors in OMBRs were investigated and further compared to the CTA FO membrane. The results indicated that β-D-glucopyranose polysaccharides and microorganisms accounted for approximately 77% of total biovolume on the CTA FO membrane while β-D-glucopyranose polysaccharides (biovolume ratio of 81.1%) were the only dominant biofoulants on the TFC FO membrane. The analyses on the biofouling structure implied that a tighter biofouling layer with a larger biovolume was formed on the CTA FO membrane. The differences in biofouling behaviors including biofoulants composition and biofouling structure between CTA and TFC FO membranes were attributed to different membrane surface properties. Copyright © 2015 Elsevier Ltd. All rights reserved.

Trace organic solutes in closed-loop forward osmosis applications: influence of membrane fouling and modeling of solute build-up.

PubMed

D'Haese, Arnout; Le-Clech, Pierre; Van Nevel, Sam; Verbeken, Kim; Cornelissen, Emile R; Khan, Stuart J; Verliefde, Arne R D

2013-09-15

In this study, trace organics transport in closed-loop forward osmosis (FO) systems was assessed. The FO systems considered, consisted of an FO unit and a nanofiltration (NF) or reverse osmosis (RO) unit, with the draw solution circulating between both units. The rejection of trace organics by FO, NF and RO was tested. It was found that the rejection rates of FO were generally comparable with NF and lower than RO rejection rates. To assess the influence of fouling in FO on trace organics rejection, FO membranes were fouled with sodium alginate, bovine serum albumin or by biofilm growth, after which trace organics rejection was tested. A negative influence of fouling on FO rejection was found which was limited in most cases, while it was significant for some compounds such as paracetamol and naproxen, indicating specific compound-foulant interactions. The transport mechanism of trace organics in FO was tested, in order to differentiate between diffusive and convective transport. The concentration of trace organics in the final product water and the build-up of trace organics in the draw solution were modeled assuming the draw solution was reconcentrated by NF/RO and taking into account different transport mechanisms for the FO membrane and different rejection rates by NF/RO. Modeling results showed that if the FO rejection rate is lower than the RO rejection rate (as is the case for most compounds tested), the added value of the FO-RO cycle compared to RO only at steady-state was small for diffusively and negative for convectively transported trace organics. Modeling also showed that trace organics accumulate in the draw solution. Copyright © 2013 Elsevier Ltd. All rights reserved.

Valence State Partitioning of Cr and V Between Olivine-Melt and Pyroxene-Melt in Experimental Basalts of a Eucritic Composition

NASA Technical Reports Server (NTRS)

Karner, J. M.; Jones, J. H.; Le, L.

2017-01-01

The partitioning of multivalent elements in basaltic systems can elucidate the oxygen fugacity (fO2) conditions under which basalts formed on planetary bodies (Earth, Moon, Mars, asteroids). Chromium and V are minor and trace elements in basaltic melts, partition into several minerals that crystallize from basaltic melts, exist in multiple valence states at differing fO2 conditions, and can therefore be used as oxybarometers for basaltic melts. Chromium is mostly 3+ in terrestrial basaltic melts at relatively high fO2 values (= IW+3.5), and mostly 2+ in melts at low fO2 values (= IW-1), such as those on the Moon and some asteroids. At intermediate fO2s, (i.e., IW-1 to IW+3.5), basaltic melts contain both Cr3+ and Cr2+. Vanadium in basaltic melts is mostly 4+ at high fO2, mostly 3+ at low fO2, and a mix of V3+ and V4+ at intermediate fO2 con-ditions. Understanding the partitioning of Cr and V into silicate phases with changing fO2 is therefore critical to the employment of Cr and V oxybarometers. In this abstract we examine the equilibrium partitioning of Cr and V between olivine/melt and pyroxene/melt in experimental charges of a eucritic composition produced at differing fO2 conditions. This study will add to the experimental data on DCr and DV (i.e., olivine/melt, pyroxene/melt) at differing fO2, and in turn these D values will be used to assess the fO2 of eucrite basalts and perhaps other compositionally similar planetary basalts.

Figures of Merit Software: Description, User's Guide, Installation Notes, Versions Description, and License Agreement

NASA Technical Reports Server (NTRS)

hoelzer, H. D.; Fourroux, K. A.; Rickman, D. L.; Schrader, C. M.

2011-01-01

Figures of Merit (FoMs) and the FoM software provide a method for quantitatively evaluating the quality of a regolith simulant by comparing the simulant to a reference material. FoMs may be used for comparing a simulant to actual regolith material, specification by stating the value a simulant s FoMs must attain to be suitable for a given application and comparing simulants from different vendors or production runs. FoMs may even be used to compare different simulants to each other. A single FoM is conceptually an algorithm that computes a single number for quantifying the similarity or difference of a single characteristic of a simulant material and a reference material and provides a clear measure of how well a simulant and reference material match or compare. FoMs have been constructed to lie between zero and 1, with zero indicating a poor or no match and 1 indicating a perfect match. FoMs are defined for modal composition, particle size distribution, particle shape distribution, (aspect ratio and angularity), and density. This TM covers the mathematics, use, installation, and licensing for the existing FoM code in detail.

Theoretical resolution of the H- resonance spectrum up to the n=4 threshold. I. States of 1Po, 1Do, and 1Fo symmetries

NASA Astrophysics Data System (ADS)

Bylicki, Mirosław; Nicolaides, Cleanthes A.

2000-05-01

We report on a theoretical approach to the calculation of wave functions, energies E, and widths Γ of high-lying resonances of H-, with application to the identification of 76 states of 1Po, 1Do, and 1Fo symmetries up to the n=4 threshold, with widths down to about 1×10-8-1×10-10 a.u., depending on symmetry and threshold. The overwhelming majority of these resonances have not been detected experimentally. Previous calculations by different methods allowed the identification of 35 of these states, with only very few cases having a level of accuracy comparable to the one of the present work. We suggest that the measurement of these resonances might become possible via two-step excitation mechanisms using ultrasensitive techniques capable of dealing with the problems of very small widths and preparation cross-sections. In this work, the 1D state at 10.872 eV above the H-1s2 1S ground state, already prepared and measured by electron scattering as well as by two-photon absorption, is considered as the stepping stone for the possible probing of resonances of 1Po, 1Do, and 1Fo symmetries via absorption of tunable radiation of high resolution. By classifying the results according to the Gailitis-Damburg model of dipole resonances (a product of a 1/r2-like potential) we find that there are unperturbed as well as perturbed series, in analogy with the Rydberg spectra of neutrals and positive ions (a product of a 1/r-like potential). For the former, the agreement with the Gailitis-Damburg predictions as to the relationship of the extent of the outer orbital and of the energies and widths of states is excellent. The perturbed series result from interchannel coupling and the remaining electron correlation. One of the effects is the existence of overlapping resonances. For example, for two 1Po states below the n=3 threshold there is degeneracy on the energy axis (E1=-0.0555763612 a.u. and E2=-0.0555763099 a.u.) but the widths differ (Γ1=1.14×10-4 eV and Γ2=5.45×10-6 e

Nanoscale patterning of gold-coated optical fibers for improved plasmonic sensing

NASA Astrophysics Data System (ADS)

Antohe, Iulia; Spasic, Dragana; Delport, Filip; Li, Jiaqi; Lammertyn, Jeroen

2017-05-01

Merging surface plasmon resonance (SPR) to fiber optic (FO) technology has brought remarkable achievements in the field by offering attractive advantages over the conventional prism-based SPR platforms, such as simplicity, cost-effectiveness and miniaturization. However, the performance of the existing FO-SPR instruments mainly depends on the device surface condition and in particular on the structural aspect of the thin gold (Au) plasmonic film deposited on the FO substrate. In this work, a simple cost-effective colloidal lithography technique (CLT) was adapted and applied for the first time to the micrometer-sized FO substrate, to design end reflection-type FO-SPR sensors with periodic arrays of Au triangularly-shaped nanostructures on the Au mirror FO tip distal end. The nanopatterned FO-SPR sensor tips were afterwards subjected to refractometric measurements in a sucrose dilution series and subsequently compared with their non-patterned counterparts. It was observed that the spectral dips of the nanopatterned FO-SPR sensor tips were shifted towards longer wavelengths after CLT patterning. Moreover, the sensor sensitivity was improved with up to 25% compared to the conventional non-patterned FO-SPR devices. The obtained results represent important steps in the development of a new generation of FO-SPR sensors with improved performance, which can ultimately be used in various applications, ranging from food analysis and environmental monitoring, to health control and medical diagnosis.

Flaxseed oil-trastuzumab interaction in breast cancer.

PubMed

Mason, Julie K; Chen, Jianmin; Thompson, Lilian U

2010-01-01

Flaxseed oil (FO), which is rich in n-3 fatty acid, is commonly consumed by breast cancer patients because of its potential anti-cancer effects. Trastuzumab (TRAS) is the primary drug for epidermal growth factor receptor 2 (HER2) positive breast cancer. We investigated in athymic mice whether combining dietary FO (8%) with TRAS treatment (2.5 or 5mg/kg body weight) can cause better or adverse effect on established human breast tumors overexpressing HER2 (BT-474). Control tumors significantly grew 187%, TRAS2.5 treated tumors did not change, while TRAS5, FO+TRAS2.5 and FO+TRAS5 treated tumors significantly regressed 75%, 89% and 84%, respectively, after 4weeks treatment. Two weeks after stopping TRAS treatment while continuing on same diet, tumor size in FO+TRAS2.5 group was 87% lower than in TRAS2.5 group and was not different from TRAS5 group with or without FO. Combined TRAS2.5 treatment with FO caused a significantly lower tumor cell proliferation and higher apoptosis compared to TRAS2.5 treatment alone and showed similar effect to TRAS5 treatment with or without FO. Hence, FO did not interfere with TRAS but rather enhanced its tumor-reducing effects and combined FO and low dose TRAS was as effective as high dose TRAS treatment. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

The ionosphere of Europe and North America before the magnetic storm of October 28, 2003

NASA Astrophysics Data System (ADS)

Blagoveshchensky, D. V.; Macdugall, J. W.; Pyatkova, A. V.

2006-05-01

The X17 solar flare occurred on October 28, 2003, and was followed by the X10 flare on October 29. These flares caused very strong geomagnetic storms (Halloween storms). The aim of the present study is to compare the variations in two main ionospheric parameters ( foF2 and hmF2) at two chains of ionosondes located in Europe and North America for the period October 23-28, 2003. This interval began immediately before the storm of October 28 and includes its commencement. Another task of the work is to detect ionospheric precursors of the storm or substorm expansion phase. An analysis is based on SPIDR data. The main results are as follows. The positive peak of δ foF2 (where δ is the difference between disturbed and quiet values) is observed several hours before the magnetic storm or substorm commencement. This peak can serve as a disturbance precursor. The amplitude of δ foF2 values varies from 20 to 100% of the foF2 values. The elements of similarity in the variations in the δ foF2 values at two chains are as follows: (a) the above δ foF2 peak is as a rule observed simultaneously at two chains before the disturbance; (b) the δ foF2 variations are similar at all midlatitude (or, correspondingly, high-latitude) ionosondes of the chain. The differences in the δ foF2 values are as follows: (a) the effect of the main phase and the phase of strong storm recovery at one chain differs from such an effect at another chain; (b) the manifestation of disturbances at high-latitude stations of the chain differ from the manifestations at midlatitude stations. The δ hmF2 variations are approximately opposite to the δ foF2 variations, and the δ hmF2 values lie in the interval 15-25% of the hmF2 values. The performed study is useful and significant in studying the problems of the space weather, especially in a short-term prediction of ionospheric disturbances caused by magnetospheric storms or substorms.

Neuroprotective efficacy of a combination of fish oil and ferulic acid against 3-nitropropionic acid-induced oxidative stress and neurotoxicity in rats: behavioural and biochemical evidence.

PubMed

K M, Denny Joseph; Muralidhara

2014-04-01

The beneficial effects of fish oil (FO) supplements on the central nervous system have been adequately demonstrated. However, FO supplementation at higher doses for longer duration is likely to cause oxidative stress in vivo. To overcome this, attempts have been made to enrich FO with known antioxidants/phytochemicals. In the present study, we examined the hypothesis that a combination of FO with ferulic acid (FA), a naturally occurring phenolic compound, is likely to provide higher degree of neuroprotection. This was examined by employing 3-nitropropionic acid (NPA), a well-known neurotoxin used to mimic behavioural and neurochemical features of Huntington's disease. Growing male rats administered with NPA (25 mg/kg of body weight (bw) for 4 days) were provided with either FO (2 mL/kg bw), FA (50 mg/kg bw) or FO+FA for 2 weeks. Interestingly, FO+FA not only offered significant protection against NPA-induced behavioural impairments, but also markedly attenuated oxidative stress in brain regions (striatum/cerebellum) as evidenced by the reduction in reactive species, malondialdehyde, hydroperoxides and nitric oxide (NO) levels. Further, FO+FA combination restored the activities of various antioxidant enzymes and the levels of cytosolic calcium. In striatum, activity levels of acetylcholinesterase enzyme and dopamine levels were markedly restored among FO+FA rats. Interestingly, NPA-induced mitochondrial dysfunctions were also attenuated among FO+FA rats. Collectively, our findings suggest the advantage of co-treatment of FO with known antioxidants to achieve a higher therapeutic benefit in the treatment of oxidative stress-mediated neurodegenerative conditions.

Radioanalytical Chemistry for Automated Nuclear Waste Process Monitoring

DOE Office of Scientific and Technical Information (OSTI.GOV)

Devol, Timothy A.

2005-06-01

Comparison of different pulse shape discrimination methods was performed under two different experimental conditions and the best method was identified. Beta/gamma discrimination of 90Sr/90Y and 137Cs was performed using a phoswich detector made of BC400 (2.5 cm OD x 1.2 cm) and BGO (2.5 cm O.D. x 2.5 cm ) scintillators. Alpha/gamma discrimination of 210Po and 137Cs was performed using a CsI:Tl (2.8 x 1.4 x 1.4 cm3) scintillation crystal. The pulse waveforms were digitized with a DGF-4c (X-Ray Instrumentation Associates) and analyzed offline with IGOR Pro software (Wavemetrics, Inc.). The four pulse shape discrimination methods that were compared include:more » rise time discrimination, digital constant fraction discrimination, charge ratio, and constant time discrimination (CTD) methods. The CTD method is the ratio of the pulse height at a particular time after the beginning of the pulse to the time at the maximum pulse height. The charge comparison method resulted in a Figure of Merit (FoM) of 3.3 (9.9 % spillover) and 3.7 (0.033 % spillover) for the phoswich and the CsI:Tl scintillator setups, respectively. The CTD method resulted in a FoM of 3.9 (9.2 % spillover) and 3.2 (0.25 % spillover), respectively. Inverting the pulse shape data typically resulted in a significantly higher FoM than conventional methods, but there was no reduction in % spillover values. This outcome illustrates that the FoM may not be a good scheme for the quantification of a system to perform pulse shape discrimination. Comparison of several pulse shape discrimination (PSD) methods was performed as a means to compare traditional analog and digital PSD methods on the same scintillation pulses. The X-ray Instrumentation Associates DGF-4C (40 Msps, 14-bit) was used to digitize waveforms from a CsI:Tl crystal and BC400/BGO phoswich detector.« less

Gait-Related Brain Activity in People with Parkinson Disease with Freezing of Gait

PubMed Central

Peterson, Daniel S.; Pickett, Kristen A.; Duncan, Ryan; Perlmutter, Joel; Earhart, Gammon M.

2014-01-01

Approximately 50% of people with Parkinson disease experience freezing of gait, described as a transient inability to produce effective stepping. Complex gait tasks such as turning typically elicit freezing more commonly than simple gait tasks, such as forward walking. Despite the frequency of this debilitating and dangerous symptom, the brain mechanisms underlying freezing remain unclear. Gait imagery during functional magnetic resonance imaging permits investigation of brain activity associated with locomotion. We used this approach to better understand neural function during gait-like tasks in people with Parkinson disease who experience freezing- “FoG+” and people who do not experience freezing- ”FoG−“. Nine FoG+ and nine FoG− imagined complex gait tasks (turning, backward walking), simple gait tasks (forward walking), and quiet standing during measurements of blood oxygen level dependent (BOLD) signal. Changes in BOLD signal (i.e. beta weights) during imagined walking and imagined standing were analyzed across FoG+ and FoG− groups in locomotor brain regions including supplementary motor area, globus pallidus, putamen, mesencephalic locomotor region, and cerebellar locomotor region. Beta weights in locomotor regions did not differ for complex tasks compared to simple tasks in either group. Across imagined gait tasks, FoG+ demonstrated significantly lower beta weights in the right globus pallidus with respect to FoG−. FoG+ also showed trends toward lower beta weights in other right-hemisphere locomotor regions (supplementary motor area, mesencephalic locomotor region). Finally, during imagined stand, FoG+ exhibited lower beta weights in the cerebellar locomotor region with respect to FoG−. These data support previous results suggesting FoG+ exhibit dysfunction in a number of cortical and subcortical regions, possibly with asymmetric dysfunction towards the right hemisphere. PMID:24595265

On the Analytical Inversion of Lidar Returns from an Inhomogeneous Atmosphere.

DTIC Science & Technology

1980-04-01

of Clouds and Precipitation (Reidel, Dordrecht, Holand , 1978), pp. 20-21. 5. T. Okita, J. Ileteorol. Soc. Japan, 40, 39 (1962). 6. R. T. Brown, Jr...Cnt %ftl 44b cA Ln. 0Co I (a 0 0 0 i rJnc RANlIe (PER !Ora) F1 "Sure 9 Znversiooms obased Oen Eqs. (14), (16), and (23), with and vithoutIteration, fo

The effect of oxygen fugacity on the rheological evolution of crystallizing basaltic melts

NASA Astrophysics Data System (ADS)

Kolzenburg, S.; Di Genova, D.; Giordano, D.; Hess, K. U.; Dingwell, D. B.

2018-04-01

Storage and transport of silicate melts in the Earth's crust and their emplacement on the planet's surface occur almost exclusively at sub-liquidus temperatures. At these conditions, the melts undergo crystallization under a wide range of cooling-rates, deformation-rates, and oxygen fugacities (fO2). Oxygen fugacity is known to influence the thermodynamics and kinetics of crystallization in magmas and lavas. Yet, its influence on sub-liquidus rheology remains largely uncharted. We present the first rheological characterization of crystallizing lavas along natural cooling paths and deformation-rates and at varying fO2. Specifically, we report on apparent viscosity measurements for two crystallizing magmatic suspensions 1) at log ⁡ fO2 of -9.15 (quartz-fayalite-magnetite buffer, QFM, -2.1) and 2) in air. These fugacities span a range of reduced to oxidized conditions pertinent to magma migration and lava emplacement. We find that: 1) crystallization at constant cooling-rates results in a quasi-exponential increase in the apparent viscosity of the magmatic suspensions until they achieve their rheological cut off temperature (Tcutoff), where the melt effectively solidifies 2) the rheological departure and Tcutoff increase with increasing fO2 and 3) increasing fO2 results in decreased crystallization-rates. Based on the experimental results and by comparison with previous rheological isothermal studies we propose a generalisation of the effect of fO2 on the dynamic rheological evolution of natural magmatic and volcanic suspensions. We further discuss the implications for magmatic transport in plumbing and storage systems (e.g. conduits, dikes and magma chambers) and during lava flow emplacement.

Dietary inclusion of fish oil changes the semen lipid composition but does not improve the post-thaw semen quality of ram spermatozoa.

PubMed

Díaz, Rommy; Torres, Mariana A; Paz, Erwin; Quiñones, John; Bravo, Silvana; Farías, Jorge G; Sepúlveda, Néstor

2017-08-01

The aim of this study was to investigate the effects of dietary fish oil (FO) time-response on the fatty acid profile, cholesterol levels and sperm cryosurvival in ram semen. Criollo Araucano rams were randomly assigned to two groups (n=4) according to the type of supplementation: a control group without FO and a supplemented group fed a diet with 3% FO for 8 weeks. The semen lipid profile and post-thaw sperm quality were analyzed at weeks 0 (pre-supplementation), 4, 8, 12 and 16 (post-supplementation) to evaluate the effects of FO supplementation by time interaction. Post-thaw sperm quality was determined by CASA and flow cytometry. In spermatozoa, the supplemented group increased the linoleic acid (C18:2n6c) and docosahexaenoic acid (DHA; C22:6n3) with levels higher at week 16 (P<0.05). The effect of FO on cholesterol concentration in sperm was significant at the end of the experiment (week 16). In seminal plasma, statistical differences of butyric acid (C4:0), palmitic acid (C16:0), stearic acid (C18:0), eicosatrienoic acid (C20:3n3) and DHA were observed at week 12. The cholesterol concentration was not affected by dietary treatments (P>0.05). However, the post-thaw sperm quality of the FO treatment group decreased. Motility percentage decreased 50% and spermatozoa with permeable plasma membrane and reacted acrosome were higher (63%) at week 16 than the control group. These results showed that DHA was effectively incorporated into semen through dietary supplementation with FO, but evaluations of post-thaw sperm quality confirm alteration specificity related to the structure of the lipid bilayer. Copyright © 2017 Elsevier B.V. All rights reserved.

Parenteral Fish Oil Lipid Emulsions in the Critically Ill: a Systematic Review and Meta-analysis

PubMed Central

Manzanares, William; Dhaliwal, Rupinder; Jurewitsch, Brian; Stapleton, Renee D.; Jeejeebhoy, Khursheed N.; Heyland, Daren K.

2015-01-01

Introduction Polyunsaturated series-3 fatty acids (PUFAs n-3) contained in fish oils (FO) posess major anti-inflammatory, anti-oxidant, and immunological properties which could be beneficial during critical illness. We hypothesized that parenteral FO containing emulsions may improve clinical outcomes in the critically ill. Methods We searched computerized databases from 1980 to 2012. We included randomized controlled trials (RCTs) conducted in critically ill adults patients that evaluated FO containing emulsions, either in the context of parenteral nutrition (PN) or enteral nutrition (EN) fed patients. Results A total of 6 RCTs (n=390 patients) were included; the mean methodological score of all trials was 10 (range: 6–13). When the results of these studies were aggregated, FO containing emulsions were associated with with a trend towards a reduction in mortality (risk ratio RR= 0.71, 95% confidence intervals CI 0.49, 1.04, P=0.08, heterogeneity I2=0%) and a tendency to reduce the duration of mechanical ventilation (weighted mean difference in days [WMD] −1.41, 95% CI −3.43, 0.61, P=0.17). However, this strategy had no effect on infections (RR= 0.76, 95% CI 0.42, 1.36, P= 0.35) and intensive care unit (ICU) length of stay (LOS) (WMD −0.46, 95% CI −4.87, 3.95, P=0.84, heterogeneity I2=75%). Conclusion FO containing lipid emulsions may be able to decrease mortality and ventilation days in the critically ill. However, because of the paucity of clinical data, there is inadequate evidence to recommend the routine use of parenteral FO. Large, rigorously designed, RCTs are required to elucidate the efficacy of parenteral FO in the critically ill. PMID:23609773

Fish oil supplementation suppresses resistance exercise and feeding-induced increases in anabolic signaling without affecting myofibrillar protein synthesis in young men.

PubMed

McGlory, Chris; Wardle, Sophie L; Macnaughton, Lindsay S; Witard, Oliver C; Scott, Fraser; Dick, James; Bell, J Gordon; Phillips, Stuart M; Galloway, Stuart D R; Hamilton, D Lee; Tipton, Kevin D

2016-03-01

Fish oil (FO) supplementation potentiates muscle protein synthesis (MPS) in response to a hyperaminoacidemic-hyperinsulinemic infusion. Whether FO supplementation potentiates MPS in response to protein ingestion or when protein ingestion is combined with resistance exercise (RE) remains unknown. In a randomized, parallel group design, 20 healthy males were randomized to receive 5 g/day of either FO or coconut oil control (CO) for 8 weeks. After supplementation, participants performed a bout of unilateral RE followed by ingestion of 30 g of whey protein. Skeletal muscle biopsies were obtained before and after supplementation for assessment of muscle lipid composition and relevant protein kinase activities. Infusion of L-[ring-(13)C6] phenylalanine was used to measure basal myofibrillar MP Sat rest (REST), in a nonexercised leg following protein ingestion (FED) and following RE and protein ingestion (FEDEX).MPS was significantly elevated above REST during FEDEX in both the FO and CO groups, but there was no effect of supplementation. There was a significant increase in MPS in both groups above REST during FED but no effect of supplementation. Supplementation significantly decreased pan PKB activity at RESTin the FO group but not the CO group. There was a significant increase from REST at post-RE for PKB and AMPKα2 activity in the CO group but not in the FO group. In FEDEX, there was a significant increase in p70S6K1 activity from REST at 3 h in the CO group only. These data highlight that 8 weeks of FO supplementation alters kinase signaling activity in response to RE plus protein ingestion without influencing MPS. © 2016 The Authors. Physiological Reports published by Wiley Periodicals, Inc. on behalf of the American Physiological Society and The Physiological Society.

Older Adults with Fear of Falling Show Deficits in Motor Imagery of Gait.

PubMed

Sakurai, R; Fujiwara, Y; Yasunaga, M; Suzuki, H; Sakuma, N; Imanaka, K; Montero-Odasso, M

2017-01-01

Understanding of the underlying mechanisms of Fear of Falling (FoF) could help to expand potential treatments. Given the nature of motor performance, the decline in the planning stage of motor execution may be associated with an expression of FoF. The aim of this study was to assess the planning/prediction accuracy in motor execution in people with FoF using gait-related motor imagery (MI). Cross-sectional case/control study. Three health centers in Japan. Two hundred and eighty-three community-dwelling older adults were recruited and stratified by presence of FoF as FoF group (n=178) or non-FoF group (n=107). Participants were tested for both imagery and execution tasks of a Timed Up and Go (TUG) test. The participants were first asked to imagine the trial (iTUG) and estimate the time it would take, and then perform the actual trial (aTUG). The difference between iTUG and aTUG (Δ TUG) was calculated. The FoF group was significantly slower in aTUG, but iTUG duration was almost identical between the two groups, resulting in significant overestimation in the FoF group. The adjusted logistic regression analysis showed that increased Δ TUG (i.e., tendency to overestimate) was significantly associated with FoF (OR = 1.05; 95% CI = 1.02-1.10). Low frequency of going outdoors was also associated with FoF (OR 2.95; 95% CI: 1.16-7.44). Older adults with FoF overestimate their TUG performance, reflecting impairment in motor planning. Overestimation of physical capabilities can be an additional explanation of the high risk of falls in this population.

Seawater-driven forward osmosis for enriching nitrogen and phosphorous in treated municipal wastewater: effect of membrane properties and feed solution chemistry.

PubMed

Xue, Wenchao; Tobino, Tomohiro; Nakajima, Fumiyuki; Yamamoto, Kazuo

2015-02-01

Seawater-driven forward osmosis (FO) is considered to be a novel strategy to concentrate nutrients in treated municipal wastewater for further recovery as well as simultaneous discharge of highly purified wastewater into the sea with low cost. As a preliminary test, the performance of FO membranes in concentrating nutrients was investigated by both batch experiments and model simulation approaches. With synthetic seawater as the draw solution, the dissolved organic carbon, phosphate, and ammonia in the effluent from a membrane bioreactor (MBR) treating municipal wastewater were 2.3-fold, 2.3-fold, and 2.1-fold, respectively, concentrated by the FO process with approximately 57% of water reduction. Most of the dissolved components, including trace metals in the MBR effluent, were highly retained (>80%) in the feed side, indicating high water quality of permeate to be discharged. The effect of membrane properties on the nutrient enrichment performance was investigated by comparing three types of FO membranes. Interestingly, a polyamide membrane possessing a high negative charge demonstrated a poor capability of retaining ammonia, which was hypothesized because of an ion exchange-like mechanism across the membrane prompted by the high ionic concentration of the draw solution. A feed solution pH of 7 was demonstrated to be an optimum condition for improving the overall retention of nutrients, especially for ammonia because of the pH-dependent speciation of ammonia/ammonium forms. The modeling results showed that higher than 10-fold concentrations of ammonia and phosphate are achievable by seawater-driven FO with a draw solution to feed solution volume ratio of 2:1. The enriched municipal wastewater contains nitrogen and phosphorous concentrations comparable with typical animal wastewater and anaerobic digestion effluent, which are used for direct nutrient recovery. Copyright © 2014 Elsevier Ltd. All rights reserved.

Home detection of freezing of gait using support vector machines through a single waist-worn triaxial accelerometer

PubMed Central

Pérez-López, Carlos; Català, Andreu; Moreno Arostegui, Joan M.; Cabestany, Joan; Bayés, Àngels; Alcaine, Sheila; Mestre, Berta; Prats, Anna; Crespo, M. Cruz; Counihan, Timothy J.; Browne, Patrick; Quinlan, Leo R.; ÓLaighin, Gearóid; Sweeney, Dean; Lewy, Hadas; Azuri, Joseph; Vainstein, Gabriel; Annicchiarico, Roberta; Costa, Alberto; Rodríguez-Molinero, Alejandro

2017-01-01

Among Parkinson’s disease (PD) symptoms, freezing of gait (FoG) is one of the most debilitating. To assess FoG, current clinical practice mostly employs repeated evaluations over weeks and months based on questionnaires, which may not accurately map the severity of this symptom. The use of a non-invasive system to monitor the activities of daily living (ADL) and the PD symptoms experienced by patients throughout the day could provide a more accurate and objective evaluation of FoG in order to better understand the evolution of the disease and allow for a more informed decision-making process in making adjustments to the patient’s treatment plan. This paper presents a new algorithm to detect FoG with a machine learning approach based on Support Vector Machines (SVM) and a single tri-axial accelerometer worn at the waist. The method is evaluated through the acceleration signals in an outpatient setting gathered from 21 PD patients at their home and evaluated under two different conditions: first, a generic model is tested by using a leave-one-out approach and, second, a personalised model that also uses part of the dataset from each patient. Results show a significant improvement in the accuracy of the personalised model compared to the generic model, showing enhancement in the specificity and sensitivity geometric mean (GM) of 7.2%. Furthermore, the SVM approach adopted has been compared to the most comprehensive FoG detection method currently in use (referred to as MBFA in this paper). Results of our novel generic method provide an enhancement of 11.2% in the GM compared to the MBFA generic model and, in the case of the personalised model, a 10% of improvement with respect to the MBFA personalised model. Thus, our results show that a machine learning approach can be used to monitor FoG during the daily life of PD patients and, furthermore, personalised models for FoG detection can be used to improve monitoring accuracy. PMID:28199357

Effect of intonation on cantonese lexical tones.

PubMed

Ma, Joan K-Y; Ciocca, Valter; Whitehill, Tara L

2006-12-01

In tonal languages, there are potential conflicts between the FO-based changes due to the coexistence of intonation and lexical tones. In the present study, the interaction of tone and intonation in Cantonese was examined using acoustic and perceptual analyses. The acoustic patterns of tones at the initial, medial, and final positions of questions and statements were measured. Results showed that intonation affects both the FO level and contour, while the duration of the six tones varied as a function of positions within intonation contexts. All six tones at the final position of questions showed rising FO contour, regardless of their canonical form. Listeners were overall more accurate in the identification of tones presented within the original carrier than of the same tones in isolation. However, a large proportion of tones 33, 21, 23, and 22 at the final position of questions were misperceived as tone 25 both within the original carrier and as isolated words. These results suggest that although the intonation context provided cues for correct tone identification, the intonation-induced changes in FO contour cannot always be perceptually compensated for, resulting in some erroneous perception of the identity of Cantonese tone.

Replacement of dietary fish oils by alpha-linolenic acid-rich oils lowers omega 3 content in tilapia flesh.

PubMed

Karapanagiotidis, Ioannis T; Bell, Michael V; Little, David C; Yakupitiyage, Amararatne

2007-06-01

A 20-week feeding trial was conducted to determine whether increasing linolenic acid (18:3n-3) in vegetable oil (VO) based diets would lead to increased tissue deposition of 22:6n-3 in Nile tilapia (Oreochromis niloticus). Five isonitrogenous and isoenergetic diets were supplemented with 3% of either linseed oil (LO), a mixture of linseed oil with refined palm olein oil (PO) (LO-PO 2:1) and a mixture of refined palm olein oil with linseed oil (PO-LO 3:2) or with fish oil (FO) or corn oil (CO) as controls. The PO-LO, LO-PO and LO diets supplied a similar amount of 18:2n-6 (0.5% of diet by dry weight) and 0.5, 0.7 and 1.1% of 18:3n-3, respectively. Increased dietary 18:3n-3 caused commensurate increases in longer-chain n-3 PUFA and decreases in longer-chain n-6 PUFA in the muscle lipids of tilapia. However, the biosynthetic activities of fish fed the LO-based diets were not sufficient to raise the tissue concentrations of 20:5n-3, 22:5n-3 and 22:6n-3 to those of fish fed FO. The study suggests that tilapia (O. niloticus) has a limited capacity to synthesise 20:5n-3 and 22:6n-3 from dietary 18:3n-3. The replacement of FO in the diet of farmed tilapia with vegetable oils could therefore lower tissue concentrations of 20:5n-3 and 22:6n-3, and consequently produce an aquaculture product of lower lipid nutritional value for the consumer.

Forward osmosis :a new approach to water purification and desalination.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Miller, James Edward; Evans, Lindsey R.

2006-07-01

Fresh, potable water is an essential human need and thus looming water shortages threaten the world's peace and prosperity. Waste water, brackish water, and seawater have great potential to fill the coming requirements. Unfortunately, the ability to exploit these resources is currently limited in many parts of the world by both the cost of the energy and the investment in equipment required for purification/desalination. Forward (or direct) osmosis is an emerging process for dewatering aqueous streams that might one day help resolve this problem. In FO, water from one solution selectively passes through a membrane to a second solution basedmore » solely on the difference in the chemical potential (concentration) of the two solutions. The process is spontaneous, and can be accomplished with very little energy expenditure. Thus, FO can be used, in effect, to exchange one solute for a different solute, specifically chosen for its chemical or physical properties. For desalination applications, the salts in the feed stream could be exchanged for an osmotic agent specifically chosen for its ease of removal, e.g. by precipitation. This report summarizes work performed at Sandia National Laboratories in the area of FO and reviews the status of the technology for desalination applications. At its current state of development, FO will not replace reverse osmosis (RO) as the most favored desalination technology, particularly for routine waters. However, a future role for FO is not out of the question. The ability to treat waters with high solids content or fouling potential is particularly attractive. Although our analysis indicates that FO is not cost effective as a pretreatment for conventional BWRO, water scarcity will likely drive societies to recover potable water from increasingly marginal resources, for example gray water and then sewage. In this context, FO may be an attractive pretreatment alternative. To move the technology forward, continued improvement and

Further applications of a Figure-of-Merit in space missions

NASA Technical Reports Server (NTRS)

Preiss, Bruce; Pan, Thomas; Ramohalli, Kumar

1991-01-01

A redesigned figure-of-merit (FoM) approach is described with respect to its applications in projects that employ in situ resource utilization (ISRU) and advanced modular engines. The FoM considers long-term effects, reliability of hardware, and risks inherent to new technologies, as well as significant design parameters. A spreadsheet is utilized to describe the FoM by means of key mission characteristics and combinations of the characteristic inputs in terms of precise governing equations. Results of the FoMs for historical and Mars Sample Return (MSR) missions are given for the conventional mission as well as an ISRU mission for the MSR. A detailed description of the most effective Mars mission is presented, showing how different factors affect the FoM. The results demonstrate that the FoM gives quantitative results based on overall mission design, allowing intercomparisons of similar missions. The FoM can be used as a screening parameter by modifying aspects of the mission by means of the R-factor.

A novel joint timing/frequency synchronization scheme based on Radon-Wigner transform of LFM signals in CO-OFDM systems

NASA Astrophysics Data System (ADS)

Liu, Jianfei; Wei, Ying; Zeng, Xiangye; Lu, Jia; Zhang, Shuangxi; Wang, Mengjun

2018-03-01

A joint timing and frequency synchronization method has been proposed for coherent optical orthogonal frequency-division multiplexing (CO-OFDM) system in this paper. The timing offset (TO), integer frequency offset (FO) and the fractional FO can be realized by only one training symbol, which consists of two linear frequency modulation (LFM) signals with opposite chirp rates. By detecting the peak of LFM signals after Radon-Wigner transform (RWT), the TO and the integer FO can be estimated at the same time, moreover, the fractional FO can be acquired correspondingly through the self-correlation characteristic of the same training symbol. Simulation results show that the proposed method can give a more accurate TO estimation than the existing methods, especially at poor OSNR conditions; for the FO estimation, both the fractional and the integer FO can be estimated through the proposed training symbol with no extra overhead, a more accurate estimation and a large FO estimation range of [ - 5 GHz, 5GHz] can be acquired.

Layer-by-Layer Assembly for Preparation of High-Performance Forward Osmosis Membrane

NASA Astrophysics Data System (ADS)

Yang, Libin; Zhang, Jinglong; Song, Peng; Wang, Zhan

2018-01-01

Forward osmosis (FO) membrane with high separation performance is needed to promote its practical applications. Herein, layer-by-layer (LbL) approach was used to prepare a thin and highly cross-linked polyamide layer on a polyacrylonitrile substrate surface to prepare a thin-film composite forward osmosis (TFC-FO) membrane with enhanced FO performance. The effects of monomer concentrations and assembly cycles on the performance of the TFC-FO membranes were systematically investigated. Under the optimal preparation condition, TFC-FO membrane achieved the best performance, exhibiting the water flux of 14.4/6.9 LMH and reverse salt flux of 7.7/3.8 gMH under the pressure retarded osmosis/forward osmosis (PRO/FO) mode using 1M NaCl as the draw against a DI-water feed, and a rejection of 96.1% for 2000 mg/L NaCl aqueous solution. The result indicated that layer-by-layer method was a potential method to regulate the structure and performance of the TFC-FO membrane.

Forward osmosis for application in wastewater treatment: a review.

PubMed

Lutchmiah, Kerusha; Verliefde, A R D; Roest, K; Rietveld, L C; Cornelissen, E R

2014-07-01

Research in the field of Forward Osmosis (FO) membrane technology has grown significantly over the last 10 years, but its application in the scope of wastewater treatment has been slower. Drinking water is becoming an increasingly marginal resource. Substituting drinking water for alternate water sources, specifically for use in industrial processes, may alleviate the global water stress. FO has the potential to sustainably treat wastewater sources and produce high quality water. FO relies on the osmotic pressure difference across the membrane to extract clean water from the feed, however the FO step is still mostly perceived as a "pre-treatment" process. To prompt FO-wastewater feasibility, the focus lies with new membrane developments, draw solutions to enhance wastewater treatment and energy recovery, and operating conditions. Optimisation of these parameters are essential to mitigate fouling, decrease concentration polarisation and increase FO performance; issues all closely related to one another. This review attempts to define the steps still required for FO to reach full-scale potential in wastewater treatment and water reclamation by discussing current novelties, bottlenecks and future perspectives of FO technology in the wastewater sector. Copyright © 2014 Elsevier Ltd. All rights reserved.

A comparative study of ultrasonication, Fenton's oxidation and ferro-sonication treatment for degradation of carbamazepine from wastewater and toxicity test by Yeast Estrogen Screen (YES) assay.

PubMed

Mohapatra, D P; Brar, S K; Tyagi, R D; Picard, P; Surampalli, R Y

2013-03-01

A comparative study of ultrasonication (US), Fenton's oxidation (FO) and ferro-sonication (FS) (combination of ultrasonication and Fenton's oxidation) advanced oxidation processes (AOPs) for degradation of carbamazepine (CBZ) from wastewater (WW) is reported for the first time. CBZ is a worldwide used antiepileptic drug, found as a persistent emerging contaminant in many wastewater treatment plants (WWTPs) effluents and other aquatic environments. The oxidation treatments of WW caused an effective removal of the drug. Among the various US, FO and FS pre-treatments carried out, higher soluble chemical oxygen demand (SCOD) and soluble organic carbon (SOC) increment (63 to 86% and 21 to 34%, respectively) was observed during FO pre-treatment process, resulting in higher removal of CBZ (84 to 100%) from WW. Furthermore, analysis of by-products formed during US, FO and FS pre-treatment in WW was carried out by using laser diode thermal desorption-atmospheric pressure chemical ionization (LDTD-APCI) coupled to tandem mass spectrometry (MS/MS). LDTD-APCI-MS/MS analysis indicated formation of two by-products, such as epoxycarbamazepine and hydroxycarbamazepine due to the reaction of hydroxyl radicals (OH) with CBZ during the three types of pre-treatment processes. In addition, the estrogenic activity of US, FO and FS pre-treated sample with CBZ and its by-products was carried out by Yeast Estrogen Screen (YES) assay method. Based upon the YES test results, none of the pre-treated samples showed estrogenic activity. Copyright © 2012 Elsevier B.V. All rights reserved.

A vegetable oil feeding history affects digestibility and intestinal fatty acid uptake in juvenile rainbow trout Oncorhynchus mykiss.

PubMed

Geurden, Inge; Jutfelt, Fredrik; Olsen, Rolf-Erik; Sundell, Kristina S

2009-04-01

Future expansion of aquaculture relies on the use of alternatives to fish oil in fish feed. This study examined to what extent the nature of the feed oil affects intestinal lipid uptake properties in rainbow trout. The fish were fed a diet containing fish (FO), rapeseed (RO) or linseed (LO) oil for 8 weeks after which absorptive properties were assessed. Differences in digestibility due to feed oil history were measured using diet FO with an indigestible marker. Intestinal integrity, paracellular permeability, in vitro transepithelial fatty acid transport (3H-18:3n-3 and 14C-16:0) and their incorporation into intestinal epithelia were compared using Ussing chambers. Feed oil history did not affect the triacylglycerol/phosphatidylcholine ratio (TAG/PC) of the newly synthesized lipids in the segments. The lower TAG/PC ratio with 16:0 (2:1) than with 18:3 (10:1) showed the preferential incorporation of 16:0 into polar lipids. The FO-feeding history decreased permeability and increased transepithelial resistance of the intestinal segments. Transepithelial passage rates of 18:3n-3 were higher when pre-fed LO compared to RO or FO. Similarly, pre-feeding LO increased apparent lipid and fatty acid digestibilities compared to RO or FO. These results demonstrate that the absorptive intestinal functions in fish can be altered by the feed oil history and that the effect remains after a return to a standard fish oil diet.

Qualitative Investigation of the Earthquake Precuesors Prior to the March 14,2012 Earthquake in Japan

NASA Astrophysics Data System (ADS)

Raghuwanshi, Shailesh Kumar; Gwal, Ashok Kumar

Abstract: In this study we have used the Empirical Mode Decomposition (EMD) method in conjunction with the Cross Correlation analysis to analyze ionospheric foF2 parameter Japan earthquake with magnitude M = 6.9. The data are collected from Kokubunji (35.70N, 139.50E) and Yamakawa (31.20N, 130.60E) ionospheric stations. The EMD method was used for removing the geophysical noise from the foF2 data and then to calculate the correlation coefficient between them. It was found that the ionospheric foF2 parameter shows anomalous change few days before the earthquake. The results are in agreement with the theoretical model evidencing ionospheric modification prior to Japan earthquake in a certain area around the epicenter.

Inhibition, Executive Function, and Freezing of Gait

PubMed Central

Cohen, Rajal G.; Klein, Krystal A.; Nomura, Mariko; Fleming, Michael; Mancini, Martina; Giladi, Nir; Nutt, John G.; Horak, Fay B.

2014-01-01

Background Studies suggest that freezing of gait (FoG) in people with Parkinson’s disease (PD) is associated with declines in executive function (EF). However, EF is multi-faceted, including three dissociable components: inhibiting prepotent responses, switching between task sets, and updating working memory. Objective This study investigated which aspect of EF is most strongly associated with FoG in PD. Method Three groups were studied: adults with PD (with and without FoG) and age-matched, healthy adults. All participants completed a battery of cognitive tasks previously shown to discriminate among the three EF components. Participants also completed a turning-in-place task that was scored for FoG by neurologists blind to subjects’ self-reported FoG. Results Compared to both other groups, participants with FoG showed significant performance deficits in tasks associated with inhibitory control, even after accounting for differences in disease severity, but no significant deficits in task-switching or updating working memory. Surprisingly, the strongest effect was an intermittent tendency of participants with FoG to hesitate, and thus miss the response window, on go trials in the Go-Nogo task. The FoG group also made slower responses in the conflict condition of the Stroop task. Physician-rated FoG scores were correlated both with failures to respond on go trials and with failures to inhibit responses on nogo trials in the Go-Nogo task. Conclusion These results suggest that FoG is associated with a specific inability to appropriately engage and release inhibition, rather than with a general executive deficit. PMID:24496099

Forward osmosis for oily wastewater reclamation: Multi-charged oxalic acid complexes as draw solutes.

PubMed

Ge, Qingchun; Amy, Gary Lee; Chung, Tai-Shung

2017-10-01

Forward osmosis (FO) has demonstrated its merits in hybrid FO seawater desalination. However, FO may have a potential for other applications if suitable draw solutes are available. In this study, a series of novel draw solutes based on oxalic acid (OA)-transitional metal complexes are presented. Influential factors of FO performance have been systematically investigated by varying the transitional metals, cations of the complex draw solutes as well as the experimental conditions. Compared to NaCl and other recently synthesized draw solutes, the OA complexes show superior FO performance in terms of high water fluxes up to 27.5 and 89.1 LMH under the respective FO and PRO (pressure retarded osmosis) modes, both with negligible reverse solute fluxes. The features of octahedral geometry, abundant hydrophilic groups and ionic species are crucial for the OA complexes as appropriate draw solutes with satisfactory FO performance. Among the synthesized OA complexes, the ammonium salt of chromic complex (NH 4 -Cr-OA) outperforms others due to the presence of more ionic species in its complex system. NH 4 -Cr-OA also performs better than the typical NaCl draw solute in FO oily wastewater treatment with higher water recovery and negligible reverse fluxes. Dilute solutions of OA complexes have been reconcentrated through membrane distillation (MD) and reused to new round of FO processes. The OA complexes have demonstrated their suitability and superiority as a novel class of draw solutes for the FO process in this study. Copyright © 2017 Elsevier Ltd. All rights reserved.

Influence of fish oil supplementation and strength training on some functional aspects of immune cells in healthy elderly women.

PubMed

de Lourdes Nahhas Rodacki, Cintia; Rodacki, André Luiz Felix; Coelho, Isabela; Pequito, Daniele; Krause, Maressa; Bonatto, Sandro; Naliwaiko, Katya; Fernandes, Luiz Cláudio

2015-07-14

Immune function changes with ageing and is influenced by physical activity (strength training, ST) and diet (fish oil, FO). The present study investigated the effect of FO and ST on the immune system of elderly women. Forty-five women (64 (sd 1.4) years) were assigned to ST for 90 d (ST; n 15), ST plus 2 g/d FO for 90 d (ST90; n 15) or 2 g/d FO for 60 d followed by ST plus FO for 90 d (ST150; n 15). Training was performed three times per week, for 12 weeks. A number of innate (zymosan phagocytosis, lysosomal volume, superoxide anion, peroxide of hydrogen) and adaptive (cluster of differentiation 4 (CD4), CD8, TNF-α, interferon-γ (IFN-γ), IL-2, IL-6 and IL-10 produced by lymphocytes) immune parameters were assessed before supplementation (base), before (pre-) and after (post-) training. ST induced no immune changes. FO supplementation caused increased phagocytosis (48 %), lysosomal volume (100 %) and the production of superoxide anion (32 %) and H₂O₂(70 %) in the ST90. Additional FO supplementation (ST150) caused no additive influence on the immune system, as ST150 and ST90 did not differ, but caused greater changes when compared to the ST (P< 0·05). FO increased CD4+ and CD8+ lymphocytes in the ST150, which remained unchanged when training was introduced. The combination of ST and FO reduced TNF-α in the ST150 from base to post-test. FO supplementation (ST150, base-pre) when combined with exercise (ST150, pre-post) increased IFN-γ, IL-2, IL-6 and IL-10 production. The immune parameters improved in response to FO supplementation; however, ST alone did not enhance the immune system.

Forward osmosis membrane modular configurations for osmotic dilution of seawater by forward osmosis and reverse osmosis hybrid system.

PubMed

Kim, Jung Eun; Phuntsho, Sherub; Ali, Syed Muztuza; Choi, Joon Young; Shon, Ho Kyong

2018-01-01

This study evaluates various options for full-scale modular configuration of forward osmosis (FO) process for osmotic dilution of seawater using wastewater for simultaneous desalination and water reuse through FO-reverse osmosis (RO) hybrid system. Empirical relationship obtained from one FO membrane element operation was used to simulate the operational performances of different FO module configurations. The main limiting criteria for module operation is to always maintain the feed pressure higher than the draw pressure throughout the housing module for safe operation without affecting membrane integrity. Experimental studies under the conditions tested in this study show that a single membrane housing cannot accommodate more than four elements as the draw pressure exceeds the feed pressure. This then indicates that a single stage housing with eight elements is not likely to be practical for safe FO operation. Hence, six different FO modular configurations were proposed and simulated. A two-stage FO configuration with multiple housings (in parallel) in the second stage using same or larger spacer thickness reduces draw pressure build-up as the draw flow rates are reduced to half in the second stage thereby allowing more than four elements in the second stage housing. The loss of feed pressure (pressure drop) and osmotic driving force in the second stage are compensated by operating under the pressure assisted osmosis (PAO) mode, which helps enhance permeate flux and maintains positive pressure differences between the feed and draw chamber. The PAO energy penalty is compensated by enhanced permeate throughput, reduced membrane area, and plant footprint. The contribution of FO/PAO to total energy consumption was not significant compared to post RO desalination (90%) indicating that the proposed two-stage FO modular configuration is one way of making the FO full-scale operation practical for FO-RO hybrid system. Copyright © 2017 Elsevier Ltd. All rights reserved.

Fatty acid metabolism (desaturation, elongation and beta-oxidation) in rainbow trout fed fish oil- or linseed oil-based diets.

PubMed

Turchini, Giovanni M; Francis, David S

2009-07-01

In consideration of economical and environmental concerns, fish oil (FO) substitution in aquaculture is the focus of many fish nutritionists. The most stringent drawback of FO replacement in aquafeeds is the consequential modification to the final fatty acid (FA) make-up of the fish fillet. However, it is envisaged that a solution may be achieved through a better understanding of fish FA metabolism. Therefore, the present study investigated the fate of individual dietary FA in rainbow trout (Oncorhynchus mykiss) fed a FO-based diet (rich in 20 : 5n-3) or a linseed oil-based diet (LO; rich in 18 : 3n-3). The study demonstrated that much of the 18 : 3n-3 content from the LO diet was oxidised and, despite the significantly increased accretion of Delta-6 and Delta-5 desaturated FA, a 2- and 3-fold reduction in the fish body content of 20 : 5n-3 and 22 : 6n-3, respectively, compared with the FO-fed fish, was recorded. The accretion of longer-chain FA was unaffected by the dietary treatments, while there was a greater net disappearance of FA provided in dietary surplus. SFA and MUFA recorded a net accretion of FA produced ex novo. In the fish fed the FO diet, the majority of dietary 20 : 5n-3 was accumulated (53.8 %), some was oxidised (14.7 %) and a large proportion (31.6 %) was elongated and desaturated up to 22 : 6n-3. In the fish fed the LO diet, the majority of dietary 18 : 3n-3 was accumulated (58.1 %), a large proportion was oxidised (29.5 %) and a limited amount (12.4 %) was bio-converted to longer and more unsaturated homologues.

Chromium valences in ureilite olivine and implications for ureilite petrogenesis

NASA Astrophysics Data System (ADS)

Goodrich, C. A.; Sutton, S. R.; Wirick, S.; Jercinovic, M. J.

2013-12-01

Ureilites are a group of ultramafic achondrites commonly thought to be residues of partial melting on a carbon-rich asteroid. They show a large variation in FeO content (olivine Fo values ranging from ∼74 to 95) that cannot be due to igneous fractionation and suggests instead variation in oxidation state. The presence of chromite in only a few of the most ferroan (Fo 75-76) samples appears to support such a model. MicroXANES analyses were used in this study to determine the valence states of Cr (previously unknown) in olivine cores of 11 main group ureilites. The goal of this work was to use a method that is independent of Fo to determine the oxidation conditions under which ureilites formed, in order to evaluate whether the ureilite FeO-variation is correlated with oxidation state, and whether it is nebular or planetary in origin. Two of the analyzed samples, LEW 88774 (Fo 74.2) and NWA 766 (Fo 76.7) contain primary chromite; two others, LAP 03587 (Fo 74.4) and CMS 04048 (Fo 76.2) contain sub-micrometer-sized exsolutions of chromite + Ca-rich pyroxene in olivine; and one, EET 96328 (Fo 85.2) contains an unusual chromite grain of uncertain origin. No chromite has been observed in the remaining six samples (Fo 77.4-92.3). Chromium in olivine in all eleven samples was found to be dominated by the divalent species, with valences ranging from 2.10 ± 0.02 (1σ) to 2.46 ± 0.04. The non-chromite-bearing ureilites have the most reduced Cr, with a weighted mean valence of 2.12 ± 0.01, i.e., Cr2+/Cr3+ = 7.33. All low-Fo chromite-bearing ureilites have more oxidized Cr, with valences ranging from 2.22 ± 0.03 to 2.46 ± 0.04. EET 96328, whose chromite grain we interpret as a late-crystallizing phase, yielded a reduced Cr valence of 2.15 ± 0.07, similar to the non-chromite-bearing samples. Based on the measured Cr valences, magmatic (1200-1300 °C) oxygen fugacities (fO2) of the non-chromite-bearing samples were estimated to be in the range IW-1.9 to IW-2.8 (assuming

Proposed Revisions to MIL-F-8785C Related to Flight Safety of Augmented Aircraft. Volume 2. Appendices A through F, References

DTIC Science & Technology

1982-04-01

for Step 6h Command - Configuration FO, Fl, F6 , F4, F2 .................................................. ....... 309 C-15 Frequency Response of e/Fs...Configuration FO, Fl, F6 , F4, F2.. 312 C-16 Time History for Step Sh Command - Configuration L21, L71, L72, L73...505 T= 2 sec 2 F4 .465 4 sec F6 .453 6 sEc where F indicates unaugmented F-1l1A and the number following F indicates T2 in sec, except 0 : stable, 1

Occupational Radiation Exposure During Endovascular Aortic Repair

DOE Office of Scientific and Technical Information (OSTI.GOV)

Sailer, Anna M., E-mail: anni.sailer@mumc.nl; Schurink, Geert Willem H., E-mail: gwh.schurink@mumc.nl; Bol, Martine E., E-mail: m.bol@maastrichtuniversity.nl

PurposeThe aim of the study was to evaluate the radiation exposure to operating room personnel and to assess determinants for high personal doses during endovascular aortic repair.Materials and MethodsOccupational radiation exposure was prospectively evaluated during 22 infra-renal aortic repair procedures (EVAR), 11 thoracic aortic repair procedures (TEVAR), and 11 fenestrated or branched aortic repair procedures (FEVAR). Real-time over-lead dosimeters attached to the left breast pocket measured personal doses for the first operators (FO) and second operators (SO), radiology technicians (RT), scrub nurses (SN), anesthesiologists (AN), and non-sterile nurses (NSN). Besides protective apron and thyroid collar, no additional radiation shielding wasmore » used. Procedural dose area product (DAP), iodinated contrast volume, fluoroscopy time, patient’s body weight, and C-arm angulation were documented.ResultsAverage procedural FO dose was significantly higher during FEVAR (0.34 ± 0.28 mSv) compared to EVAR (0.11 ± 0.21 mSv) and TEVAR (0.06 ± 0.05 mSv; p = 0.003). Average personnel doses were 0.17 ± 0.21 mSv (FO), 0.042 ± 0.045 mSv (SO), 0.019 ± 0.042 mSv (RT), 0.017 ± 0.031 mSv (SN), 0.006 ± 0.007 mSv (AN), and 0.004 ± 0.009 mSv (NSN). SO and AN doses were strongly correlated with FO dose (p = 0.003 and p < 0.001). There was a significant correlation between FO dose and procedural DAP (R = 0.69, p < 0.001), iodinated contrast volume (R = 0.67, p < 0.001) and left-anterior C-arm projections >60° (p = 0.02), and a weak correlation with fluoroscopy time (R = 0.40, p = 0.049).ConclusionAverage FO dose was a factor four higher than SO dose. Predictors for high personal doses are procedural DAP, iodinated contrast volume, and left-anterior C-arm projections greater than 60°.« less

Postural control deficit during sit-to-walk in patients with Parkinson's disease and freezing of gait.

PubMed

Mezzarobba, Susanna; Grassi, Michele; Valentini, Roberto; Bernardis, Paolo

2018-03-01

The intricate linkage between Freezing of Gait (FoG) and postural control in Parkinson's disease (PD) is unclear. We analyzed the impact of FoG on dynamic postural control. 24 PD patients, 12 with (PD + FoG), 12 without FoG (PD-FoG), and 12 healthy controls, were assessed in ON state. Mobility and postural control were measured with clinical scales (UPDRS III, BBS, MPAS) and with kinematic and kinetic analysis during three tasks, characterized by levels of increasing difficulty to plan sequential movement of postural control: walk (W), gait initiation (GI) and sit-to-walk (STW). The groups were balanced by age, disease duration, disease severity, mobility and balance. During STW, the spatial distribution of COP trajectories in PD + FoG patients are spread over medial-lateral space more than in the PD-FoG (p < .001). Moreover, the distribution of COP positions. in the transition between sit-to-stand and gait initiation, is not properly shifted toward the leading leg, as in PD-FoG and healthy controls, but it is more centrally dispersed (p < .01) with a delayed weight forward progression (p < .05). In GI task and walk task, COM and COP differences are less evident and even absent between PD patients. PD + FoG show postural control differences in STW, compared with PD-FoG and healthy. Different spatial distribution of COP trajectories, between two PD groups are probably due to a deficit to plan postural control during a more demanding motor pattern, such as STW. Copyright © 2018 Elsevier B.V. All rights reserved.

Redox variations in Mauna Kea lavas, the oxygen fugacity of the Hawaiian plume, and the role of volcanic gases in Earth’s oxygenation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Brounce, Maryjo; Stolper, Edward; Eiler, John

The behavior of C, H, and S in the solid Earth depends on their oxidation states, which are related to oxygen fugacity (fO2). Volcanic degassing is a source of these elements to Earth’s surface; therefore, variations in mantle fO2 may influence the fO2 at Earth’s surface. However, degassing can impact magmatic fO2 before or during eruption, potentially obscuring relationships between the fO2 of the solid Earth and of emitted gases and their impact on surface fO2. We show that low-pressure degassing resulted in reduction of the fO2 of Mauna Kea magmas by more than an order of magnitude. The leastmore » degassed magmas from Mauna Kea are more oxidized than midocean ridge basalt (MORB) magmas, suggesting that the upper mantle sources of Hawaiian magmas have higher fO2 than MORB sources. One explanation for this difference is recycling of material from the oxidized surface to the deep mantle, which is then returned to the surface as a component of buoyant plumes. It has been proposed that a decreasing pressure of volcanic eruptions led to the oxygenation of the atmosphere. Extension of our findings via modeling of degassing trends suggests that a decrease in eruption pressure would not produce this effect. If degassing of basalts were responsible for the rise in oxygen, it requires that Archean magmas had at least two orders of magnitude lower fO2 than modern magmas. Estimates of fO2 of Archean magmas are not this low, arguing for alternative explanations for the oxygenation of the atmosphere.« less

Redox variations in Mauna Kea lavas, the oxygen fugacity of the Hawaiian plume, and the role of volcanic gases in Earth's oxygenation

NASA Astrophysics Data System (ADS)

Brounce, Maryjo; Stolper, Edward; Eiler, John

2017-08-01

The behavior of C, H, and S in the solid Earth depends on their oxidation states, which are related to oxygen fugacity (fO2). Volcanic degassing is a source of these elements to Earth’s surface; therefore, variations in mantle fO2 may influence the fO2 at Earth’s surface. However, degassing can impact magmatic fO2 before or during eruption, potentially obscuring relationships between the fO2 of the solid Earth and of emitted gases and their impact on surface fO2. We show that low-pressure degassing resulted in reduction of the fO2 of Mauna Kea magmas by more than an order of magnitude. The least degassed magmas from Mauna Kea are more oxidized than midocean ridge basalt (MORB) magmas, suggesting that the upper mantle sources of Hawaiian magmas have higher fO2 than MORB sources. One explanation for this difference is recycling of material from the oxidized surface to the deep mantle, which is then returned to the surface as a component of buoyant plumes. It has been proposed that a decreasing pressure of volcanic eruptions led to the oxygenation of the atmosphere. Extension of our findings via modeling of degassing trends suggests that a decrease in eruption pressure would not produce this effect. If degassing of basalts were responsible for the rise in oxygen, it requires that Archean magmas had at least two orders of magnitude lower fO2 than modern magmas. Estimates of fO2 of Archean magmas are not this low, arguing for alternative explanations for the oxygenation of the atmosphere.

Redox variations in Mauna Kea lavas, the oxygen fugacity of the Hawaiian plume, and the role of volcanic gases in Earth’s oxygenation

PubMed Central

Stolper, Edward; Eiler, John

2017-01-01

The behavior of C, H, and S in the solid Earth depends on their oxidation states, which are related to oxygen fugacity (fO2). Volcanic degassing is a source of these elements to Earth’s surface; therefore, variations in mantle fO2 may influence the fO2 at Earth’s surface. However, degassing can impact magmatic fO2 before or during eruption, potentially obscuring relationships between the fO2 of the solid Earth and of emitted gases and their impact on surface fO2. We show that low-pressure degassing resulted in reduction of the fO2 of Mauna Kea magmas by more than an order of magnitude. The least degassed magmas from Mauna Kea are more oxidized than midocean ridge basalt (MORB) magmas, suggesting that the upper mantle sources of Hawaiian magmas have higher fO2 than MORB sources. One explanation for this difference is recycling of material from the oxidized surface to the deep mantle, which is then returned to the surface as a component of buoyant plumes. It has been proposed that a decreasing pressure of volcanic eruptions led to the oxygenation of the atmosphere. Extension of our findings via modeling of degassing trends suggests that a decrease in eruption pressure would not produce this effect. If degassing of basalts were responsible for the rise in oxygen, it requires that Archean magmas had at least two orders of magnitude lower fO2 than modern magmas. Estimates of fO2 of Archean magmas are not this low, arguing for alternative explanations for the oxygenation of the atmosphere. PMID:28784788

Rapid effects of essential fatty acid deficiency on growth and development parameters and transcription of key fatty acid metabolism genes in juvenile barramundi (Lates calcarifer).

PubMed

Salini, Michael J; Turchini, Giovanni M; Wade, Nicholas M; Glencross, Brett D

2015-12-14

Barramundi (Lates calcarifer), a catadromous teleost of significant and growing commercial importance, are reported to have limited fatty acid bioconversion capability and therefore require preformed long-chain PUFA (LC-PUFA) as dietary essential fatty acid (EFA). In this study, the response of juvenile barramundi (47·0 g/fish initial weight) fed isolipidic and isoenergetic diets with 8·2% added oil was tested. The experimental test diets were either devoid of fish oil (FO), and thus with no n-3 LC-PUFA (FO FREE diet), or with a low inclusion of FO (FO LOW diet). These were compared against a control diet containing only FO (FO CTRL diet) as the added lipid source, over an 8-week period. Interim samples and measurements were taken fortnightly during the trial in order to define the aetiology of the onset and progression of EFA deficiency. After 2 weeks, the fish fed the FO FREE and FO LOW diets had significantly lower live-weights, and after 8 weeks significant differences were detected for all performance parameters. The fish fed the FO FREE diet also had a significantly higher incidence of external abnormalities. The transcription of several genes involved in fatty acid metabolism was affected after 2 weeks of feeding, showing a rapid nutritional regulation. This experiment documents the aetiology of the onset and the progression of EFA deficiency in juvenile barramundi and demonstrates that such deficiencies can be detected within 2 weeks in juvenile fish.

Fish oil protects the peripheral and central nervous systems against cisplatin-induced neurotoxicity.

PubMed

Kamisli, Suat; Ciftci, Osman; Cetin, Asli; Kaya, Kursat; Kamisli, Ozden; Celik, Hamit

2014-04-01

The protective effects of fish oil (FO) on cisplatin (CP)-induced central and peripheral neurotoxicity were investigated in rats. Rats (n = 28) were divided equally into four groups, the first group was kept as a control. In the second and third groups, CP and FO were given at doses of 7 mg/kg and 1 softgel/rat/day, respectively. In the fourth group, CP and FO were given together at the same doses. Although CP caused significant oxidative damage, via induction of lipid peroxidation and reduction in the antioxidant defense system potency, FO treatment largely reversed these effects. CP also resulted in histopathological damage, such as apoptosis, and electromyographical changes in the sciatic nerve. FO treatment partially prevented the histopathological and electromyographical effects of CP. CP has severe central and peripheral neurotoxic effects in rats and these effects were largely prevented by FO treatment. Thus, it appears that co-administration of FO with CP may be a useful approach to attenuate the negative effects of CP on the nervous system.

The Relationship between Feelings-of-Knowing and Partial Knowledge for General Knowledge Questions

PubMed Central

Norman, Elisabeth; Blakstad, Oskar; Johnsen, Øivind; Martinsen, Stig K.; Price, Mark C.

2016-01-01

Feelings of knowing (FoK) are introspective self-report ratings of the felt likelihood that one will be able to recognize a currently unrecallable memory target. Previous studies have shown that FoKs are influenced by retrieved fragment knowledge related to the target, which is compatible with the accessibility hypothesis that FoK is partly based on currently activated partial knowledge about the memory target. However, previous results have been inconsistent as to whether or not FoKs are influenced by the accuracy of such information. In our study (N = 26), we used a recall-judge-recognize procedure where stimuli were general knowledge questions. The measure of partial knowledge was wider than those applied previously, and FoK was measured before rather than after partial knowledge. The accuracy of reported partial knowledge was positively related to subsequent recognition accuracy, and FoK only predicted recognition on trials where there was correct partial knowledge. Importantly, FoK was positively related to the amount of correct partial knowledge, but did not show a similar incremental relation with incorrect knowledge. PMID:27445950

Development of combined nanofiltration and forward osmosis process for production of ethanol from pretreated rice straw.

PubMed

Shibuya, Masafumi; Sasaki, Kengo; Tanaka, Yasuhiro; Yasukawa, Masahiro; Takahashi, Tomoki; Kondo, Akihiko; Matsuyama, Hideto

2017-07-01

A membrane process combining nanofiltraion (NF) and forward osmosis (FO) was developed for the sugar concentration with the aim of high bio-ethanol production from the liquid fraction of rice straw. The commercial NF membrane, ESNA3, was more adequate for removal of fermentation inhibitors (such as acetic acid) than the FO membrane, whereas the commercial FO membrane, TFC-ES, was more adequate for concentration of the sugars than the NF membrane. The liquid fraction was subjected to the following process: NF concentration with water addition (NF (+H2O) )→enzymatic hydrolysis→FO concentration. This NF (+H2O) -FO hybrid process generated a total sugar content of 107g·L -1 . Xylose-assimilating S. cerevisiae produced 24g·L -1 ethanol from the liquid fraction that was diluted 1.5-fold and then concentrated by the NF (+H2O) -FO hybrid process. The NF (+H2O) -FO hybrid process has the potential for optimized ethanol production from pretreated lignocellulosic biomass. Copyright © 2017 Elsevier Ltd. All rights reserved.

Application of forward osmosis membrane technology for oil sands process-affected water desalination.

PubMed

Jiang, Yaxin; Liang, Jiaming; Liu, Yang

2016-01-01

The extraction process used to obtain bitumen from the oil sands produces large volumes of oil sands process-affected water (OSPW). As a newly emerging desalination technology, forward osmosis (FO) has shown great promise in saving electrical power requirements, increasing water recovery, and minimizing brine discharge. With the support of this funding, a FO system was constructed using a cellulose triacetate FO membrane to test the feasibility of OSPW desalination and contaminant removal. The FO systems were optimized using different types and concentrations of draw solution. The FO system using 4 M NH4HCO3 as a draw solution achieved 85% water recovery from OSPW, and 80 to 100% contaminant rejection for most metals and ions. A water backwash cleaning method was applied to clean the fouled membrane, and the cleaned membrane achieved 77% water recovery, a performance comparable to that of new FO membranes. This suggests that the membrane fouling was reversible. The FO system developed in this project provides a novel and energy efficient strategy to remediate the tailings waters generated by oil sands bitumen extraction and processing.

Advanced, Energy-Efficient Hybrid Membrane System for Industrial Water Reuse

DOE Office of Scientific and Technical Information (OSTI.GOV)

Toy, Lora; Choi, Young Chul; Hendren, Zachary

In the U.S. manufacturing sector, current industrial water use practices are energy-intensive and utilize and discharge high volumes of waters, rendering them not sustainable especially in light of the growing scarcity of suitable water supplies. To help address this problem, the goal of this project was to develop an advanced, cost-effective, hybrid membrane-based water treatment system that can improve the energy efficiency of industrial wastewater treatment while allowing at least 50% water reuse efficiency. This hybrid process would combine emerging Forward Osmosis (FO) and Membrane Distillation (MD) technology components into an integrated FO-MD system that can beneficially utilize low-grade wastemore » heat (i.e., T < 450 °F) in industrial facilities to produce distilled-quality product water for reuse. In this project, laboratory-, bench-, and pilot-scale experiments on the hybrid FO-MD system were conducted for industrial wastewater treatment. It was demonstrated at laboratory, bench, and pilot scales that FO-MD membrane technology can concentrate brine to very high total dissolved solids (TDS) levels (>200,000 ppm) that are at least 2.5 times higher than the TDS level to which RO can achieve. In laboratory testing, currently available FO and MD membranes were tested to select for high-performing membranes with high salt rejection and high water flux. Multiple FO membrane/draw-salt solution combinations that gave high water flux with higher than 98% salt rejection were also identified. Reverse draw-salt fluxes were observed to be much lower for divalent salts than for monovalent salts. MD membranes were identified that had 99.9+% salt rejection and water flux as high as 50-90 L/(m 2·h) for flat-sheet membranes and >20 L/(m 2·h) for hollow fibers. In bench-scale testing, a single unit of commercially available FO and MD membrane modules were evaluated for continuous, integrated operation. Using the laboratory- and bench-scale test data, numerical

PRELIMINARY COST ESTIMATES OF POLLUTION CONTROL TECHNOLOGIES FOR GEOTHERMAL DEVELOPMENTS

EPA Science Inventory

This report provides preliminary cost estimates of air and water pollution control technologies for geothermal energy conversion facilities. Costs for solid waste disposal are also estimated. The technologies examined include those for control of hydrogen sulfide emissions and fo...

Blood and tissue fatty acid compositions, lipoprotein levels, performance and meat flavor of broilers fed fish oil: changes in the pre- and post-withdrawal design.

PubMed

Aghaei, N; Safamehr, A; Mehmannavaz, Y; Chekaniazar, S

2012-12-01

Administration of fish oil (FO) in broiler diets can elevate α-linolenic acid (ALA), eicosapentanoic acid (EPA) and docosahexanoic acid (DHA) levels, which are protective against cardiovascular disease. However, optimization based solely on n-3 polyunsaturated fatty acid (n-3 PUFA) enrichment in chicken meat could lead to lower meat quality, unless the withdrawal period (plan) is applied for 1 week. The present study investigated whether the incorporation of FO in the diet for 32 days followed by its withdrawal for 1 week affected blood lipid profiles, lipoprotein particles, performance and meat flavor in male broiler chickens. Two hundred and forty birds (1-day-old, Ross 308) were assigned to 1 of 4 dietary groups: 0%, 1%, 2% or 3% FO with four replicates. Broilers were fed for 49 days according to a 4-phase feeding program. The experimental phase comprised day 11 to 42, and FO was removed on day 42. Blood samples were collected during the pre- and post-withdrawal period after the recordings before slaughter. The FO groups demonstrated decreased low-density lipoprotein (LDL) and increased high-density lipoprotein levels on day 42 (P < 0.01); however, these values were not significant after design withdrawal. Diet supplementation with FO elevated the blood levels of palmitic acid (C16:0) and n-3 PUFAs, especially long-chain (LC) PUFAs (EPA, C20:5n-3 and DHA, C22:6n-3), and caused a decline in the level of arachidonic acid (AA, C20:4n-6; P < 0.05). Application of a one-week withdrawal period resulted in a decrease in (P < 0.05) linoleic acid (C18:2n-6) and an increase in the level of AA, unlike their amounts on day 42. Although blood and tissue LC n-3 PUFA levels on day 49 were significantly higher in the FO groups compared with the control, they demonstrated a substantial decrease on day 49 compared with day 42. The best results, mainly the lowest n-6/n-3 fatty acids (FAs) and feed conversion ratio (FCRs), were observed for 3% FO (group T4), even after institution

Upper mantle oxygen fugacity recorded by peridotite xenoliths from oceanic islands

NASA Astrophysics Data System (ADS)

Davis, F. A.; Wall, K. T.; Cottrell, E.

2017-12-01

Oxygen fugacity (fO2) in Earth's mantle is a key variable influencing mineral and fluid stability, the onset of melting, and mantle rheology; but fO2 is not uniform across mantle spatial domains. Peridotite xenoliths erupted in oceanic island basalts (OIB) potentially record fO2 of their lithospheric source - the convecting upper mantle. Many of these xenoliths have reacted with OIB as they transited the lithosphere. These xenoliths may record fO2 of the OIB source, potentially recording fO2 heterogeneity within the upper mantle. We investigate fO2heterogeneity by analyzing coexisting olivine, opx, and spinel in 41 peridotite xenoliths from islands associated with four different hotspots: Oahu (Hawaii), Savai'i (Samoa), Tubuai (Austral), and Tahiti (Society). Elevated spinel TiO2 concentrations (TiO2 >0.2 wt.%) in xenoliths from Oahu, Tubuai, and Tahiti may indicate interaction with OIB magmas [1]. Such assemblages record higher fO2 on average (QFM+0.4 to QFM+1.0) than peridotites and lavas from mid-ocean ridges (QFM-2 to QFM) [2,3,4]. This suggests that Hawaiian, Society, and Austral basalts with fO2 ≥ QFM+0.4 are more oxidized than MORB. (None of the Samoan xenoliths have spinel TiO2 >0.05 wt.%). Xenoliths with TiO2 <0.2 wt.% that have not reacted with OIB show a great degree of fO2 heterogeneity (QFM-1.5 to QFM+1.0) reflective of heterogeneity in lithospheric fO2. Although some heterogeneity may indicate spatial variability in bulk mantle chemistry, it is likely that it is partly driven by metamorphic reactions as lithosphere cools or is reheated by a mantle plume. Increased temperature causes the (Mg,Fe)Al2O4 component of spinel to dissolve into pyroxene; this concentrates the magnetite component in spinel and increases fO2 [5]. We observed evidence of this reaction at the grain-scale. Spinels in spinel-cpx symplectites and rims of equant spinels are >1 log unit more oxidized and have lower Al2O3 concentrations than interiors of the equant spinels. These

FREEZING OF GAIT IS ASSOCIATED WITH A MISMATCH BETWEEN MOTOR IMAGERY AND MOTOR EXECUTION IN NARROW DOORWAYS, NOT WITH FAILURE TO JUDGE DOORWAY PASSABILITY

PubMed Central

Cohen, Rajal G.; Chao, Amanda; Nutt, John G.; Horak, Fay B.

2011-01-01

Background Many patients with Parkinson’s disease (PD) develop freezing of gait (FoG), which may manifest as a hesitation or “getting stuck” when they attempt to pass through a doorway. In two experiments, we asked whether FoG is associated with (1) a deficit in internal representation of one’s body size with respect to a doorway and (2) a mismatch between imagined and actual walking times when passing through a doorway. Method 24 subjects with PD (11 with and 13 without FoG) and 10 control subjects of similar age completed two experiments. In the Passability experiment, subjects judged the passability of doorways with different apertures scaled to their body widths. We compared passability estimates across groups. In the Imagery experiment, subjects timed themselves while: (1) imagining walking through doorways of different apertures and from different distances, and (2) actually walking in the same conditions they had just imagined. We compared imagined and actual walking durations across groups and conditions. Results In the Passability experiment, the estimated just-passable doorway was wider, relative to body width, in PD subjects than in control subjects, but there was no difference between PD subjects with and without FoG. In the Imagery experiment, subjects in all groups walked more slowly through narrow doorways than though wide doorways, and subjects with FoG walked much more slowly through the narrowest doorways. PD subjects with FoG showed a large discrepancy between actual and imagined time to pass through narrow doorways, unlike PD subjects without FoG and control subjects. Conclusions The equivalent passability judgments in PD subjects with and without FoG indicate that FoG is not specifically associated with a deficit in ability to internally represent space with reference to body size. However, the large difference in duration between actual and imagined walking through narrow doorways in subjects with FoG suggests that PD subjects with Fo

Summary of the Hungarian Provincial Press (21-26 June 1960) (132nd of the Series)

DTIC Science & Technology

1960-08-02

girls pose in the nude fo: pictures. (SK, 22 June 60, p Ij.) PART V. MILITARY MEWS Worker^* Militia The new worker guards of Baranya Magye took...farm of Boly from 6 to 20 July, while 220 high school girls will pick fruits and vegetables in the state farm of Balatonujhely. (DN, 22 June 60, pi...some 530 leadership members will participate. There will be no.camp for girl leaders in the Megye this year. (DN, 23 June 60, pi) 10 _ MGYÄL

TrkB Activators for the Treatment of Traumatic Vision Loss

DTIC Science & Technology

2017-06-01

em ( do i: 10 .1 08 9/ ne u. 20 17 .5 10...Im m un e Sy st em ( do i: 10 .1 08 9/ ne u. 20 17 .5 10 4) T hi s ar tic le h as b ee n pe er -r ev ie w ed a nd a cc ep te d fo r pu bl ic...Sy st em ( do i: 10 .1 08 9/ ne u. 20 17 .5 10 4) T hi s ar tic le h as b ee n pe er -r ev ie w ed a nd a cc ep te d fo r pu bl ic at io

The utilization of forward osmosis for coal tailings dewatering

EPA Science Inventory

The feasibility of dewatering coal tailings slurry by forward osmosis (FO) membrane process was investigated in this research. A prototype cell was designed and used for the dewatering tests. A cellulosic FO membrane (Hydration Technology Innovations, LLC, Albany, OR) was used fo...

Custom-Molded Foot-Orthosis Intervention and Multisegment Medial Foot Kinematics During Walking

PubMed Central

Cobb, Stephen C.; Tis, Laurie L.; Johnson, Jeffrey T.; Wang, Yong “Tai”; Geil, Mark D.

2011-01-01

Context: Foot-orthosis (FO) intervention to prevent and treat numerous lower extremity injuries is widely accepted clinically. However, the results of quantitative gait analyses have been equivocal. The foot models used, participants receiving intervention, and orthoses used might contribute to the variability. Objective: To investigate the effect of a custom-molded FO intervention on multisegment medial foot kinematics during walking in participants with low-mobile foot posture. Design: Crossover study. Setting: University biomechanics and ergonomics laboratory. Patients or Other Participants: Sixteen participants with low-mobile foot posture (7 men, 9 women) were assigned randomly to 1 of 2 FO groups. Interventions : After a 2-week period to break in the FOs, individuals participated in a gait analysis that consisted of 5 successful walking trials (1.3 to 1.4 m/s) during no-FO and FO conditions. Main Outcome Measure(s): Three-dimensional displacements during 4 subphases of stance (loading response, mid-stance, terminal stance, preswing) were computed for each multisegment foot model articulation. Results: Repeated-measures analyses of variance (ANOVAs) revealed that rearfoot complex dorsiflexion displacement during midstance was greater in the FO than the no-FO condition (F1,14 = 5.24, P = .04, partial η2 = 0.27). Terminal stance repeated-measures ANOVA results revealed insert-by-insert condition interactions for the first metatarsophalangeal joint complex (F1,14 = 7.87, P = .01, partial η2 = 0.36). However, additional follow-up analysis did not reveal differences between the no-FO and FO conditions for the balanced traditional orthosis (F1,14 = 4.32, P = .08, partial η2 = 0.38) or full-contact orthosis (F1,14 = 4.10, P = .08, partial η2 = 0.37). Conclusions: Greater rearfoot complex dorsiflexion during midstance associated with FO intervention may represent improved foot kinematics in people with low-mobile foot postures. Furthermore, FO intervention might

Functional Reorganization of the Locomotor Network in Parkinson Patients with Freezing of Gait

PubMed Central

Fling, Brett W.; Cohen, Rajal G.; Mancini, Martina; Carpenter, Samuel D.; Fair, Damien A.; Nutt, John G.; Horak, Fay B.

2014-01-01

Freezing of gait (FoG) is a transient inability to initiate or maintain stepping that often accompanies advanced Parkinson’s disease (PD) and significantly impairs mobility. The current study uses a multimodal neuroimaging approach to assess differences in the functional and structural locomotor neural network in PD patients with and without FoG and relates these findings to measures of FoG severity. Twenty-six PD patients and fifteen age-matched controls underwent resting-state functional magnetic resonance imaging and diffusion tensor imaging along with self-reported and clinical assessments of FoG. After stringent movement correction, fifteen PD patients and fourteen control participants were available for analysis. We assessed functional connectivity strength between the supplementary motor area (SMA) and the following locomotor hubs: 1) subthalamic nucleus (STN), 2) mesencephalic and 3) cerebellar locomotor region (MLR and CLR, respectively) within each hemisphere. Additionally, we quantified structural connectivity strength between locomotor hubs and assessed relationships with metrics of FoG. FoG+ patients showed greater functional connectivity between the SMA and bilateral MLR and between the SMA and left CLR compared to both FoG− and controls. Importantly, greater functional connectivity between the SMA and MLR was positively correlated with i) clinical, ii) self-reported and iii) objective ratings of freezing severity in FoG+, potentially reflecting a maladaptive neural compensation. The current findings demonstrate a re-organization of functional communication within the locomotor network in FoG+ patients whereby the higher-order motor cortex (SMA) responsible for gait initiation communicates with the MLR and CLR to a greater extent than in FoG− patients and controls. The observed pattern of altered connectivity in FoG+ may indicate a failed attempt by the CNS to compensate for the loss of connectivity between the STN and SMA and may reflect a loss

Biosimilars: it's not as simple as cost alone.

PubMed

Roger, S D; Goldsmith, D

2008-10-01

Biosimilars or follow-on biologics (FoB) are biopharmaceuticals that, unlike small molecule generic products, are copies of larger, much more complex proteins. As such, data generated from one biopharmaceutical cannot be extrapolated to another. Unlike small molecule generics, FoB require a full developmental programme, albeit smaller than for an originator product. This has been recognized by European regulatory authorities and it is becoming clear that accelerated processes for FoB marketing approval are not feasible. To determine the balance between costs surrounding FoB (including relatively extensive developmental programmes and subsequent price to the market) and the necessity to ensure efficacy and safety. It is important that FoB are sufficiently tested to ensure patient safety is not compromised. Conducting such a development programme followed by sound pharmacovigilance is very challenging and costly. Cost-savings associated with FoB may be limited.

Fluid Overload and Fluid Removal in Pediatric Patients on Extracorporeal Membrane Oxygenation Requiring Continuous Renal Replacement Therapy

PubMed Central

Selewski, David T; Cornell, Timothy T; Blatt, Neal B; Han, Yong Y; Mottes, Theresa; Kommareddi, Mallika; Gaies, Michael G; Annich, Gail M; Kershaw, David B; Shanley, Thomas P; Heung, Michael

2012-01-01

Objective In pediatric patients fluid overload (FO) at continuous renal replacement (CRRT) initiation is associated with increased mortality. The aim of this study was to characterize the association between fluid overload at CRRT initiation, fluid removal during CRRT, the kinetics of fluid removal and mortality in a large pediatric population receiving CRRT while on extracorporeal membrane oxygenation (ECMO). Design Retrospective chart review. Setting Tertiary children’s hospital Patients ECMO patients requiring CRRT from July 2006 to September 2010 Interventions None Measurements and Main Results Overall ICU survival was 34% for 53 patients that were initiated on CRRT while on ECMO during the study period. Median FO at CRRT initiation was significantly lower in survivors compared to non-survivors (24.5 vs. 38%, p=0.006). Median FO at CRRT discontinuation was significantly lower in survivors compared to non-survivors (7.1 vs. 17.5%, p=0.035). After adjusting for percent FO at CRRT initiation, age and severity of illness, the change in FO at CRRT discontinuation was not significantly associated with mortality (p=0.212). Models investigating the rates of fluid removal in different periods, age, severity of illness and fluid overload at CRRT initiation found that fluid overload at CRRT initiation was the most consistent predictor of survival. Conclusions Our data demonstrates an association between FO at CRRT initiation and mortality in pediatric patients receiving ECMO. The degree of FO at CRRT discontinuation is also associated with mortality, but appears to reflect the effect of FO at initiation. Furthermore, correction of FO to ≤ 10% was not associated with improved survival. These results suggest that intervening prior to the development of significant FO may be more clinically effective than attempting fluid removal after significant fluid overload has developed. Our findings suggest a role for earlier initiation of CRRT in this population, and warrant

Fructo-oligosaccharide improved brain β-amyloid, β-secretase, cognitive function, and plasma antioxidant levels in D-galactose-treated Balb/cJ mice.

PubMed

Yen, Chi-Hua; Wang, Cheng-Hsin; Wu, Wen-Tzu; Chen, Hsiao-Ling

2017-05-01

Long-term d-galactose injection induces accelerated aging in experimental rodent models. The aim of this study was to determine the effects of dietary fructo-oligosaccharide (FO) on the brain β-amyloid (Aβ), amyloid-associated enzymes, cognitive function, and plasma antioxidant levels in d-galactose-treated Balb/c mice. The subcutaneous (s.c.) injection and the dietary treatment were conducted simultaneously for 49 days. Mice (12 weeks of age) were divided into five groups (n = 14/group): control (s.c. saline, control diet) serving as a young control, DG (s.c. 1.2 g d-galactose/kg body weight, control diet), DG + LFO (2.5% w/w FO, low-dose FO diet), DG + HFO (5% w/w FO, high-dose FO diet), and DG + E (α-tocopherol 0.2% w/w, vitamin E diet) as an antioxidant reference group. Another group of older mice (64 weeks of age) without any injection served as a natural aging (NA) group. The DG and NA groups had greater Aβ levels in the cortex, hippocampus, and the whole brain. High-dose FO, similar to α-tocopherol, attenuated the d-galactose-induced Aβ density in the cortex and hippocampus. In addition, FO attenuated the d-galactose-induced protein expression of Aβ and beta-site amyloid precursor cleaving enzyme of the whole brain in a dose-response manner. Either dose of FO supplementation, similar to α-tocopherol, attenuated the d-galactose-induced cognitive dysfunction. In addition, FO improved the plasma ascorbic acid level in a dose-response manner. Dietary FO (2.5-5% w/w diet) could attenuate the development of Alzheimer's disease, which was likely to be associated with its systematic antioxidant effects.

Modified Primers for the Identification of Nonpathogenic Fusarium oxysporum Isolates That Have Biological Control Potential against Fusarium Wilt of Cucumber in Taiwan

PubMed Central

Wang, Chaojen; Lin, Yisheng; Lin, Yinghong; Chung, Wenhsin

2013-01-01

Previous investigations demonstrated that Fusarium oxysporum (Fo), which is not pathogenic to cucumbers, could serve as a biological control agent for managing Fusarium wilt of cucumber caused by Fo f. sp. cucumerinum (Foc) in Taiwan. However, thus far it has not been possible to separate the populations of pathogenic Fo from the nonpathogenic isolates that have biological control potential through their morphological characteristics. Although these two populations can be distinguished from one another using a bioassay, the work is laborious and time-consuming. In this study, a fragment of the intergenic spacer (IGS) region of ribosomal DNA from an Fo biological control agent, Fo366, was PCR-amplified with published general primers, FIGS11/FIGS12 and sequenced. A new primer, NPIGS-R, which was designed based on the IGS sequence, was paired with the FIGS11 primer. These primers were then evaluated for their specificity to amplify DNA from nonpathogenic Fo isolates that have biological control potential. The results showed that the modified primer pair, FIGS11/NPIGS-R, amplified a 500-bp DNA fragment from five of seven nonpathogenic Fo isolates. These five Fo isolates delayed symptom development of cucumber Fusarium wilt in greenhouse bioassay tests. Seventy-seven Fo isolates were obtained from the soil and plant tissues and then subjected to amplification using the modified primer pair; six samples showed positive amplification. These six isolates did not cause symptoms on cucumber seedlings when grown in peat moss infested with the isolates and delayed disease development when the same plants were subsequently inoculated with a virulent isolate of Foc. Therefore, the modified primer pair may prove useful for the identification of Fo isolates that are nonpathogenic to cucumber which can potentially act as biocontrol agents for Fusarium wilt of cucumber. PMID:23762289

Effects of dietary fat energy restriction and fish oil feeding on hepatic metabolic abnormalities and insulin resistance in KK mice with high-fat diet-induced obesity.

PubMed

Arai, Takeshi; Kim, Hyoun-ju; Hirako, Satoshi; Nakasatomi, Maki; Chiba, Hiroshige; Matsumoto, Akiyo

2013-01-01

We investigated the effects of dietary fat energy restriction and fish oil intake on glucose and lipid metabolism in female KK mice with high-fat (HF) diet-induced obesity. Mice were fed a lard/safflower oil (LSO50) diet consisting of 50 energy% (en%) lard/safflower oil as the fat source for 12 weeks. Then, the mice were fed various fat energy restriction (25 en% fat) diets - LSO, FO2.5, FO12.5 or FO25 - containing 0, 2.5, 12.5, or 25 en% fish oil, respectively, for 9 weeks. Conversion from a HF diet to each fat energy restriction diet significantly decreased final body weights and visceral and subcutaneous fat mass in all fat energy restriction groups, regardless of fish oil contents. Hepatic triglyceride and cholesterol levels markedly decreased in the FO12.5 and FO25 groups, but not in the LSO group. Although plasma insulin levels did not differ among groups, the blood glucose areas under the curve in the oral glucose tolerance test were significantly lower in the FO12.5 and FO25 groups. Real-time polymerase chain reaction analysis showed fatty acid synthase mRNA levels significantly decreased in the FO25 group, and stearoyl-CoA desaturase 1 mRNA levels markedly decreased in the FO12.5 and FO25 groups. These results demonstrate that body weight gains were suppressed by dietary fat energy restriction even in KK mice with HF diet-induced obesity. We also suggested that the combination of fat energy restriction and fish oil feeding decreased fat droplets and ameliorated hepatic hypertrophy and insulin resistance with suppression of de novo lipogenesis in these mice. Copyright © 2013 Elsevier Inc. All rights reserved.

Perinatal polyunstaurated fatty acids supplementation causes alterations in fuel homeostasis in adult male rats but does not offer resistance against STZ-induced diabetes.

PubMed

van Dijk, G; Kacsándi, A; Kóbor-Nyakas, D E; Hogyes, E; Nyakas, C

2011-12-01

Maternal factors can have major imprinting effects on homeostatic mechanisms in the developing fetus and newborn. Here we studied whether supplemented perinatal polyunsaturated fatty acids (PUFAs) influence energy balance and fuel homeostasis later in life. Between day 10 after conception and day 10 after delivery, female rats were subjected to chow enriched with 10% fish-oil (FO-rich). Fish oil contains high concentrations of n-3 biosynthesis endpoint products, which may have caused the increased membrane phospholipid incorporation (particularly derived from the long-chain 20 +:n-3 PUFAs) in 10-day old pup brains. Adult male offspring of FO-rich fed rats had reduced body weight (- 20%) at 3 months, and had lower levels of plasma leptin (- 54%), insulin (- 41%), triglycerides (- 65%), and lactate (- 46%) than controls. All differences between groups were lost 48 h after streptozotocin (STZ) treatment. At 4.5 months of age, body weights of FO-rich were still lower (- 6%) than controls, but were associated with increased food intake, and increased insulin sensitivity (following intraperitoneal injection) to lower blood glucose levels relative to controls. We concluded that perinatal FO supplementation has lasting effects on body weight homeostasis and fuel metabolism in male offspring, but does not offer resistance against STZ-induced diabetes. © Georg Thieme Verlag KG Stuttgart · New York.

Increased fear of progression in cancer patients with recurrence.

PubMed

Shim, Eun-Jung; Shin, Yong-Wook; Oh, Do-Youn; Hahm, Bong-Jin

2010-01-01

This study investigated the fear of progression (FoP) in cancer patients and the discriminant ability of the Fear of Progression Questionnaire (FoP-Q) against the Hospital Anxiety and Depression Scale (HADS), while also examining relationships between FoP, satisfaction outcomes and supportive needs. The FoP-Q and HADS were administered to 112 cancer patients in Korea during June and July 2006. The FoP-Q totals and subscales, and the HADS scores were compared across three groups (patients with recurrence, patients with metastases and controls experiencing neither). Comparison of the FoP-Q total score to HADS anxiety (HADS-A) and depression (HADS-D) scores showed higher FoP in the recurrence group compared to the control group (P=.009). Subscale score comparisons revealed a heightened "affective reaction" (P=.003) to cancer progression and fear of "loss of autonomy" (P=.011) in recurrence patients. FoP-Q score showed a moderate association with HADS-A (r=.54, P=.000) and a significant association with treatment satisfaction (r=-.26, P=.007), medical staff and communication (r=-.31, P=.001), and supportive needs (r=.41, P=.000). The importance of providing supportive interventions tailored to the specific emotional concerns of cancer patients, assessed via appropriate, disease-specific instruments, and the need to pay special attention to the concerns of recurrence patients are suggested. Copyright 2010 Elsevier Inc. All rights reserved.

Signature of a possible relationship between the maximum CME speed index and the critical frequencies of the F1 and F2 ionospheric layers: Data analysis for a mid-latitude ionospheric station during the solar cycles 23 and 24

NASA Astrophysics Data System (ADS)

Kilcik, Ali; Ozguc, Atila; Yiǧit, Erdal; Yurchyshyn, Vasyl; Donmez, Burcin

2018-06-01

We analyze temporal variations of two solar indices, the monthly mean Maximum CME Speed Index (MCMESI) and the International Sunspot Number (ISSN) as well as the monthly median ionospheric critical frequencies (foF1, and foF2) for the time period of 1996-2013, which covers the entire solar cycle 23 and the ascending branch of the cycle 24. We found that the maximum of foF1 and foF2 occurred respectively during the first and second maximum of the ISSN solar activity index in the solar cycle 23. We compared these data sets by using the cross-correlation and hysteresis analysis and found that both foF1 and foF2 show higher correlation with ISSN than the MCMESI during the investigated time period, but when significance levels are considered correlation coefficients between the same indices become comparable. Cross-correlation analysis showed that the agreement between these data sets (solar indices and ionospheric critical frequencies) is better pronounced during the ascending phases of solar cycles, while they display significant deviations during the descending phase. We conclude that there exists a signature of a possible relationship between MCMESI and foF1 and foF2, which means that MCMESI could be used as a possible indicator of solar and geomagnetic activity, even though other investigations are needed.

Fish oil-enriched nutrition combined with systemic chemotherapy for gastrointestinal cancer patients with cancer cachexia.

PubMed

Shirai, Yumiko; Okugawa, Yoshinaga; Hishida, Asahi; Ogawa, Aki; Okamoto, Kyoko; Shintani, Miki; Morimoto, Yuki; Nishikawa, Ryutaro; Yokoe, Takeshi; Tanaka, Koji; Urata, Hisashi; Toiyama, Yuji; Inoue, Yasuhiro; Tanaka, Motoyoshi; Mohri, Yasuhiko; Goel, Ajay; Kusunoki, Masato; McMillan, Donald C; Miki, Chikao

2017-07-06

Despite recent advances in chemotherapy for gastrointestinal cancer, a crucial factor related to poor prognosis is reduced tolerance to chemotherapy induced by cancer cachexia. Fish oil (FO)-derived eicosapentaenoic acid (EPA) modulates inflammation in patients with various malignancies; however, the impact of FO-enriched nutrition as a combined modality therapy on clinical outcomes remains controversial. We systemically analysed chronological changes in biochemical and physiological status using bioelectrical impedance analysis in 128 gastrointestinal cancer patients provided with or without FO-enriched nutrition during chemotherapy. Furthermore, we evaluated the clinical significance of FO-enriched nutrition and clarified appropriate patient groups that receive prognostic benefits from FO-enriched nutrition during treatment of gastrointestinal cancer. The control group showed significant up-regulation of serum CRP) levels and no significant difference in both skeletal muscle mass and lean body mass. In contrast, the FO-enriched nutrition group showed no changes in serum CRP concentration and significantly increased skeletal muscle mass and lean body mass over time. Furthermore, high CRP levels significantly correlated with reduced tolerance to chemotherapy, and FO-enriched nutrition improved chemotherapy tolerance and prognosis, particularly in gastrointestinal cancer patients with a modified Glasgow prognostic score (mGPS) of 1 or 2. We conclude that FO-enriched nutrition may improve the prognosis of patients with cancer cachexia and systemic inflammation (i.e., those with a mGPS of 1 or 2).

Boric acid permeation in forward osmosis membrane processes: modeling, experiments, and implications.

PubMed

Jin, Xue; Tang, Chuyang Y; Gu, Yangshuo; She, Qianhong; Qi, Saren

2011-03-15

Forward osmosis (FO) is attracting increasing interest for its potential applications in desalination. In FO, permeation of contaminants from feed solution into draw solution through the semipermeable membrane can take place simultaneously with water diffusion. Understanding the contaminants transport through and rejection by FO membrane has significant technical implications in the way to separate clean water from the diluted draw solution. In this study, a model was developed to predict boron flux in FO operation. A strong agreement between modeling results and experimental data indicates that the model developed in this study can accurately predict the boron transport through FO membranes. Furthermore, the model can guide the fabrication of improved FO membranes with decreased boron permeability and structural parameter to minimize boron flux. Both theoretical model and experimental results demonstrated that when membrane active layer was facing draw solution, boron flux was substantially greater compared to the other membrane orientation due to more severe internal concentration polarization. In this investigation, for the first time, rejection of contaminants was defined in FO processes. This is critical to compare the membrane performance between different membranes and experimental conditions.

Sensory quality and chemical composition of meat from lambs fed diets enriched with fish and rapeseed oils, carnosic acid and seleno-compounds.

PubMed

Jaworska, Danuta; Czauderna, Marian; Przybylski, Wiesław; Rozbicka-Wieczorek, Agnieszka J

2016-09-01

The aim of the study was to evaluate longissimus muscle quality in lambs fed diets including fish oil (FO), rapeseed oil (RO), carnosic acid (CA) and seleno-compounds. Lambs were fed one of diets: Group I - the basal diet (BD) with 3% RO; Group II - BD with 2% RO and 1% FO; Group III - BD with 2% RO, 1% FO and 0.1% CA; Group IV - BD with 2% RO, 1% FO, 0.1% CA and 0.35ppm Se as selenized-yeast; Group V - BD with 2% RO, 1% FO, 0.1% CA and 0.35ppm Se as selenate. The addition of FO and FO, CA and selenium in the inorganic form was characterized by lowest tenderness and juiciness (P<0.05). The lowest concentration of fatty acids (ΣFAs), atherogenic-FAs (A(SFA)) and thrombogenic-FAs (T(SFA)) in the muscle was found for Group V (P<0.05). Experimental diets decreased indexes of A(SFA) and T(SFA) in muscle. The lowest ratio (P<0.05) of n-6polyunsaturated-FAs to n-3polyunsaturated-FAs was obtained for Group III. Copyright © 2016 Elsevier Ltd. All rights reserved.

Comparison of acid-detergent lignin, alkaline-peroxide lignin, and acid-detergent insoluble ash as internal markers for predicting fecal output and digestibility by cattle offered bermudagrass hays of varying nutrient composition.

PubMed

Kanani, Juvenal; Philipp, Dirk; Coffey, Kenneth P; Kegley, Elizabeth B; West, Charles P; Gadberry, Shane; Jennings, John; Young, Ashley N; Rhein, Robert T

2014-01-13

The potential for acid-detergent insoluble ash (ADIA), alkaline-peroxide lignin (APL), and acid-detergent lignin (ADL) to predict fecal output (FO) and dry matter digestibility (DMD) by cattle offered bermudagrass [Cynodon dactylon (L.) Pers.] hays of different qualities was evaluated. Eight ruminally cannulated cows (594 ± 35.5 kg) were allocated randomly to 4 hay diets: low (L), medium low (ML), medium high (MH), and high (H) crude protein (CP) concentration (79, 111, 131, and 164 g CP/kg on a DM basis, respectively). Diets were offered in 3 periods with 2 diet replicates per period and were rotated across cows between periods. Cows were individually fed 20 g DM/kg of body weight in equal feedings at 08:00 and 16:00 h for a 10-d adaptation followed by a 5-d total fecal collection. Actual DM intake (DMI), DMD, and FO were determined based on hay offered, ort, and feces excreted. These components were then analyzed for ADL, APL, and ADIA concentration to determine marker recovery and marker-based estimates of FO and DMD. Forage DMI was affected by diet (P = 0.02), and DMI from MH and H was greater (P < 0.05) than from L. Apparent DMD tended (P = 0.08) to differ among diets while FO (P = 0.20) was not affected by diet treatments. Average ADL recovery (1.16) was greater (P < 0.05) than that of ADIA (1.03) and APL (1.06), but ADIA and APL did not differ (P = 0.42). Estimates of FO and DMD derived using APL and ADIA were not different (P ≥ 0.05) from total fecal collection while those using ADL differed (P < 0.05). There was no diet by marker interaction (P ≥ 0.22) for either FO or DMD. Acid-detergent insoluble ash and APL accurately predicted FO and DMD of cattle fed bermudagrass hay of varying nutrient composition. These internal markers may facilitate studies involving large numbers of animals and forages. Results from such studies may be used to develop improved equations to predict energy values of forages based on the

Characterization of vacuolar amino acid transporter from Fusarium oxysporum in Saccharomyces cerevisiae.

PubMed

Lunprom, Siriporn; Pongcharoen, Pongsanat; Sekito, Takayuki; Kawano-Kawada, Miyuki; Kakinuma, Yoshimi; Akiyama, Koichi

2015-01-01

Fusarium oxysporum causes wilt disease in many plant families, and many genes are involved in its development or growth in host plants. A recent study revealed that vacuolar amino acid transporters play an important role in spore formation in Schizosaccharomyces pombe and Saccharomyces cerevisiae. To investigate the role of vacuolar amino acid transporters of this phytopathogenic fungus, the FOXG_11334 (FoAVT3) gene from F. oxysporum was isolated and its function was characterized. Transcription of FoAVT3 was upregulated after rapamycin treatment. A green fluorescent protein fusion of FoAvt3p was localized to vacuolar membranes in both S. cerevisiae and F. oxysporum. Analysis of the amino acid content of the vacuolar fraction and amino acid transport activities using vacuolar membrane vesicles from S. cerevisiae cells heterologously expressing FoAVT3 revealed that FoAvt3p functions as a vacuolar amino acid transporter, exporting neutral amino acids. We conclude that the FoAVT3 gene encodes a vacuolar neutral amino acid transporter.

Water reclamation from shale gas drilling flow-back fluid using a novel forward osmosis-vacuum membrane distillation hybrid system.

PubMed

Li, Xue-Mei; Zhao, Baolong; Wang, Zhouwei; Xie, Ming; Song, Jianfeng; Nghiem, Long D; He, Tao; Yang, Chi; Li, Chunxia; Chen, Gang

2014-01-01

This study examined the performance of a novel hybrid system of forward osmosis (FO) combined with vacuum membrane distillation (VMD) for reclaiming water from shale gas drilling flow-back fluid (SGDF). In the hybrid FO-VMD system, water permeated through the FO membrane into a draw solution reservoir, and the VMD process was used for draw solute recovery and clean water production. Using a SGDF sample obtained from a drilling site in China, the hybrid system could achieve almost 90% water recovery. Quality of the reclaimed water was comparable to that of bottled water. In the hybrid FO-VMD system, FO functions as a pre-treatment step to remove most contaminants and constituents that may foul or scale the membrane distillation (MD) membrane, whereas MD produces high quality water. It is envisioned that the FO-VMD system can recover high quality water not only from SGDF but also other wastewaters with high salinity and complex compositions.

A Novel Multi-Charged Draw Solute That Removes Organic Arsenicals from Water in a Hybrid Membrane Process.

PubMed

Ge, Qingchun; Lau, Cher Hon; Liu, Minghua

2018-03-20

The potential of forward osmosis for water treatment can only be maximized with suitable draw solutes. Here a three-dimensional, multicharge draw solute of decasodium phytate (Na 10 -phytate) is designed and synthesized for removing organic arsenicals from water using a hybrid forward osmosis (FO) - membrane distillation (MD) process. Efficient water recovery is achieved using Na 10 -phytate as a draw solute with a water flux of 20.0 LMH and negligible reverse solute diffusion when 1000 ppm organic arsenicals as the feed and operated under ambient conditions with FO mode. At 50 °C, the novel draw solute increases water flux by more than 30% with water fluxes higher than 26.0 LMH on the FO side, drastically enhancing water recovery efficiency. By combining the FO and MD processes into a single hybrid process, a 100% recovery of Na 10 -phytate draw solute was achieved. Crucially, organic arsenicals or Na 10 -phytate draw solutes are both rejected 100% and not detected in the permeate of the hybrid process. The complete rejection of both organic arsenicals and draw solutes using hybrid membrane processes is unprecedented; creating a new application for membrane separations.

Fe3+ partitioning during basalt differentiation on Mars: insights into the oxygen fugacity of the shergottite mantle source(s).

NASA Astrophysics Data System (ADS)

Medard, E.; Martin, A. M.; Collinet, M.; Righter, K.; Grove, T. L.; Newville, M.; Lanzirotti, A.

2014-12-01

The partitioning of Fe3+ between silicate melts and minerals is a key parameter to understand magmatic processes, as it is directly linked to oxygen fugacity (fO2). fO2 is, a priori, not a constant during magmatic processes, and its evolution depends on the compatibility of Fe3+. We have experimentally determined the partition coefficients of Fe3+ between augite, pigeonite, and silicate melt, and use them to constrain the fO2of the martian mantle and of differentiated martian basalts. A series of experiments on various martian basaltic compositions were performed under controlled fO2 in one-atmosphere gas-mixing furnaces. Fe3+/Fetotal ratios in silicate melts and pyroxenes were determined using synchrotron Fe K-edge XANES on the 13 IDE beamline at APS (Argonne). Fe3+ mineral/melt partition coefficients (DFe3+) for augite and pigeonite were obtained with a relative uncertainty of 10-15 %. Both are constant over a wide range of oxygen fugacity (FMQ-2.5 to FMQ+2.0). DFe3+ for augite and pigeonite are broadly consistent with previous data by [1], but DFe3+ for augite is significantly higher (by a factor of 2) than the indirect determinations of [2]. Since augites in [2] are extremely poor in iron compared to ours (0.18 wt% vs 13 wt% FeO), this strongly suggests that DFe3+ varies with Mg#, indicating that Fe3+is more compatible than previously thought in terrestrial mantle pyroxenes (3 wt% FeO) as well. Crystallization paths for shergottite parental melts have been calculated using the MELTS software, combined with our partition coefficients. fO2 in the residual melts is calculated from the models of [3] and [4]. It stays relatively constant at high temperatures, but increases very strongly during the latest stages of crystallization. These results explain the large range of fO2 determined in enriched shergottites. In order to estimate the fO2 of the martian mantle, only the highest temperature phases in the most primitive martian samples should be used. The most

Effect of dietary starch concentration and fish oil supplementation on milk yield and composition, diet digestibility, and methane emissions in lactating dairy cows.

PubMed

Pirondini, M; Colombini, S; Mele, M; Malagutti, L; Rapetti, L; Galassi, G; Crovetto, G M

2015-01-01

The aim of this study was to evaluate the effects of diets with different starch concentrations and fish oil (FO) supplementation on lactation performance, in vivo total-tract nutrient digestibility, N balance, and methane (CH4) emissions in lactating dairy cows. The experiment was conducted as a 4×4 Latin square design with a 2×2 factorial arrangement: 2 concentrations of dietary starch [low vs. high: 23.7 and 27.7% on a dry matter (DM) basis; neutral detergent fiber/starch ratios: 1.47 and 1.12], the presence or absence of FO supplement (0.80% on a DM basis), and their interaction were evaluated. Four Italian Friesian cows were fed 1 of the following 4 diets in 4 consecutive 26-d periods: (1) low starch (LS), (2) low starch plus FO (LSO), (3) high starch (HS), and (4) high starch plus FO (HSO). The diets contained the same amount of forages (corn silage, alfalfa and meadow hays). The starch concentration was balanced using different proportions of corn meal and soybean hulls. The cows were housed in metabolic stalls inside open-circuit respiration chambers to allow measurement of CH4 emission and the collection of separate urine and feces. No differences among treatments were observed for DM intake. We observed a trend for FO to increase milk yield: 29.2 and 27.5kg/d, on average, for diets with and without FO, respectively. Milk fat was affected by the interaction between dietary starch and FO: milk fat decreased only in the HSO diet. Energy-corrected milk (ECM) was affected by the interaction between starch and FO, with a positive effect of FO on the LS diet. Fish oil supplementation decreased the n-6:n-3 ratio of milk polyunsaturated fatty acids. High-starch diets negatively influenced all digestibility parameters measured except starch, whereas FO improved neutral detergent fiber digestibility (41.9 vs. 46.1% for diets without and with FO, respectively, and ether extract digestibility (53.7 vs. 67.1% for diets without and with FO, respectively). We observed

Longitudinal variation of the equatorial ionosphere: Modeling and experimental results

NASA Astrophysics Data System (ADS)

Souza, J. R.; Asevedo, W. D.; dos Santos, P. C. P.; Petry, A.; Bailey, G. J.; Batista, I. S.; Abdu, M. A.

2013-02-01

We describe a new version of the Parameterized Regional Ionospheric Model (PARIM) which has been modified to include the longitudinal dependences. This model has been reconstructed using multidimensional Fourier series. To validate PARIM results, the South America maps of critical frequencies for the E (foE) and F (foF2) regions were compared with the values calculated by Sheffield Plasmasphere-Ionosphere Model (SUPIM) and IRI representations. PARIM presents very good results, the general characteristics of both regions, mainly the presence of the equatorial ionization anomaly, were well reproduced for equinoctial conditions of solar minimum and maximum. The values of foF2 and hmF2 recorded over Jicamarca (12°S; 77°W; dip lat. 1°N; mag. declination 0.3°) and sites of the conjugate point equatorial experiment (COPEX) campaign Boa Vista (2.8°N; 60.7°W; dip lat. 11.4°; mag. declination -13.1°), Cachimbo (9.5°S; 54.8°W; dip lat. -1.8°; mag. declination -15.5°), and Campo Grande (20.4°S; 54.6°W; dip lat. -11.1°; mag. declination -14.0°) have been used in this work. foF2 calculated by PARIM show good agreement with the observations, except during morning over Boa Vista and midnight-morning over Campo Grande. Some discrepancies were also found for the F-region peak height (hmF2) near the geomagnetic equator during times of F3 layer occurrences. IRI has underestimated both foF2 and hmF2 over equatorial and low latitude sectors during evening-nighttimes, except for Jicamarca where foF2 values were overestimated.

Comparison of optics and performance of a distal sensor high definition cystoscope, a distal sensor standard definition cystoscope, and a fiberoptic cystoscope.

PubMed

Lusch, Achim; Liss, Michael A; Greene, Peter; Abdelshehid, Corollos; Menhadji, Ashleigh; Bucur, Philip; Alipanah, Reza; McDougall, Elspeth; Landman, Jaime

2013-12-01

To evaluate performance characteristics and optics of a new generation high-definition distal sensor (HD-DS) flexible cystoscope, a standard-definition distal sensor (SD-DS) cystoscope, and a standard fiberoptic (FO) cystoscope. Three new cystoscopes (HD-DS, SD-DS, and FO) were compared for active deflection, irrigation flow, and optical characteristics. Each cystoscope was evaluated with an empty working channel and with various accessories. Optical characteristics (resolution, grayscale imaging, color representation, depth of field, and image brightness) were measured using United States Air Force (USAF)/Edmund Optics test targets and illumination meter. We digitally recorded a porcine cystoscopy in both clear and blood fields, with subsequent video analysis by 8 surgeons via questionnaire. The HD-DS had a higher resolution than the SD-DS and the FO at both 20 mm (6.35 vs 4.00 vs 2.24 line pairs/mm) and 10 mm (14.3 vs 7.13 vs 4.00 line pairs/mm) evaluations, respectively (P <.001 and P <.001). Color representation and depth of field (P = .001 and P <.001) were better in the HD-DS. When compared to the FO, the HD-DS and SD-DS demonstrated superior deflection up and irrigant flow with and without accessory present in the working channel, whereas image brightness was superior in the FO (P <.001, P = .001, and P <.001, respectively). Observers deemed the HD-DS cystoscope superior in visualization in clear and bloody fields, as well as for illumination. The new HD-DS provided significantly improved visualization in a clear and a bloody field, resolution, color representation, and depth of field compared to SD-DS and FO. Clinical correlation of these findings is pending. Copyright © 2013 Elsevier Inc. All rights reserved.

Evaluation of a high-EPA oil from transgenic Camelina sativa in feeds for Atlantic salmon (Salmo salar L.): Effects on tissue fatty acid composition, histology and gene expression.

PubMed

Betancor, M B; Sprague, M; Sayanova, O; Usher, S; Campbell, P J; Napier, J A; Caballero, M J; Tocher, D R

2015-07-01

Currently, one alternative for dietary fish oil (FO) in aquafeeds is vegetable oils (VO) that are devoid of omega-3 (n-3) long-chain polyunsaturated fatty acids (LC-PUFAs). Entirely new sources of n-3 LC-PUFA such as eicosapentaenoic (EPA) and docosahexaenoic (DHA) acids through de novo production are a potential solution to fill the gap between supply and demand of these important nutrients. Camelina sativa was metabolically engineered to produce a seed oil (ECO) with > 20% EPA and its potential to substitute for FO in Atlantic salmon feeds was tested. Fish were fed with one of the three experimental diets containing FO, wild-type camelina oil (WCO) or ECO as the sole lipid sources for 7 weeks. Inclusion of ECO did not affect any of the performance parameters studied and enhanced apparent digestibility of individual n-6 and n-3 PUFA compared to dietary WCO. High levels of EPA were maintained in brain, liver and intestine (pyloric caeca), and levels of DPA and DHA were increased in liver and intestine of fish fed ECO compared to fish fed WCO likely due to increased LC-PUFA biosynthesis based on up-regulation of the genes. Fish fed ECO showed slight lipid accumulation within hepatocytes similar to that with WCO, although not significantly different to fish fed FO. The regulation of a small number of genes could be attributed to the specific effect of ECO (311 features) with metabolism being the most affected category. The EPA oil from transgenic Camelina (ECO) could be used as a substitute for FO, however it is a hybrid oil containing both FO (EPA) and VO (18:2n-6) fatty acid signatures that resulted in similarly mixed metabolic and physiological responses.

Fear of recurrence in long-term cancer survivors-Do cancer type, sex, time since diagnosis, and social support matter?

PubMed

Koch-Gallenkamp, Lena; Bertram, Heike; Eberle, Andrea; Holleczek, Bernd; Schmid-Höpfner, Sieglinde; Waldmann, Annika; Zeissig, Sylke R; Brenner, Hermann; Arndt, Volker

2016-12-01

Fear of recurrence (FoR) is among the most important concerns for cancer survivors. Studies on potentially influencing variables, like time since diagnosis, cancer type, and sex, have yielded heterogeneous results. Also social support has rarely been examined as an influencing factor. This study aims to increase knowledge on these factors. Analyses are based on cross-sectional data of long-term survivors of breast, colorectal, and prostate cancer (5-16 years postdiagnosis), recruited by 6 German population-based cancer registries. Six thousand fifty-seven women and men were included in the analyses. FoR was assessed using the short form of the Fear of Progression Questionnaire (FoP-Q-SF). The associations of cancer type, age, sex, time since diagnosis, and social support with moderate/high FoR were identified via multiple logistic regression analyses. The majority of long-term cancer survivors reported experiencing FoR, mostly in low intensity. Female survivors, survivors ≤54 or 55-59 years of age, 5 to 7 years postdiagnosis, with a lower education, with recurrence/metastases, or being socially isolated were at greater risk to experience moderate/high FoR. Cancer type and stage at diagnosis did not reach statistical significance. Our results indicate a potential vulnerability for women to experience FoR in moderate/high severity. Also younger and socially isolated survivors were at greater risk to suffer from moderate/high levels of FoR and should thus be monitored for high levels of FoR and be offered the support needed to manage their fears. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

Effects of organic plant oils and role of oxidation on nutrient utilization in juvenile rainbow trout (Oncorhynchus mykiss).

PubMed

Lund, I; Dalsgaard, J; Jacobsen, C; Hansen, J H; Holm, J; Jokumsen, A

2013-03-01

Producing organic fish diets requires that the use of both fishmeal and fish oil (FO) be minimized and replaced by sustainable, organic sources. The purpose of the present study was to replace FO with organic oils and evaluate the effects on feed intake, feed conversion ratio (FCR), daily specific growth rate (SGR) and nutrient digestibility in diets in which fishmeal protein was partly substituted by organic plant protein concentrates. It is prohibited to add antioxidants to organic oils, and therefore the effects of force-oxidizing the oils (including FO) on feed intake and nutrient digestibility was furthermore examined. Four organic oils with either a relatively high or low content of polyunsaturated fatty acids were considered: linseed oil, rapeseed oil, sunflower oil and grapeseed oil. Substituting FO with organic oils did not affect feed intake (P > 0.05), FCR or SGR (P > 0.05) despite very different dietary fatty acid profiles. All organic plant oils had a positive effect on apparent lipid digestibility compared with the FO diet (P < 0.05), whereas there were no effects on the apparent digestibility of other macronutrients when compared with the FO diet (P > 0.05). Organic vegetable oils did not undergo auto-oxidation as opposed to the FO, and the FO diet consequently had a significantly negative effect on the apparent lipid digestibility. Feed intake was not affected by oxidation of any oils. In conclusion, the study demonstrated that it is possible to fully substitute FO with plant-based organic oils without negatively affecting nutrient digestibility and growth performance. Furthermore, plant-based organic oils are less likely to oxidize than FOs, prolonging the shelf life of such organic diets.

40 CFR 279.21 - Hazardous waste mixing.

Code of Federal Regulations, 2014 CFR

2014-07-01

... 40 Protection of Environment 27 2014-07-01 2014-07-01 false Hazardous waste mixing. 279.21 Section 279.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Generators § 279.21 Hazardous waste mixing...

40 CFR 279.21 - Hazardous waste mixing.

Code of Federal Regulations, 2011 CFR

2011-07-01

... 40 Protection of Environment 27 2011-07-01 2011-07-01 false Hazardous waste mixing. 279.21 Section 279.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Generators § 279.21 Hazardous waste mixing...

40 CFR 279.21 - Hazardous waste mixing.

Code of Federal Regulations, 2013 CFR

2013-07-01

... 40 Protection of Environment 28 2013-07-01 2013-07-01 false Hazardous waste mixing. 279.21 Section 279.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Generators § 279.21 Hazardous waste mixing...

40 CFR 279.21 - Hazardous waste mixing.

Code of Federal Regulations, 2012 CFR

2012-07-01

... 40 Protection of Environment 28 2012-07-01 2012-07-01 false Hazardous waste mixing. 279.21 Section 279.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Generators § 279.21 Hazardous waste mixing...

40 CFR 279.21 - Hazardous waste mixing.

Code of Federal Regulations, 2010 CFR

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Hazardous waste mixing. 279.21 Section 279.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Generators § 279.21 Hazardous waste mixing...

Family Obligation and the Transition to Young Adulthood.

ERIC Educational Resources Information Center

Fuligni, Andrew J.; Pedersen, Sara

2002-01-01

Examined changes in sense of family obligation (FO) among an ethnically diverse group of 745 Americans in transition from secondary school into young adulthood. Found that FO increased for all young adults, with slight variations according to ethnic and financial backgrounds. Implications of FO for employment and educational persistence depended…

Right heart dilatation in a fetus with an abnormal foramen ovale valve: an indicator of interatrial communication restriction.

PubMed

Lei, Wenjia; Fan, Miao; Wang, Meilian; Wang, Yu; Sun, Wei; Sun, Xue; Zhang, Ying

2018-05-02

Foramen ovale (FO) valve with a shape or motion abnormality is frequently detected during routine obstetric ultrasonic examinations. However, the hemodynamics mechanism of this entity remains unclear. The purpose of the study is to determine the relevance of interatrial communication restriction and resultant morphological modifications. We reviewed the echocardiographic records of fetuses with isolated abnormal FO valve evaluated between January of 2010 and december of 2016. The size (DFO) of the FO orifice, opening angle (α) of the FO valve, and dimensions of cardiac chambers, FO channel outlet (DOUT) and inferior vena cava (DIVC) were measured. We evaluated their (DFO, DOUT, α) relationships to the diameters of RA and DIVC. Five hundred and seventy normal fetuses were selected to establish the normal range of the DOUT/DIVC ratio so as to provide a criterion for restriction. An abnormal FO valve was identified in 89 fetuses without congenital heart disease, with restriction noted in 62 fetuses (45 fetuses with RA dilatation, 12 fetuses with RA and RV dilatation, and 5 fetuses with no RA dilatation). There were no significant correlations between RA/LA and DFO/DIVC, RA/ LA and α. RA/LA was negatively correlated with DOUT/DIVC (R2=0.97, p<0.01). For a fetus with an abnormal FO valve, right heart dilatation could be considered as an indicator of interatrial communication restriction, which could be assessed by evaluating the FO channel outlet. The degree of right atrium dilatation indicates the severity of the restriction.

Two-degree-of-freedom fractional order-PID controllers design for fractional order processes with dead-time.

PubMed

Li, Mingjie; Zhou, Ping; Zhao, Zhicheng; Zhang, Jinggang

2016-03-01

Recently, fractional order (FO) processes with dead-time have attracted more and more attention of many researchers in control field, but FO-PID controllers design techniques available for the FO processes with dead-time suffer from lack of direct systematic approaches. In this paper, a simple design and parameters tuning approach of two-degree-of-freedom (2-DOF) FO-PID controller based on internal model control (IMC) is proposed for FO processes with dead-time, conventional one-degree-of-freedom control exhibited the shortcoming of coupling of robustness and dynamic response performance. 2-DOF control can overcome the above weakness which means it realizes decoupling of robustness and dynamic performance from each other. The adjustable parameter η2 of FO-PID controller is directly related to the robustness of closed-loop system, and the analytical expression is given between the maximum sensitivity specification Ms and parameters η2. In addition, according to the dynamic performance requirement of the practical system, the parameters η1 can also be selected easily. By approximating the dead-time term of the process model with the first-order Padé or Taylor series, the expressions for 2-DOF FO-PID controller parameters are derived for three classes of FO processes with dead-time. Moreover, compared with other methods, the proposed method is simple and easy to implement. Finally, the simulation results are given to illustrate the effectiveness of this method. Copyright © 2015 ISA. Published by Elsevier Ltd. All rights reserved.

Fish oil supplementation reduces cachexia and tumor growth while improving renal function in tumor-bearing rats.

PubMed

Coelho, Isabela; Casare, Fernando; Pequito, Danielle C T; Borghetti, Gina; Yamazaki, Ricardo K; Brito, Gleisson A P; Kryczyk, Marcelo; Fernandes, Luiz Claudio; Coimbra, Terezila M; Fernandez, Ricardo

2012-11-01

The objective of the present work was to study the renal function of healthy and tumor-bearing rats chronically supplemented with fish oil (FO), a source of n-3 polyunsaturated fatty acids. Weanling male rats were divided in two groups, one control (C) and another orally supplemented for 70 days with FO (1 g/kg body weight). After this time, half the animals of each group were injected in the right flank with a suspension of Walker 256 tumor cells (W and WFO). The W group had less proteinemia reflecting cachectic proteolysis, FO reversed this fact. Tumor weight gain was also reduced in WFO. Glomerular filtration rate (GFR) was not different in FO or W compared to C, but was higher in WFO. Renal plasma flow (RPF) was higher in the FO supplemented groups. The W group had lower plasma osmolality than the C group, but FO supplementation resulted in normalization of this parameter. Fractional sodium excretion (FE(Na+)) of FO rats was similar to C. Proximal Na(+) reabsorption, evaluated by lithium clearance, was similar among the groups. Urinary thromboxane B(2) (TXB(2)) excretion was lower in the supplemented groups. The number of macrophages in renal tissue was higher in W compared to C rats, but was lower in WFO rats compared to W rats. In conclusion, FO supplementation resulted in less tumor growth and cachexia, and appeared to be renoprotective, as suggested by higher RPF and GFR.

Integrated forward osmosis-membrane distillation process for human urine treatment.

PubMed

Liu, Qianliang; Liu, Caihong; Zhao, Lei; Ma, Weichao; Liu, Huiling; Ma, Jun

2016-03-15

This study demonstrated a forward osmosis-membrane distillation (FO-MD) hybrid system for real human urine treatment. A series of NaCl solutions at different concentrations were adopted for draw solutions in FO process, which were also the feed solutions of MD process. To establish a stable and continuous integrated FO-MD system, individual FO process with different NaCl concentrations and individual direct contact membrane distillation (DCMD) process with different feed temperatures were firstly investigated separately. Four stable equilibrium conditions were obtained from matching the water transfer rates of individual FO and MD processes. It was found that the integrated system is stable and sustainable when the water transfer rate of FO subsystem is equal to that of MD subsystem. The rejections to main contaminants in human urine were also investigated. Although individual FO process had relatively high rejection to Total Organic Carbon (TOC), Total Nitrogen (TN) and Ammonium Nitrogen (NH4(+)-N) in human urine, these contaminants could also accumulate in draw solution after long term performance. The MD process provided an effective rejection to contaminants in draw solution after FO process and the integrated system revealed nearly complete rejection to TOC, TN and NH4(+)-N. This work provided a potential treatment process for human urine in some fields such as water regeneration in space station and water or nutrient recovery from source-separated urine. Copyright © 2016 Elsevier Ltd. All rights reserved.

Dietary fish oil and curcumin combine to modulate colonic cytokinetics and gene expression in dextran sodium sulphate-treated mice.

PubMed

Jia, Qian; Ivanov, Ivan; Zlatev, Zlatomir Z; Alaniz, Robert C; Weeks, Brad R; Callaway, Evelyn S; Goldsby, Jennifer S; Davidson, Laurie A; Fan, Yang-Yi; Zhou, Lan; Lupton, Joanne R; McMurray, David N; Chapkin, Robert S

2011-08-01

Both fish oil (FO) and curcumin have potential as anti-tumour and anti-inflammatory agents. To further explore their combined effects on dextran sodium sulphate (DSS)-induced colitis, C57BL/6 mice were randomised to four diets (2 × 2 design) differing in fatty acid content with or without curcumin supplementation (FO, FO+2 % curcumin, maize oil (control, MO) or MO+2 % curcumin). Mice were exposed to one or two cycles of DSS in the drinking-water to induce either acute or chronic intestinal inflammation, respectively. FO-fed mice exposed to the single-cycle DSS treatment exhibited the highest mortality (40 %, seventeen of forty-three) compared with MO with the lowest mortality (3 %, one of twenty-nine) (P = 0·0008). Addition of curcumin to MO increased (P = 0·003) mortality to 37 % compared with the control. Consistent with animal survival data, following the one- or two-cycle DSS treatment, both dietary FO and curcumin promoted mucosal injury/ulceration compared with MO. In contrast, compared with other diets, combined FO and curcumin feeding enhanced the resolution of chronic inflammation and suppressed (P < 0·05) a key inflammatory mediator, NF-κB, in the colon mucosa. Mucosal microarray analysis revealed that dietary FO, curcumin and FO plus curcumin combination differentially modulated the expression of genes induced by DSS treatment. These results suggest that dietary lipids and curcumin interact to regulate mucosal homeostasis and the resolution of chronic inflammation in the colon.

LABORATORY EVALUATION OF ZERO-VALENT IRON TO TREAT GROUNDWATER IMPACTED BY ACID MINE DRAINAGE

EPA Science Inventory

The generation and release of acidic, metal-rich water from mine wastes continues to be an intractable environmental problem. Although the effects of acid mine drainage (AMD) are most evident in surface waters, there is an obvious need for developing cost-effective approaches fo...

GROUNDWATER IMPACTED BY ACID MINE DRAINAGE

EPA Science Inventory

The generation and release of acidic, metal-rich water from mine wastes continues to be an intractable environmental problem. Although the effects of acid mine drainage (AMD) are most evident in surface waters, there is an obvious need for developing cost-effective approaches fo...

Control and monitoring of oxygen fugacity in piston cylinder experiments

NASA Astrophysics Data System (ADS)

Matjuschkin, Vladimir; Brooker, Richard A.; Tattitch, Brian; Blundy, Jon D.; Stamper, Charlotte C.

2015-01-01

We present a newly developed capsule design that resolves some common problems associated with the monitoring and control of oxygen fugacity ( fO2) in high-pressure piston cylinder experiments. The new fO2 control assembly consists of an AuPd outer capsule enclosing two inner capsules: one of AuPd capsule containing the experimental charge (including some water), and the other of Pt containing a solid oxygen buffer plus water. The inner capsules are separated by crushable alumina. The outer capsule is surrounded by a Pyrex sleeve to simultaneously minimise hydrogen loss from the cell and carbon infiltration from the graphite furnace. Controlled fO2 experiments using this cell design were carried out at 1.0 GPa and 1,000 °C. We used NiPd, CoPd and (Ni, Mg)O fO2 sensors, whose pressure sensitivity is well calibrated, to monitor the redox states achieved in experiments buffered by Re-ReO2, Ni-NiO and Co-CoO, respectively. Results for the fO2 sensors are in good agreement with the intended fO2 established by the buffer, demonstrating excellent control for durations of 24-48 h, with uncertainties less than ± 0.3 log bar units of fO2.

Ionosonde-based indices for improved representation of solar cycle variation in the International Reference Ionosphere model

NASA Astrophysics Data System (ADS)

Brown, Steven; Bilitza, Dieter; Yiǧit, Erdal

2018-06-01

A new monthly ionospheric index, IGNS, is presented to improve the representation of the solar cycle variation of the ionospheric F2 peak plasma frequency, foF2. IGNS is calculated using a methodology similar to the construction of the "global effective sunspot number", IG, given by Liu et al. (1983) but selects ionosonde observations based on hemispheres. We incorporated the updated index into the International Reference Ionosphere (IRI) model and compared the foF2 model predictions with global ionospheric observations. We also investigated the influence of the underlying foF2 model on the IG index. IRI has two options for foF2 specification, the CCIR-66 and URSI-88 foF2 models. For the first time, we have calculated IG using URSI-88 and assessed the impact on model predictions. Through a retrospective model-data comparison, results show that the inclusion of the new monthly IGNS index in place of the current 12-month smoothed IG index reduce the foF2 model prediction errors by nearly a factor of two. These results apply to both day-time and nightime predictions. This is due to an overall improved prediction of foF2 seasonal and solar cycle variations in the different hemispheres.

Improvement in in vitro fertilization rate, decrease in reactive oxygen species and spermatozoa death incidence in rams by dietary fish oil.

PubMed

Matini Behzad, A; Ebrahimi, B; Alizadeh, A R; Esmaeili, V; Dalman, A; Rashki, L; Shahverdi, A H

2014-08-01

Our aim was to evaluate the effects of fish oil feeding on sperm classical parameters, level of reactive oxygen spices (ROS), spermatozoa death incidence and in vitro fertilization (IVF) rate in rams. We randomly assigned nine rams, into two experimental groups (isoenergetic and isonitrogenous rations with constant level of vitamin E supplement): control (CTR; n = 5) and fish oil (FO; n = 4, 35 g/day/ram). Diets were fed for 70 days during the physiological breeding season. After a 21-day dietary adaptation period, semen was collected weekly from each ram by an artificial vagina. Sperm classical parameters were determined by the computer-assisted sperm analyzer system (CASA), and it was prepared for IVF process by swim-up technique. These evaluations were performed during the first and last weeks of sampling. Intracellular ROS level and spermatozoa death incidence were detected by flow cytometry on a weekly basis after adaptation. Data were analysed with SPSS 15. The volume, concentration (3.6 and 2.7 × 10(9) /ml) and sperm progressive motility (60 and 48%) were significantly improved in the FO group compared with the CTR (p < 0.05). A comparison of two-cell stage embryos following IVF in the two groups showed a significantly higher fertilization rate in the FO group (56%) compared with the CTR (49%). Superoxide anion (O2 (-) ) rate was significantly lower (p < 0.05) at the third week of sampling in the FO. Although the H2 O2 rate was numerically lower in the FO group compared with the CTR, this difference was not significant. In addition, apoptosis showed a significant difference in the third week of sampling (15 and 30% for FO and CTR, respectively; p < 0.05). Overall, adding fish oil to the ram diet not only improved sperm quality and IVF results, it also could reduce oxygen-free radicals and the incidence of spermatozoa death. © 2014 Blackwell Verlag GmbH.

Oxygen Fugacity in Large Metal Capsules

NASA Astrophysics Data System (ADS)

Faul, U.; Cline, C. J., II; Jackson, I.; Berry, A.

2016-12-01

During experiments with iron bearing silicates, equilibration between metal capsules and sample interior depends on diffusion of Fe if the capsule composition is not initially in equilibrium with the sample composition. For example, placing Pt or Ni capsules in contact with Fe-bearing olivine leads to Fe-loss from the olivine. In a fully equilibrated system the Fe contents of coexisting metal capsule and olivine reflect the oxygen fugacity (fO2) of the system. Experiments were conducted with olivine encapsulated or wrapped in four different metals (Fe, Ni70Fe30, Ni and Pt) to determine the fO2 in the cm-sized samples used for deformation and seismic property experiments. Small Pt particles mixed with olivine powder were used as fO2 sensors in the interior of the capsules. The results show an ordering of the fO2 in the interior that is consistent with the enclosing metals, i.e. the fO2 is lowest in a Fe capsule and highest in a Pt capsule. However, fO2 values in the more oxidizing metal capsules are substantially below their respective metal-oxide buffers. For example, solgel olivine encapsulated in Ni has an oxygen fugacity that is more than three orders of magnitude below Ni-NiO at 1200C and 0.3 GPa. The fO2 in a capsule interior is therefore to some extent self-buffering and only moderately influenced by the composition of the capsule. While the Pt particles in the interior are equilibrated, Fe gradients from the interior up to the Pt and Ni sample-capsule interfaces show that Fe loss into the capsules is diffusion limited. The fO2 at the interface also has implications for the water retention in unbuffered capsules. We infer that relatively high fO2 and hence fH2O observed adjacent to Pt capsules enables retention of water in these capsules, but the fO2 adjacent to Ni capsules is too low and water is lost.

Effects of coconut and fish oils on ruminal methanogenesis, fermentation, and abundance and diversity of microbial populations in vitro.

PubMed

Patra, A K; Yu, Z

2013-03-01

Coconut (CO) and fish (FO) oils were previously shown to inhibit rumen methanogenesis and biohydrogenation, which mitigates methane emission and helps improve beneficial fatty acids in meat and milk. This study aimed at investigating the comparative effects of CO and FO on the methanogenesis, fermentation, and microbial abundances and diversity in vitro rumen cultures containing different doses (0, 3.1, and 6.2 mL/L) of each oil and 400mg feed substrate using rumen fluid from lactating dairy cows as inocula. Increasing doses of CO and FO quadratically decreased concentrations of methane, but hydrogen concentrations were only increased quadratically by CO. Both oils linearly decreased dry matter and neutral detergent fiber digestibility of feeds but did not affect the concentration of total volatile fatty acids. However, CO reduced acetate percentage and acetate to propionate ratio and increased the percentages of propionate and butyrate to a greater extent than FO. Ammonia concentration was greater for CO than FO. As determined by quantitative real-time PCR, FO had greater inhibition to methanogens than CO, but the opposite was true for protozoal, Ruminococcus flavefaciens, and Fibrobacter succinogenes. Ruminococcus albus was not affected by either oil. Denaturing gradient gel electrophoresis (DGGE) profiles revealed that bacterial and archaeal community composition were changed differently by oil type. Based on Pareto-Lorenz evenness curve analysis of the DGGE profiles, CO noticeably changed the functional organization of archaea compared with FO. In conclusion, although both CO and FO decreased methane concentrations to a similar extent, the mode of reduction and the effect on abundances and diversity of archaeal and bacterial populations differed between the oils. Thus, the use of combination of CO and FO at a low dose may additively lower methanogenesis in the rumen while having little adverse effect on rumen fermentation. Copyright © 2013 American Dairy

Tone-assisted time delay interferometry on GRACE Follow-On

NASA Astrophysics Data System (ADS)

Francis, Samuel P.; Shaddock, Daniel A.; Sutton, Andrew J.; de Vine, Glenn; Ware, Brent; Spero, Robert E.; Klipstein, William M.; McKenzie, Kirk

2015-07-01

We have demonstrated the viability of using the Laser Ranging Interferometer on the Gravity Recovery and Climate Experiment Follow-On (GRACE-FO) space mission to test key aspects of the interspacecraft interferometry proposed for detecting gravitational waves. The Laser Ranging Interferometer on GRACE-FO will be the first demonstration of interspacecraft interferometry. GRACE-FO shares many similarities with proposed space-based gravitational wave detectors based on the Laser Interferometer Space Antenna (LISA) concept. Given these similarities, GRACE-FO provides a unique opportunity to test novel interspacecraft interferometry techniques that a LISA-like mission will use. The LISA Experience from GRACE-FO Optical Payload (LEGOP) is a project developing tests of arm locking and time delay interferometry (TDI), two frequency stabilization techniques, that could be performed on GRACE-FO. In the proposed LEGOP TDI demonstration one GRACE-FO spacecraft will have a free-running laser while the laser on the other spacecraft will be locked to a cavity. It is proposed that two one-way interspacecraft phase measurements will be combined with an appropriate delay in order to produce a round-trip, dual one-way ranging (DOWR) measurement independent of the frequency noise of the free-running laser. This paper describes simulated and experimental tests of a tone-assisted TDI ranging (TDIR) technique that uses a least-squares fitting algorithm and fractional-delay interpolation to find and implement the delays needed to form the DOWR TDI combination. The simulation verifies tone-assisted TDIR works under GRACE-FO conditions. Using simulated GRACE-FO signals the tone-assisted TDIR algorithm estimates the time-varying interspacecraft range with a rms error of ±0.2 m , suppressing the free-running laser frequency noise by 8 orders of magnitude. The experimental results demonstrate the practicability of the technique, measuring the delay at the 6 ns level in the presence of a

Permeability recovery of fouled forward osmosis membranes by chemical cleaning during a long-term operation of anaerobic osmotic membrane bioreactors treating low-strength wastewater.

PubMed

Wang, Xinhua; Hu, Taozhan; Wang, Zhiwei; Li, Xiufen; Ren, Yueping

2017-10-15

Anaerobic osmotic membrane bioreactor (AnOMBR) has gained increasing interests in wastewater treatment owing to its simultaneous recovery of biogas and water. However, the forward osmosis (FO) membrane fouling was severe during a long-term operation of AnOMBRs. Here, we aim to recover the permeability of fouled FO membranes by chemical cleaning. Specifically speaking, an optimal chemical cleaning procedure was searched for fouled thin film composite polyamide FO (TFC-FO) membranes in a novel microfiltration (MF) assisted AnOMBR (AnMF-OMBR). The results indicated that citric acid, disodium ethylenediaminetetraacetate (EDTA-2Na), hydrochloric acid (HCl), sodium dodecyl sulfate (SDS) and sodium hydroxide (NaOH) had a low cleaning efficiency of less than 15%, while hydrogen peroxide (H 2 O 2 ) could effectively remove foulants from the TFC-FO membrane surface (almost 100%) through oxidizing the functional group of the organic foulants and disintegrating the colloids and microbe flocs into fine particles. Nevertheless, the damage of H 2 O 2 to the TFC-FO membrane was observed when a high cleaning concentration and a long duration were applied. In this case, the optimal cleaning conditions including cleaning concentration and time for fouled TFC-FO membranes were selected through confocal laser scanning microscope (CLSM) and scanning electron microscopy (SEM) images and the flux recovery rate. The results suggested that the optimal cleaning procedure for fouled TFC-FO membranes was use of 0.5% H 2 O 2 at 25 °C for 6 h, and after that, the cleaned TFC-FO membrane had the same performance as a virgin one including water flux and rejection for organic matters and phosphorus during the operation of AnMF-OMBR. Copyright © 2017 Elsevier Ltd. All rights reserved.

The relationship between the parenteral dose of fish oil supplementation and the variation of liver function tests in hospitalized adult patients.

PubMed

Badia-Tahull, Maria B; Leiva-Badosa, Elisabet; Jodar-Masanes, Ramon; Ramon-Torrell, Josep Maria; Llop-Talaveron, Josep

2015-07-02

Hepatic dysfunction is a complication associated with parenteral nutrition (PN). Our primary objective was to study the relationship between doses of intravenous fish oil (FO) emulsion in PN and the variation in the main liver function tests (LFTs) in hospitalized PN-treated adults. As a secondary objective, we studied the safety of FO administration. We conducted a retrospective study in adult patients receiving FO supplementation in PN. Demographic, nutritional and safety variables were collected. Variation of LFTs was defined as the difference between values just before the first administration of FO and values at the end of PN. A multiple linear regression was performed to study the association between PN-lipids (FO or vegetable) and the variation of each LFT; the following variables were used to adjust the effect of lipids: sepsis, length of stay in the intensive care unit and lipids dose. Student t-test was used to study safety variables. Data were analyzed using SPSS 19.0. Patients (53, median age 68 years (24-90); 62% men) with the principal diagnosis of digestive neoplasm (42%) received PN for a median of 19 (7-75) days. In the multivariate analysis, the amount of FO was related to a decrease in gamma-glutamyl transferase (GGT) (B = -2.23;CI95 % = -4.41/-0.05), a decrease in alkaline phosphatase (AP) (B = -1.23;CI95 % = -2.07/-0.37), and a decrease in alanine aminotransferase (ALT) (B = -0.82; CI95 % = -1.19/-0.44). No differences were found in safety variables. GGT, AP and ALT improved with FO PN-supplementation. Moreover, the improvement was greater when the doses of FO were higher. FO administration in PN is safe.

Metabolic and molecular responses to calcium soap of fish oil fed to ewes during peripartal period.

PubMed

Sheibani, S; Mohammadi-Sangcheshmeh, A; Alamouti, A A; Khadem, A A; Norouzian, M A

2017-10-31

It has been shown that n-3 long chain fatty acids (n-3 LCFA) are involved in energy/lipid metabolisms, reproductive parameters, and molecular regulations leading to maintained homeostasis. We hypothesized that supplementation of peripartal diets with fish oil (FO), as a source of n-3 LCFA, could improve energy balance and modulate metabolic pressure in a sheep model. Prepartum ewes (n = 24) were fed control (CON) or calcium soap of fish oil (FO) supplemented-diet from four weeks before until three weeks after parturation. Feed intake, body weight (BW) change, plasma metabolites, colostrums/milk composition, and fatty acids profile of milk along with the expression of core microRNAs in glucose and lipid metabolism were evaluated. Prepartal feed intake decreased in FO group (1674 ± 33.26 vs. 1812 ± 35.56) though post-partal intake was similar. Differences in BW were not also significant (55.47 ± 2.07 in CON vs. 53.69 ± 1.94 in FO). No differences were observed in plasma metabolites except for cholesterol that was lower in FO group (56.25 ± 0.71 vs. 53.09 ± 0.61). Milk fat percentage was reduced (8.82 ± 0.49 vs. 7.03 ± 0.45) while the percentage of milk total n-3 LCFA increased in FO group. In accordance, the relative transcript abundance of miR-101 (0.215 ± 0.08) and miR-103 (0.37 ± 0.15) decreased by FO supplementation. Results showed that FO supplementation during peripartal period decreased milk fat, feed intake, plasma cholesterol, milk n-6:n-3 ratio and the expression of miR-101. Although the trend indicated that FO could alter lipid metabolism during transition period, further studies are needed to fully address its effect on energy balance and homeorhetic processes.

On the influence of solar activity on the mid-latitude sporadic E layer

NASA Astrophysics Data System (ADS)

Pezzopane, Michael; Pignalberi, Alessio; Pietrella, Marco

2015-09-01

To investigate the influence of solar cycle variability on the sporadic E layer (Es), hourly measurements of the critical frequency of the Es ordinary mode of propagation, foEs, and of the blanketing frequency of the Es layer, fbEs, recorded from January 1976 to December 2009 at the Rome (Italy) ionospheric station (41.8° N, 12.5° E), were examined. The results are: (1) a high positive correlation between the F10.7 solar index and foEs as well as between F10.7 and fbEs, both for the whole data set and for each solar cycle separately, the correlation between F10.7 and fbEs being much higher than the one between F10.7 and foEs; (2) a decreasing long-term trend of the F10.7, foEs and fbEs time series, with foEs decreasing more rapidly than F10.7 and fbEs; (3) clear and statistically significant peaks at 11 years in the foEs and fbEs time series, inferred from Lomb-Scargle periodograms.

Fear of Hypoglycemia, Parenting Stress, and Metabolic Control for Children with Type 1 Diabetes and Their Parents.

PubMed

Viaene, Ann-Sofie; Van Daele, Tom; Bleys, Dries; Faust, Kelly; Massa, Guy G

2017-03-01

This study sets out to extend current knowledge of parenting stress and fear of hypoglycemia (FoH) in parents of children with type 1 diabetes mellitus (T1DM). We examined if the relationship between parental and children's FoH and metabolic control, as reflected by HbA1c, is mediated by parenting stress. A total of 63 parents and children with T1DM were recruited during their routine physician's appointment. Parents completed questionnaires on parenting stress and FoH. Children eight years and older also completed a questionnaire on FoH. HbA1c values were obtained from all children. Mediation analysis revealed an indirect association between parental FoH and HbA1c values through parenting stress (Sobel's z = 2.42, p = .02), but no indirect association between children's FoH and HbA1c. We concluded that parental FOH has an indirect association with the child's metabolic control that is mediated by parenting stress. More simply, fear of hypoglycemia predicts parent stress, which in turn, predicts metabolic control.

Flaxseed Oil Alleviates Chronic HFD-Induced Insulin Resistance through Remodeling Lipid Homeostasis in Obese Adipose Tissue.

PubMed

Yu, Xiao; Tang, Yuhan; Liu, Peiyi; Xiao, Lin; Liu, Liegang; Shen, Ruiling; Deng, Qianchun; Yao, Ping

2017-11-08

Emerging evidence suggests that higher circulating long-chain n-3 polyunsaturated fatty acids (n-3PUFA) levels were intimately associated with lower prevalence of obesity and insulin resistance. However, the understanding of bioactivity and potential mechanism of α-linolenic acid-rich flaxseed oil (ALA-FO) against insulin resistance was still limited. This study evaluated the effect of FO on high-fat diet (HFD)-induced insulin resistance in C57BL/6J mice focused on adipose tissue lipolysis. Mice after HFD feeding for 16 weeks (60% fat-derived calories) exhibited systemic insulin resistance, which was greatly attenuated by medium dose of FO (M-FO), paralleling with differential accumulation of ALA and its n-3 derivatives across serum lipid fractions. Moreover, M-FO was sufficient to effectively block the metabolic activation of adipose tissue macrophages (ATMs), thereby improving adipose tissue insulin signaling. Importantly, suppression of hypoxia-inducible factors HIF-1α and HIF-2α were involved in FO-mediated modulation of adipose tissue lipolysis, accompanied by specific reconstitution of n-3PUFA within adipose tissue lipid fractions.

Plastic ingestion by a generalist seabird on the coast of Uruguay.

PubMed

Lenzi, Javier; Burgues, María Fernanda; Carrizo, Daniel; Machín, Emanuel; Teixeira-de Mello, Franco

2016-06-15

We analyzed plastic ingestion by Kelp Gull (Larus dominicanus) from 806 pellets collected between 2011 and 2013. Employing a Raman spectroscopy, we characterized those polymers used to produce the plastics ingested. Debris was recorded in 143 pellets (%FO=17.7%, n=202, 92.58g). Plastic was found in 119 pellets (%FO=83%) and non-plastic occurred in 56 pellets (%FO=39%). The most important debris category was plastic film with 55.3% (n=79). Plastic bags were observed in 19 pellets (%FO=2.4%, weight=25.02g). Glass was the second most important component (%FO=18.9%) followed by plastic fragments (%FO=17.8%). Plastic debris represented the 65.3% of the debris fragments (n=132, weight=58.84g), and was composed by polyethylene (52%), polypropylene (26%), polyamide (12%), polystyrene (6%), polyvinyl chloride (2%), and polyethylene terephthalate (2%). How plastics were obtained by gulls and the effects on individuals are discussed, as well as environmental considerations about plastic pollution on coastal environments. Copyright © 2016 Elsevier Ltd. All rights reserved.

Comparison of gene expression and fatty acid profiles in concentrate and forage finished beef.

PubMed

Buchanan, J W; Garmyn, A J; Hilton, G G; VanOverbeke, D L; Duan, Q; Beitz, D C; Mateescu, R G

2013-01-01

Fatty acid profiles and intramuscular expression of genes involved in fatty acid metabolism were characterized in concentrate- (CO) and forage- (FO) based finishing systems. Intramuscular samples from the adductor were taken at slaughter from 99 heifers finished on a CO diet and 58 heifers finished on a FO diet. Strip loins were obtained at fabrication to evaluate fatty acid profiles of LM muscle for all 157 heifers by using gas chromatography fatty acid methyl ester analysis. Composition was analyzed for differences by using the General Linear Model (GLM) procedure in SAS. Differences in fatty acid profile included a greater atherogenic index, greater percentage total MUFA, decreased omega-3 to omega-6 ratio, decreased percentage total PUFA, and decreased percentage omega-3 fatty acids in CO- compared with FO-finished heifers (P<0.05). Fatty acid profiles from intramuscular samples were ranked by the atherogenic index, and 20 heifers with either a high (HAI; n=10) or low (LAI; n=10) atherogenic index were selected for gene expression analysis using real-time PCR (RT-PCR). Gene expression data for the 20 individuals were analyzed as a 2 by 2 factorial arrangement of treatments using the GLM procedure in SAS. There was no significant diet × atherogenic index interaction identified for any gene (P>0.05). Upregulation was observed for PPARγ, fatty acid synthase (FASN), and fatty acid binding protein 4 (FABP4) in FO-finished compared with CO-finished heifers in both atherogenic index categories (P<0.05). Upregulation of diglyceride acyl transferase 2 (DGAT2) was observed in FO-finished heifers with a HAI (P<0.05). Expression of steroyl Co-A desaturase (SCD) was upregulated in CO-finished heifers with a LAI, and downregulated in FO-finished heifers with a HAI (P<0.05). Expression of adiponectin (ADIPOQ) was significantly downregulated in CO-finished heifers with a HAI compared with all other categories (P<0.05). The genes identified in this study which exhibit

NOVEL REACTOR DESIGN FOR BIODIESEL PRODUCTION

EPA Science Inventory

The goal of this project is to scale-up a novel reactor for producing Biodiesel from alternative feedstocks. Biodiesel is an alternative fuel that can be produced from a wide variety of plant oils, animal oils and waste oils from food processing. The conventional feedstocks fo...

Effects of flaxseed lignan and oil on bone health of breast-tumor-bearing mice treated with or without tamoxifen.

PubMed

Chen, Jianmin; Saggar, Jasdeep K; Ward, Wendy E; Thompson, Lilian U

2011-01-01

Previous studies showed that flaxseed lignan (secoisolariciresinol diglucoside, SDG) and oil (FO) inhibit established breast tumor growth in athymic mice with or without tamoxifen (TAM) treatment. TAM was found to increase bone mineral content (BMC) and density (BMD) in breast cancer patients. It is not known whether SDG or FO alone or combined with TAM affects bone health. Hence, the effects of SDG and FO, alone or in combination, on BMC, BMD, and biomechanical bone strength in ovariectomized athymic mice with established human breast tumors (MCF-7) treated with or without TAM were studied. In a factorial design, mice were divided into four non-TAM and four TAM groups. Each group consisted of mice fed a basal diet (BD), SDG (1 g/kg), FO (38.5 g/kg) or SDG + FO (combination) diets. The TAM group had TAM implants that provide a 5-mg TAM dose released over 60 d. TAM exerted an overall significant effect in increasing BMC, BMD, and biomechanical strength in femurs and lumbar vertebra. Without TAM treatment, SDG produced significant lower femur BMD (6%) while FO produced lower vertebrae BMC (8%) and BMD (6%). With TAM treatment, SDG and FO did not exert an effect on BMC and BMD at the femur or vertebra. SDG and FO produced no marked effect on biomechanical bone strength with or without TAM treatment. In conclusion, FS components did not significantly attenuate the positive effects on bone induced by TAM in this model system, indicating no apparent adverse effects on bone health.

Hydroxyl functionalized polytriazole-co-polyoxadiazole as substrates for forward osmosis membranes.

PubMed

Duong, Phuoc H H; Chisca, Stefan; Hong, Pei-Ying; Cheng, Hong; Nunes, Suzana P; Chung, Tai-Shung

2015-02-25

Hydroxyl functionalized polytriazole-co-polyoxadiazole (PTA-POD) copolymers have been synthesized and cast as promising highly thermally stable, chemically resistant, and antiorganic/biological fouling porous substrates for the fabrication of thin-film composite (TFC) forward osmosis (FO) membranes. The roles of PTA/POD ratios in the membrane substrates, TFC layers, and FO membrane performance have been investigated. This study demonstrates that the substrate fabricated from the copolymer containing 40 mol % PTA is optimal for the TFC membranes. Compared to the POD-TFC membrane, the 40 mol % PTA-TFC membrane exhibits a remarkable decrease in structural parameter (S) of more than 3.3 times. In addition, the 40 mol % PTA-TFC membrane is characterized by high water fluxes of 24.9 LMH and 47.2 LMH using 1 M NaCl as the draw solution and DI water as the feed under FO and pressure retarded osmosis (PRO) modes, respectively. Compared to a polysulfone (PSU) supported TFC-FO membrane under similar fabrication conditions, the 40% mol PTA-TFC membrane shows better FO performance and enhanced antifouling properties on the support (lower protein binding propensity and improved bacterial inhibition). Moreover, the performance of the 40 mol % PTA supported TFC-FO membrane can be improved to 37.5 LMH (FO mode)/78.4 LMH (PRO mode) and potentially higher by optimizing the support morphology, the TFC formation, and the post-treatment process. Hence, the use of newly developed hydroxyl functionalized polytriazole-co-polyoxadiazole copolymers may open up a new class of material for FO processes.

Application of volume-retarded osmosis and low-pressure membrane hybrid process for water reclamation.

PubMed

Im, Sung-Ju; Choi, Jungwon; Lee, Jung-Gil; Jeong, Sanghyun; Jang, Am

2018-03-01

A new concept of volume-retarded osmosis and low-pressure membrane (VRO-LPM) hybrid process was developed and evaluated for the first time in this study. Commercially available forward osmosis (FO) and ultrafiltration (UF) membranes were employed in a VRO-LPM hybrid process to overcome energy limitations of draw solution (DS) regeneration and production of permeate in the FO process. To evaluate its feasibility as a water reclamation process, and to optimize the operational conditions, cross-flow FO and dead-end mode UF processes were individually evaluated. For the FO process, a DS concentration of 0.15 g mL -1 of polysulfonate styrene (PSS) was determined to be optimal, having a high flux with a low reverse salt flux. The UF membrane with a molecular weight cut-off of 1 kDa was chosen for its high PSS rejection in the LPM process. As a single process, UF (LPM) exhibited a higher flux than FO, but this could be controlled by adjusting the effective membrane area of the FO and UF membranes in the VRO-LPM system. The VRO-LPM hybrid process only required a circulation pump for the FO process. This led to a decrease in the specific energy consumption of the VRO-LPM process for potable water production, that was similar to the single FO process. Therefore, the newly developed VRO-LPM hybrid process, with an appropriate DS selection, can be used as an energy efficient water production method, and can outperform conventional water reclamation processes. Copyright © 2017 Elsevier Ltd. All rights reserved.

Leg lengthening and femoral-offset reduction after total hip arthroplasty: where is the problem - stem or cup positioning?

PubMed

Al-Amiry, Bariq; Mahmood, Sarwar; Krupic, Ferid; Sayed-Noor, Arkan

2017-09-01

Background Restoration of femoral offset (FO) and leg length is an important goal in total hip arthroplasty (THA) as it improves functional outcome. Purpose To analyze whether the problem of postoperative leg lengthening and FO reduction is related to the femoral stem or acetabular cup positioning or both. Material and Methods Between September 2010 and April 2013, 172 patients with unilateral primary osteoarthritis treated with THA were included. Postoperative leg-length discrepancy (LLD) and global FO (summation of cup and FO) were measured by two observers using a standardized protocol for evaluation of antero-posterior plain hip radiographs. Patients with postoperative leg lengthening ≥10 mm (n = 41) or with reduced global FO >5 mm (n = 58) were further studied by comparing the stem and cup length of the operated side with the contralateral side in the lengthening group, and by comparing the stem and cup offset of the operated side with the contralateral side in the FO reduction group. We evaluated also the inter-observer and intra-observer reliability of the radiological measurements. Results Both observers found that leg lengthening was related to the stem positioning while FO reduction was related to the positioning of both the femoral stem and acetabular cup. Both inter-observer reliability and intra-observer reproducibility were moderate to excellent (intra-class correlation co-efficient, ICC ≥0.69). Conclusion Post THA leg lengthening was mainly caused by improper femoral stem positioning while global FO reduction resulted from improper positioning of both the femoral stem and the acetabular cup.

Modeling the Time-dependent Changes in Electrical Conductivity of Basaltic Melts With Redox State

NASA Astrophysics Data System (ADS)

Pommier, A.; Gaillard, F.; Pichavant, M.

2008-12-01

The electrical conductivity σ is an efficient probe of mass transfer processes within silicate melts and magmas. Little attention has been given to the influence of redox state (fO2) on the melts conductivity. We present an experimental setup allowing electrical conductivity measurements for basaltic melts under variable fO2. We demonstrate a significant dependence of σ with fO2, allowing to characterize in situ the mechanisms and kinetics of redox changes in the melt. Experiments were conducted on basalts from Pu'u 'O'o, Hawaii, and Mt.Vesuvius, Italy. Measurements were performed cylindrical glass samples (OD: 6mm, ID: 1mm, L: 8mm) using an impedance spectrometer. Experiments were conducted in a 1atm vertical furnace, from 1200°C to 1400°C. Variable gas atmosphere (air, CO2 or CO-CO2 gas mixtures) were used, imposing ΔNNO from -1 to +7. Electrical conductivities were determined for the two melts at constant fO2, different T (constant fO2) and constant T, different fO2 (variable fO2) obtained by changing the gas composition. Isothermal reduction and oxidation cycles were performed. Glasses quenched from different T and fO2 conditions were analyzed by electron microprobe, the FeO concentration was determined by wet chemistry. In constant fO2 experiments, a small but detectable effect of fO2 on σ is evidenced. At 1300°C, the difference in the Kilauea sample conductivity between reduced (ΔNNO=-1) and oxidized (ΔNNO=+7) fO2 is <1(ohm.m)-1, the sample being more conductive when reduced. The temperature dependence of σ was fitted using Arrhenian equations, the activation energy Ea being 100kJ/mol. Sodium was identified as the main charge carrier in the melts. The fO2-effect on σ can thus be attributed to the influence of the Fe2+/Fe3+ ratio on sodium mobility. The fO2-dependence of σ was included in the model of Pommier et al.(2008), allowing the conductivity of natural melts to be calculated as a function of T, P, H2O, and fO2. Variable fO2 experiments

The OptiMUM-study: EMDR therapy in pregnant women with posttraumatic stress disorder after previous childbirth and pregnant women with fear of childbirth: design of a multicentre randomized controlled trial

PubMed Central

Baas, M. A. M.; Stramrood, C. A. I.; Dijksman, L. M.; de Jongh, A.; van Pampus, M. G.

2017-01-01

ABSTRACT Background: Approximately 3% of women develop posttraumatic stress disorder (PTSD) after giving birth, and 7.5% of pregnant women show a pathological fear of childbirth (FoC). FoC or childbirth-related PTSD during (a subsequent) pregnancy can lead to a request for an elective caesarean section as well as adverse obstetrical and neonatal outcomes. For PTSD in general, and several subtypes of specific phobia, eye movement desensitization and reprocessing (EMDR) therapy has been proven effective, but little is known about the effects of applying EMDR during pregnancy. Objective: To describe the protocol of the OptiMUM-study. The main aim of the study is to determine whether EMDR therapy is an effective and safe treatment for pregnant women with childbirth-related PTSD or FoC. In addition, the cost-effectiveness of this approach will be analysed. Method: The single-blind OptiMUM-study consists of two two-armed randomized controlled trials (RCTs) with overlapping design. In several hospitals and community midwifery practices in Amsterdam, the Netherlands, all eligible pregnant women with a gestational age between eight and 20 weeks will be administered the Wijma delivery expectations questionnaire (WDEQ) to asses FoC. Multiparous women will also receive the PTSD checklist for DSM-5 (PCL-5) to screen for possible PTSD. The clinician administered PTSD scale (CAPS-5) will be used for assessing PTSD according to DSM-5 in women scoring above the PCL-5 cut-off value. Fifty women with childbirth-related PTSD and 120 women with FoC will be randomly allocated to either EMDR therapy carried out by a psychologist or care-as-usual. Women currently undergoing psychological treatment or women younger than 18 years will not be included. Primary outcome measures are severity of childbirth-related PTSD or FoC symptoms. Secondary outcomes are percentage of PTSD diagnoses, percentage caesarean sections, subjective childbirth experience, obstetrical and neonatal complications

Can Chlorine Anion Catalyze the Reaction fo HOCl with HCl?

NASA Technical Reports Server (NTRS)

Richardson, S. L.; Francisco, J. S.; Mebel, A. M.; Morokuma, K.

1997-01-01

The reaction of HOCl + HCl -> Cl2 + H20 in the presence of Cl has been studied using ab initio methods. This reaction has been shown to have a high activation barrier of 46.5 kcal/mol. The chlorine anion, Cl- is found to catalyze the reaction, viz. two mechanisms. The first involves Cl- interacting through the concerted four-center transition state of the neutral reaction. The other mechanism involves the formation of a HCl-HOCl-Cl- intermediate which dissociates into Cl2 + Cl- + H20. The steps are found to have no barriers. The overall exothermicity is 15.5 kcal/mol.

Toxicological characterization of a novel wastewater treatment process using EDTA-Na2Zn as draw solution (DS) for the efficient treatment of MBR-treated landfill leachate.

PubMed

Niu, Aping; Ren, Yi-Wei; Yang, Li; Xie, Shao-Lin; Jia, Pan-Pan; Zhang, Jing-Hui; Wang, Xiao; Li, Jing; Pei, De-Sheng

2016-07-01

Landfill leachate has become an important source of environmental pollution in past decades, due to the increase of waste volume. Acute toxic and genotoxic hazards to organisms can be caused by landfill leachate. Thus, how to efficiently recover water from landfill leachate and effectively eliminate combined toxicity of landfill leachate are the most pressing issues in waste management. In this study, EDTA-Na2Zn as draw solution (DS) was used to remove the toxicity of membrane bioreactor-treated landfill leachate (MBR-treated landfill leachate) in forward osmosis (FO) process, and nanofiltration (NF) was designed for recovering the diluted DS. Zebrafish and human cells were used for toxicity assay after the novel wastewater treatment process using EDTA-Na2Zn as DS. Results showed that the water recovery rate of MBR-treated landfill leachate (M-LL) in FO membrane system could achieve 66.5% and 71.2% in the PRO and FO mode respectively, and the diluted DS could be efficiently recovered by NF. Toxicity tests performed by using zebrafish and human cells showed that M-LL treated by EDTA-Na2Zn had no toxicity effect on zebrafish larvae and human cells, but it had very slight effect on zebrafish embryos. In conclusion, all results indicated that EDTA-Na2Zn as DS can effectively eliminate toxicity of landfill leachate and this method is economical and eco-friendly for treatment of different types of landfill leachate. Copyright © 2016 Elsevier Ltd. All rights reserved.

Treatment of real effluents from the pharmaceutical industry: A comparison between Fenton oxidation and conductive-diamond electro-oxidation.

PubMed

Pérez, J F; Llanos, J; Sáez, C; López, C; Cañizares, P; Rodrigo, M A

2017-06-15

Wastewater produced in pharmaceutical manufacturing plants (PMPs), especially the one coming from organic-synthesis facilities, is characterized by its large variability due to the wide range of solvents and chemical reagents used in the different stages of the production of medicines. Normally, the toxicity of the organic compounds prevent the utilization of biological processes and more powerful treatments are needed becoming advanced oxidation processes (AOPs) a valid alternative. In this work, the efficiency in abatement of pollution by Fenton oxidation (FO) and conductive-diamond electro-oxidation (CDEO) are compared in the treatment of 60 real effluents coming from different processes carried out in a pharmaceutical facility, using standardized tests. In 80% of the samples, CDEO was found to be more efficient than FO and in the remaining 20%, coagulation was found to exhibit a great significance in the COD abatement mechanism during FO, pointing out the effectiveness of the oxidation promoted by the electrochemical technology. Mean oxidation state of carbon was found to be a relevant parameter to understand the behavior of the oxidation technologies. It varied inversely proportional to efficiency in FO and it showed practically no influence in the case of CDEO. Copyright © 2016 Elsevier Ltd. All rights reserved.

Treatment of greywater by forward osmosis technology: role of the operating temperature.

PubMed

Wang, Ce; Li, Yongmei; Wang, Yanqiang

2018-06-04

Effects of operating conditions were investigated in terms of water flux, reverse salt flux (RSF) and pollutant rejection in a forward osmosis (FO) membrane system treating synthetic greywater. Changing cross-flow velocity had a slight impact on the performance of the FO membrane. Elevating operating temperature was more effective than increasing draw solution concentration to enhance the water flux. Further observation on the effect of heating mode showed that when the temperature was increased from 20 to 30°C, heating the feed solution (FS) side was better than heating the draw solution (DS) side or heating both sides; further increasing the temperature to 40 and 50°C, heating both the FS and DS achieved much higher water flux compared with only increasing the FS or DS temperature. Under isothermal conditions, a higher water flux and a lower RSF were achieved at 40°C than at other temperatures. Changing either FS or DS temperature had similar influences on water flux and RSF. The FO process revealed high rejection of nitrate (95.7%-100%), ammonia nitrogen (98.8%-100%), total nitrogen (97.4%-99.9%), linear alkylbenzene sulfonate (100%) and Mg (97.5%-100%). A mathematical model that could well simulate the water flux evolution in the present FO system was recommended.

Effect of the vertical position of the canine on the frictional/orthodontic force ratio of Ni-Ti archwires during the levelling phase of orthodontic treatment.

PubMed

Kato, Moeko; Namura, Yasuhiro; Yoneyama, Takayuki; Shimizu, Noriyoshi

2018-05-31

This study investigated the effect of the vertical position of the canine on changes in the frictional/orthodontic (F/O) force ratio of nickel-titanium (Ni-Ti) archwires during the initial levelling phase of orthodontic treatment. Frictional and orthodontic forces were measured by using low-friction brackets and Ni-Ti archwires with three different cross-sectional sizes and force types. To simulate canine malocclusion (first premolar extraction case), the upper right canine was displaced gingivally by 1 to 3 mm and the inter-bracket distance between the upper right lateral incisor and second premolar was set at 15 mm or 20 mm. A three-point bending test was performed to measure the orthodontic force of each Ni-Ti archwire. Frictional forces were measured with a universal testing machine and dental arch models by pulling parallel to the end of the archwire at a crosshead speed of 0.5 mm/min. F/O force ratio was calculated and analysed statistically. At a displacement of 3 mm, few archwires had F/O force ratios of less than 1.0, at which orthodontic force overcame frictional force, thus ensuring extrusion of the canine. For effective tooth movement, orthodontists should use Ni-Ti archwires with an F/O force ratio of less than 1.0.

Fear of progression in chronic diseases: psychometric properties of the Fear of Progression Questionnaire.

PubMed

Herschbach, Peter; Berg, Petra; Dankert, Andrea; Duran, Gabriele; Engst-Hastreiter, Ursula; Waadt, Sabine; Keller, Monika; Ukat, Robert; Henrich, Gerhard

2005-06-01

The aim of this study was the development and psychometric testing of a new psychological questionnaire to measure the fear of progression (FoP) in chronically ill patients (cancer, diabetes mellitus and rheumatic diseases). The Fear of Progression Questionnaire (FoP-Q) was developed in four phases: (1) generation of items (65 interviews); (2) reduction of items--the initial version of the questionnaire (87 items) was presented to 411 patients, to construct subscales and test the reliability; (3) testing the convergent and discriminative validity of the reduced test version (43 items) within a new sample (n=439); (4) translation--German to English. The scale comprised five factors (Cronbach's alpha >.70): affective reactions (13 items), partnership/family (7), occupation (7), loss of autonomy (7) and coping with anxiety (9). The test-retest reliability coefficients varied between .77 and .94. There was only a medium relationship to traditional anxiety scales. This is an indication of the independence of the FoP. Significant relationships between the FoP-Q and the patient's illness behaviour indicate discriminative validity. The FoP-Q is a new and unique questionnaire developed for the chronically ill. A major problem and source of stress for this patient group has been measuring both specifically and economically the FoP of an illness. The FoP-Q was designed to resolve this problem, fulfill this need and reduce this stress.

MR-based field-of-view extension in MR/PET: B0 homogenization using gradient enhancement (HUGE).

PubMed

Blumhagen, Jan O; Ladebeck, Ralf; Fenchel, Matthias; Scheffler, Klaus

2013-10-01

In whole-body MR/PET, the human attenuation correction can be based on the MR data. However, an MR-based field-of-view (FoV) is limited due to physical restrictions such as B0 inhomogeneities and gradient nonlinearities. Therefore, for large patients, the MR image and the attenuation map might be truncated and the attenuation correction might be biased. The aim of this work is to explore extending the MR FoV through B0 homogenization using gradient enhancement in which an optimal readout gradient field is determined to locally compensate B0 inhomogeneities and gradient nonlinearities. A spin-echo-based sequence was developed that computes an optimal gradient for certain regions of interest, for example, the patient's arms. A significant distortion reduction was achieved outside the normal MR-based FoV. This FoV extension was achieved without any hardware modifications. In-plane distortions in a transaxially extended FoV of up to 600 mm were analyzed in phantom studies. In vivo measurements of the patient's arms lying outside the normal specified FoV were compared with and without the use of B0 homogenization using gradient enhancement. In summary, we designed a sequence that provides data for reducing the image distortions due to B0 inhomogeneities and gradient nonlinearities and used the data to extend the MR FoV. Copyright © 2011 Wiley Periodicals, Inc.

Application of a nanofibrous composite membrane to the fertilizer-driven forward osmosis process for irrigation water use.

PubMed

An, Hee-Kyung; Lee, Chang-Gu; Park, Seong-Jik

2017-11-01

In this study, we fabricated a nanofibrous composite (NFC) membrane as a substrate to produce forward osmosis (FO) membranes, and we also assessed the use of liquid fertilizer as a draw solution for the FO process in order to produce agricultural irrigation water. Commercial cellulose triacetate (CTA) and thin-film composite (TFC) FO membranes were included in this study. Under FO tests, the NFC, CTA, and TFC membranes achieved initial osmotic water flux values of 35.31, 6.85, and 3.31 L/m 2 ·h and final osmotic water flux values of 12.62, 6.31, and 3.85 L/m 2  h, respectively. The reason for the high osmotic water flux of the NFC membrane is because its nanofiber layer has low tortuosity, high porosity, and a low thickness, resulting in a reduction in the internal concentration polarization phenomenon. When liquid fertilizer was used as the draw solution, the water flux values in the FO experiments for the NFC, CTA, and TFC membranes were 15.54, 5.46, and 2.54 L/m 2  h. Finally, our results revealed that the FO process using liquid fertilizer as a draw solution can be applied to produce agricultural irrigation water from brackish water and the newly fabricated NFC membrane can be applied to the FO process.

Fish oil and krill oil supplementations differentially regulate lipid catabolic and synthetic pathways in mice

PubMed Central

2014-01-01

Background Marine derived oils are rich in long-chain polyunsaturated omega-3 fatty acids, in particular eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA), which have long been associated with health promoting effects such as reduced plasma lipid levels and anti-inflammatory effects. Krill oil (KO) is a novel marine oil on the market and is also rich in EPA and DHA, but the fatty acids are incorporated mainly into phospholipids (PLs) rather than triacylglycerols (TAG). This study compares the effects of fish oil (FO) and KO on gene regulation that influences plasma and liver lipids in a high fat diet mouse model. Methods Male C57BL/6J mice were fed either a high-fat diet (HF) containing 24% (wt/wt) fat (21.3% lard and 2.3% soy oil), or the HF diet supplemented with FO (15.7% lard, 2.3% soy oil and 5.8% FO) or KO (15.6% lard, 2.3% soy oil and 5.7% KO) for 6 weeks. Total levels of cholesterol, TAG, PLs, and fatty acid composition were measured in plasma and liver. Gene regulation was investigated using quantitative PCR in liver and intestinal epithelium. Results Plasma cholesterol (esterified and unesterified), TAG and PLs were significantly decreased with FO. Analysis of the plasma lipoprotein particles indicated that the lipid lowering effect by FO is at least in part due to decreased very low density lipoprotein (VLDL) content in plasma with subsequent liver lipid accumulation. KO lowered plasma non-esterified fatty acids (NEFA) with a minor effect on fatty acid accumulation in the liver. In spite of a lower omega-3 fatty acid content in the KO supplemented diet, plasma and liver PLs omega-3 levels were similar in the two groups, indicating a higher bioavailability of omega-3 fatty acids from KO. KO more efficiently decreased arachidonic acid and its elongation/desaturation products in plasma and liver. FO mainly increased the expression of several genes involved in fatty acid metabolism, while KO specifically decreased the expression of genes involved in

IR Absorption Coefficients for the Quantification of Water in Hydrous Ringwoodite

NASA Astrophysics Data System (ADS)

Thomas, Sylvia-Monique; Jacobsen, Steven D.; Bina, Craig R.; Smyth, Joseph R.; Frost, Daniel J.

2010-05-01

computed. Our value for pure Mg-ringwoodite is in very good agreement with the value according to Libowitzky & Rossman (1997) and the absorption coefficient proposed by Balan et al. (2008), but is higher than the extrapolated value from Koch-Müller & Rhede (2010). However, in case of the sample with Fo60 composition water content and ɛ-value determined here are in excellent agreement with those calculated by Koch-Müller & Rhede (2010). Here, we will further discuss general IR calibrations and the dependence of ɛ on structure, composition and frequency for the (Mg,Fe)2SiO4 polymorphs in the mantle. We agree with the findings of Koch-Müller & Rhede (2010), which report that using the calibrations according to Paterson (1982) and Libowitzky & Rossman (1997) leads to a water content underestimation in case of Fe-rich (Fay-Fo60) samples. At this point this cannot be generalized for Mg-rich ringwoodite. References Thomas et al. (2009), Phys. Chem. Mineral., 36, 489-509. Libowitzky & Rossman (1997), Am. Mineral., 82, 1111-1115. Koch-Müller & Rhede (2010), Am. Mineral., in press. Paterson (1982), Bull. Mineral. (Paris), 105, 20-29.

Weight-based determination of fluid overload status and mortality in pediatric intensive care unit patients requiring continuous renal replacement therapy

PubMed Central

Selewski, David T.; Cornell, Timothy T.; Lombel, Rebecca M.; Blatt, Neal B.; Han, Yong Y.; Mottes, Theresa; Kommareddi, Mallika; Kershaw, David B.; Shanley, Thomas P.; Heung, Michael

2012-01-01

Purpose In pediatric intensive care unit (PICU) patients, fluid overload (FO) at initiation of continuous renal replacement therapy (CRRT) has been reported to be an independent risk factor for mortality. Previous studies have calculated FO based on daily fluid balance during ICU admission, which is labor intensive and error prone. We hypothesized that a weight-based definition of FO at CRRT initiation would correlate with the fluid balance method and prove predictive of outcome. Methods This is a retrospective single-center review of PICU patients requiring CRRT from July 2006 through February 2010 (n = 113). We compared the degree of FO at CRRT initiation using the standard fluid balance method versus methods based on patient weight changes assessed by both univariate and multivariate analyses. Results The degree of fluid overload at CRRT initiation was significantly greater in nonsurvivors, irrespective of which method was used. The univariate odds ratio for PICU mortality per 1% increase in FO was 1.056 [95% confidence interval (CI) 1.025, 1.087] by the fluid balance method, 1.044 (95% CI 1.019, 1.069) by the weight-based method using PICU admission weight, and 1.045 (95% CI 1.022, 1.07) by the weight-based method using hospital admission weight. On multivariate analyses, all three methods approached significance in predicting PICU survival. Conclusions Our findings suggest that weight-based definitions of FO are useful in defining FO at CRRT initiation and are associated with increased mortality in a broad PICU patient population. This study provides evidence for a more practical weight-based definition of FO that can be used at the bedside. PMID:21533569

Fundamental Frequency of Crying in Two-month-old Boys and Girls: Do Sex Hormones During Mini-puberty Mediate Differences?

PubMed

Borysiak, Anja; Hesse, Volker; Wermke, Peter; Hain, Johannes; Robb, Michael; Wermke, Kathleen

2017-01-01

To evaluate whether the puberty-like sex hormone surge during the first months of life (mini-puberty) affects fundamental frequency (fo) in infant crying as one would derive from hormone influences on voice in adults. Populational prospective study. Twenty healthy normal-hearing infants (nine boys) were recruited for participation. Spontaneously uttered cries were collected from each infant at 8 weeks of age. The cries were acoustically analyzed for mean fo and fo range. The fo properties were correlated to the average serum levels of bioavailable estradiol (E2) (mean E2/sex hormone-binding globulin [SHBG]) and testosterone (T) (mean T/SHBG) across the second month of life. Whereas no significant hormone effect was found for mean fo, a significant negative correlation (r = -0.55) was found between fo range and mean E2/SHBG. No indication for a T influence on fo features was found at this age. Although girls showed a slightly higher mean E2 concentration than boys did, the observed differences in cry fo range were judged to be reflective of an infant's serum concentration of E2 rather than a sex-based difference. In the absence of laryngeal size differences between female and male infants, the result was interpreted as indicative of an E2 influence on viscoelastic properties of the vocal folds. In our opinion, the investigation of young infants' vocalizations during the early postnatal surge of sex steroids (mini-puberty) may advance our understanding of the mechanisms mediating average sex differences in vocal development and early communication. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

Sarcopenia and sarcopenic obesity in Spanish community-dwelling middle-aged and older women: Association with balance confidence, fear of falling and fall risk.

PubMed

Aibar-Almazán, Agustín; Martínez-Amat, Antonio; Cruz-Díaz, David; Jiménez-García, José D; Achalandabaso, Alexander; Sánchez-Montesinos, Indalecio; de la Torre-Cruz, Manuel; Hita-Contreras, Fidel

2018-01-01

To analyze the association of sarcopenia, obesity, and sarcopenic obesity (SO) with fear of falling (FoF) and balance confidence in a Spanish sample of middle-aged and older community-dwelling women. A total of 235 women (69.21±7.56 years) participated in this study. Body composition (bioelectrical impedance analysis), hand-grip strength, and physical performance (gait speed) were evaluated for the diagnosis of sarcopenia, obesity, and SO. Anxiety and depression were measured using the Hospital Anxiety and Depression Scale. The Activities-Specific Balance Confidence Scale (ABC) and the Falls Efficacy Scale-International (FES-I) were employed to assess FoF and balance confidence, respectively. Scores of >26 on the FES-I and <67% on the ABC were used to identify women at risk of falling. The independent associations of sarcopenia, obesity and SO with FoF, balance confidence, and fall risk were evaluated by multivariate linear and logistic regressions, adjusting for potential confounding variables. 27.23% and 18.72% of women presented with sarcopenia and SO, respectively. Gait speed, body mass index (BMI), and fall history were independently associated with ABC score (adjusted-R 2 =0.152) and fall risk (ABC) (adjusted-R 2 =0.115). FES-I score was independently associated (adjusted-R 2 =0.193) with fall history, gait speed, BMI, and depression, which, together with obesity (BMI) and SO, remained independent factors for fall risk measured as FES-I score (adjusted-R 2 =0.243). In community-dwelling middle-aged and older Spanish women, BMI, gait speed, and fall history were independently associated with FoF, balance confidence, and fall risk. Depression was related only to FoF, and, together with obesity (BMI) and SO, was an independent predictor of fall risk as assessed by the FES-I. Copyright © 2017 Elsevier B.V. All rights reserved.

Dietary fish oil delays hypoxic skeletal muscle fatigue and enhances caffeine-stimulated contractile recovery in the rat in vivo hindlimb.

PubMed

Peoples, Gregory E; McLennan, Peter L

2017-06-01

Oxygen efficiency influences skeletal muscle contractile function during physiological hypoxia. Dietary fish oil, providing docosahexaenoic acid (DHA), reduces the oxygen cost of muscle contraction. This study used an autologous perfused rat hindlimb model to examine the effects of a fish oil diet on skeletal muscle fatigue during an acute hypoxic challenge. Male Wistar rats were fed a diet rich in saturated fat (SF), long-chain (LC) n-6 polyunsaturated fatty acids (n-6 PUFA), or LC n-3 PUFA DHA from fish oil (FO) (8 weeks). During anaesthetised and ventilated conditions (normoxia 21% O 2 (SaO 2 -98%) and hypoxia 14% O 2 (SaO 2 -89%)) the hindlimb was perfused at a constant flow and the gastrocnemius-plantaris-soleus muscle bundle was stimulated via sciatic nerve (2 Hz, 6-12V, 0.05 ms) to established fatigue. Caffeine (2.5, 5, 10 mM) was supplied to the contracting muscle bundle via the arterial cannula to assess force recovery. Hypoxia, independent of diet, attenuated maximal twitch tension (normoxia: 82 ± 8; hypoxia: 41 ± 2 g·g -1 tissue w.w.). However, rats fed FO sustained higher peak twitch tension compared with the SF and n-6 PUFA groups (P < 0.05), and the time to decline to 50% of maximum twitch tension was extended (SF: 546 ± 58; n-6 PUFA: 522 ± 58; FO: 792 ± 96 s; P < 0.05). In addition, caffeine-stimulated skeletal muscle contractile recovery was enhanced in the FO-fed animals (SF: 41 ± 3; n-6 PUFA: 40 ± 4; FO: 52 ± 7% recovery; P < 0.05). These results support a physiological role of DHA in skeletal muscle membranes when exposed to low-oxygen stress that is consistent with the attenuation of muscle fatigue under physiologically normoxic conditions.

Modulation format identification enabled by the digital frequency-offset loading technique for hitless coherent transceiver.

PubMed

Fu, Songnian; Xu, Zuying; Lu, Jianing; Jiang, Hexun; Wu, Qiong; Hu, Zhouyi; Tang, Ming; Liu, Deming; Chan, Calvin Chun-Kit

2018-03-19

We propose a blind and fast modulation format identification (MFI) enabled by the digital frequency-offset (FO) loading technique for hitless coherent transceiver. Since modulation format information is encoded to the FO distribution during digital signal processing (DSP) at the transmitter side (Tx), we can use the fast Fourier transformation based FO estimation (FFT-FOE) method to obtain the FO distribution of individual data block after constant modulus algorithm (CMA) pre-equalization at the receiver side, in order to realize non-data-aided (NDA) and fast MFI. The obtained FO can be also used for subsequent FO compensation (FOC), without additional complexity. We numerically investigate and experimentally verify the proposed MFI with high accuracy and fast format switching among 28 Gbaud dual-polarization (DP)-4/8/16/64QAM, time domain hybrid-4/16QAM, and set partitioning (SP)-128QAM. In particular, the proposed MFI brings no performance degradation, in term of tolerance of amplified spontaneous emission (ASE) noise, laser linewidth, and fiber nonlinearity. Finally, a hitless coherent transceiver enabled by the proposed MFI with switching-block of only 2048 symbols is demonstrated over 1500 km standard single mode fiber (SSMF) transmission.

Subunit rotation of ATP synthase embedded in membranes: a or β subunit rotation relative to the c subunit ring

PubMed Central

Nishio, Kazuaki; Iwamoto-Kihara, Atsuko; Yamamoto, Akitsugu; Wada, Yoh; Futai, Masamitsu

2002-01-01

ATP synthase FoF1 (α3β3γδɛab2c10–14) couples an electrochemical proton gradient and a chemical reaction through the rotation of its subunit assembly. In this study, we engineered FoF1 to examine the rotation of the catalytic F1 β or membrane sector Fo a subunit when the Fo c subunit ring was immobilized; a biotin-tag was introduced onto the β or a subunit, and a His-tag onto the c subunit ring. Membrane fragments were obtained from Escherichia coli cells carrying the recombinant plasmid for the engineered FoF1 and were immobilized on a glass surface. An actin filament connected to the β or a subunit rotated counterclockwise on the addition of ATP, and generated essentially the same torque as one connected to the c ring of FoF1 immobilized through a His-tag linked to the α or β subunit. These results established that the γɛc10–14 and α3β3δab2 complexes are mechanical units of the membrane-embedded enzyme involved in rotational catalysis. PMID:12357031

An Implementation Method of the Fractional-Order PID Control System Considering the Memory Constraint and its Application to the Temperature Control of Heat Plate

NASA Astrophysics Data System (ADS)

Sasano, Koji; Okajima, Hiroshi; Matsunaga, Nobutomo

Recently, the fractional order PID (FO-PID) control, which is the extension of the PID control, has been focused on. Even though the FO-PID requires the high-order filter, it is difficult to realize the high-order filter due to the memory limitation of digital computer. For implementation of FO-PID, approximation of the fractional integrator and differentiator are required. Short memory principle (SMP) is one of the effective approximation methods. However, there is a disadvantage that the approximated filter with SMP cannot eliminate the steady-state error. For this problem, we introduce the distributed implementation of the integrator and the dynamic quantizer to make the efficient use of permissible memory. The objective of this study is to clarify how to implement the accurate FO-PID with limited memories. In this paper, we propose the implementation method of FO-PID with memory constraint using dynamic quantizer. And the trade off between approximation of fractional elements and quantized data size are examined so as to close to the ideal FO-PID responses. The effectiveness of proposed method is evaluated by numerical example and experiment in the temperature control of heat plate.

Impact of extra virgin olive oil and ethylenediaminetetraacetic acid (EDTA) on the oxidative stability of fish oil emulsions and spray-dried microcapsules stabilized by sugar beet pectin.

PubMed

Polavarapu, Sudheera; Oliver, Christine M; Ajlouni, Said; Augustin, Mary Ann

2012-01-11

The influence of EDTA on lipid oxidation in sugar beet pectin-stabilized oil-in-water emulsions (pH 6, 15% oil, wet basis), prepared from fish oil (FO) and fish oil-extra virgin olive oil (FO-EVOO) (1:1 w/w), as well as the spray-dried microcapsules (50% oil, dry basis) prepared from these emulsions, was investigated. Under accelerated conditions (80 °C, 5 bar oxygen pressure) the oxidative stability was significantly (P < 0.05) higher for FO and FO-EVOO formulated with EDTA, in comparison to corresponding emulsions and spray-dried microcapsules formulated without EDTA. The EDTA effect was greater in emulsions than in spray-dried microcapsules, with the greatest protective effect obtained in FO-EVOO emulsions. EDTA enhanced the oxidative stability of the spray-dried microcapsules during ambient storage (~25 °C, a(w) = 0.5), as demonstrated by their lower concentration of headspace volatile oxidation products, propanal and hexanal. These results show that the addition of EDTA is an effective strategy to maximize the oxidative stability of both FO emulsions and spray-dried microcapsules in which sugar beet pectin is used as the encapsulant material.

Statistical mapping of zones of focused groundwater/surface-water exchange using fiber-optic distributed temperature sensing

USGS Publications Warehouse

Mwakanyamale, Kisa; Day-Lewis, Frederick D.; Slater, Lee D.

2013-01-01

Fiber-optic distributed temperature sensing (FO-DTS) increasingly is used to map zones of focused groundwater/surface-water exchange (GWSWE). Previous studies of GWSWE using FO-DTS involved identification of zones of focused GWSWE based on arbitrary cutoffs of FO-DTS time-series statistics (e.g., variance, cross-correlation between temperature and stage, or spectral power). New approaches are needed to extract more quantitative information from large, complex FO-DTS data sets while concurrently providing an assessment of uncertainty associated with mapping zones of focused GSWSE. Toward this end, we present a strategy combining discriminant analysis (DA) and spectral analysis (SA). We demonstrate the approach using field experimental data from a reach of the Columbia River adjacent to the Hanford 300 Area site. Results of the combined SA/DA approach are shown to be superior to previous results from qualitative interpretation of FO-DTS spectra alone.

The association between fear of falling and motor imagery abilities in older community-dwelling individuals.

PubMed

Grenier, Sébastien; Richard-Devantoy, Stéphane; Nadeau, Alexandra; Payette, Marie-Christine; Benyebdri, Fethia; Duhaime, Marie-Michelle B; Gunther, Bruno; Beauchet, Olivier

2018-04-01

We investigated the association between fear of falling (FoF) and motor imagery (MI) abilities in older people. Cross-sectional data from 3552 French older adults were used to conduct a multiple linear regression analysis looking at the association between FoF and MI abilities after controlling for several factors (e.g. gender, age, history of falls). MI abilities were significantly lower in older adults reporting a FoF compared with those without this fear. The presence of lower MI abilities, reflecting deficits in gait control, may explain why older people with a FoF are at higher risk of falling. Copyright © 2018 Elsevier B.V. All rights reserved.

A first screening and risk assessment of pharmaceuticals and additives in personal care products in waste water, sludge, recipient water and sediment from Faroe Islands, Iceland and Greenland.

PubMed

Huber, Sandra; Remberger, Mikael; Kaj, Lennart; Schlabach, Martin; Jörundsdóttir, Hrönn Ó; Vester, Jette; Arnórsson, Mímir; Mortensen, Inge; Schwartson, Richard; Dam, Maria

2016-08-15

A screening of a broad range of pharmaceuticals and additives in personal care products (PPCPs) in sub-arctic locations of the Faroe Islands (FO), Iceland (IS) and Greenland (GL) was conducted. In total 36 pharmaceuticals including some metabolites, and seven additives in personal care products were investigated in influent and effluent waters as well as sludge of waste water treatment plants (WWTPs) and in water and sediment of recipients. Concentrations and distribution patterns for PPCPs discharged via sewage lines (SLs) to the marine environment were assessed. Of the 36 pharmaceuticals or metabolites analysed 33 were found close to or above the limit of detection (LOD) in all or a part of the samples. All of the seven investigated additives in personal care products were detected above the LOD. Some of the analysed PPCPs occurred in every or almost every sample. Among these were diclofenac, ibuprofen, lidocaine, naproxen, metformin, citalopram, venlafaxine, amiloride, furosemide, metoprolol, sodium dodecyl sulphate (SDS) and cetrimonium salt (ATAC-C16). Additionally, the study encompasses ecotoxicological risk assessment of 2/3 of the analysed PPCPs in recipient and diluted effluent waters. For candesartan only a small margin to levels with inacceptable risks was observed in diluted effluent waters at two locations (FO). Chronical risks for aquatic organisms staying and/or living around WWTP effluent pipe-outlets were indicated for 17β-estradiol and estriol in the three countries. Additives in PCPs were found to pose the largest risk to the aquatic environment. The surfactants CAPB and ATAC-C16 were found in concentrations resulting in risk factors up to 375 for CAPB and 165 for ATAC-C16 in recipients for diluted effluents from Iggia, Nuuk (GL) and Torshavn (FO) respectively. These results demonstrates a potentially high ecological risk stemming from discharge of surfactants as used in household and industrial detergents as well as additives in personal care

A Focused Observation Tool Using Dreyfus Stages of Skill Acquisition as an Evaluative Scale.

PubMed

Driver, Richard; Grose, Brian; Serafini, Mario; Cottrell, Scott; Sizemore, Daniel; Vallejo, Manuel

2017-01-01

Focused Observartion (FO) is associated with assessing complex skills and differs from generalized observations and evaluations. We've developed a FO assessing clinical procedural skills using Hubert Dreyfus Stages of Skill Acquisition as descriptive anchors. This study sought to analyze the effectiveness of this measure of skill progression. During week 1 and week 4 of training, FO was performed repetitively on 6 residents during endotracheal intubation. Skill stage ratings were converted to numerical scores. A dependent, paired samples t-test was calculated using total mean score (dependent variable) and an effect size. (Cohen's d) was performed to ascertain the standardized mean difference between observations. A significant improvement in mean scores occurred between Week 1 (AVG 1.2, STDV ± 0.1) and Week 4 (AVG 2.0, STDV ± 0.1) (t= -3.9, p<.05) Calculated Chohen's d indicates that this difference was meaningful. This study demonstrates success in adapting a Focused Observation technique and an innovative evaluative scale based upon Dreyfus stages of skill acquisition.

Fish Oil Contaminated with Persistent Organic Pollutants Reduces Antioxidant Capacity and Induces Oxidative Stress without Affecting Its Capacity to Lower Lipid Concentrations and Systemic Inflammation in Rats.

PubMed

Hong, Mee Young; Lumibao, Jan; Mistry, Prashila; Saleh, Rhonda; Hoh, Eunha

2015-05-01

Numerous studies have investigated the benefits of fish, fish oil, and ω-3 (n-3) polyunsaturated fatty acids against cardiovascular diseases. However, concern surrounding contamination with persistent organic pollutants (POPs) prompts caution in the recommendation to consume fish and fish oil. The present study compared the effects of fish oil contaminated with polychlorinated biphenyls (PCBs) and organochlorine pesticides (OCs) on serum lipid profiles, inflammation, and oxidative stress. Twenty eight-day-old male Sprague-Dawley rats (n = 30) consumed diets of unmodified fish oil (FO) consisting of 15% fat by weight, persistent organic pollutant-contaminated fish oil (POP FO) (PCBs at 2.40 μg/g; OCs at 3.80 μg/g FO), or corn oil (control; CO) for 9 wk. Lipid profiles and C-reactive protein concentrations were assessed. Hepatic gene expression related to lipid metabolism was determined by real time quantitative polymerase chain reaction analysis. After 9 wk of feeding, accumulation of PCBs and OCs in the fat tissue of the POP FO group compared with the other 2 groups was confirmed (P < 0.01). Both fish oil groups showed greater HDL cholesterol (FO 53 ± 5.3 and POP FO 55 ± 7.7 vs. CO 34 ± 2.3 mg/dL), but lower triglycerides (24 ± 2.8 and 22 ± 3.0 vs. 43 ± 5.6 mg/dL), LDL cholesterol (38 ± 14 and 34 ± 9.2 vs. 67 ± 4.4 mg/dL), and C-reactive protein (113 ± 20 and 120 ± 26 vs. 189 ± 22 μg/dL) compared with the CO group (P < 0.05). Gene expression of fatty acid synthase in both fish oil groups was also less than in the CO group (P < 0.05). However, the POP FO group showed greater lipid peroxidation (5.1 ± 0.7 vs. 2.9 ± 0.9 and 2.6 ± 0.6 μM) and less antioxidant capacity (0.08 ± 0.06 vs. 0.5 ± 0.1 and 0.4 ± 0.1 mM) than the CO and FO groups (P < 0.05). These findings indicate that, despite exhibiting benefits on serum lipid concentrations and inflammation, contamination with PCBs and OCs showed significant negative effects on oxidative stress and

Earthquake aftereffects in the Equatorial Ionization Anomaly region under geomagnetic quiet and storm conditions

NASA Astrophysics Data System (ADS)

Gulyaeva, T. L.; Arikan, F.; Stanislawska, I.

2017-07-01

In addition to multi-scale spatio-temporal trends that shape the ionosphere variability, the ionosphere responds to the disturbances that are solar, geomagnetic and seismic in origin. In this study, post-seismic ionospheric disturbances are investigated retrospectively from 1999 to 2015 using two different sets of ionospheric maps of the F2 layer critical frequency, foF2. One set of foF2 maps is obtained by assimilating Global Ionospheric Maps (GIM) of Total Electron Content (TEC) into IRI-Plas model (IRI-Plas-foF2). Another set of hourly foF2 maps is obtained using PRIME-251 mapping technique (PRIME-foF2) by the assimilation of ionosonde foF2 data into IRI-CCIR model. The geomagnetic storms affecting the ionosphere are determined with relevant thresholds of geomagnetic AE, aa, ap, ap(τ) and Dst indices. It is observed that more than 60% of the earthquakes occur in the Equatorial Ionization Anomaly (EIA) region within the belt of geomagnetic latitudes ±40° N and geographic longitudes 90-190° E. The co-seismic foF2 disturbances, DfoF2, are identified for the cells of the map if an instant foF2 value is outside of pre-defined bounds of foF2 median (μ) and standard deviation (σ), μ ± 1σ, in the map fragment of 1000 km radius around the earthquake hypocenter. The results of positive ionospheric disturbances, DfoF2p, and negative disturbances, DfoF2n, in the EIA region during the 12 h after earthquake differ with respect to geomagnetic quiet and storm conditions, nighttime and daytime, magnitude and depth of the earthquake. The maximum spatial variability (for more than 50% of map cells in the vicinity of hypocenter) is observed with positive disturbances (DfoF2p) for the earthquakes that occurred during daytime at a depth of 70-300 km.

Diagnostic performance of focused cardiac ultrasound performed by emergency physicians for the assessment of ascending aorta dilation and aneurysm.

PubMed

Nazerian, Peiman; Vanni, Simone; Morello, Fulvio; Castelli, Matteo; Ottaviani, Maddalena; Casula, Claudia; Petrioli, Alessandra; Bartolucci, Maurizio; Grifoni, Stefano

2015-05-01

The diagnostic performance of transthoracic focused cardiac ultrasound (FoCUS) performed by emergency physicians (EP) to estimate ascending aorta dimensions in the acute setting has not been prospectively studied. The diagnostic accuracy and the interobserver variability of EP-performed FoCUS were investigated to estimate thoracic aortic dilation and aneurysm compared with the results of computed tomography angiography (CTA). This was a prospective single-center cohort study of a convenience sample of patients who underwent CTA in the emergency department for suspected aortic pathology. FoCUS was performed before CTA, and the maximum ascending aorta diameter evaluated in parasternal long-axis view. Aorta diameter < 40 mm by visual estimation or by diameter measurement was considered normal. Measurements were recorded in all patients with aorta diameter ≥ 40 mm. Diagnostic accuracy of FoCUS for detection of aortic dilation (diameter ≥ 40 mm) and aneurysm (diameter ≥ 45 mm) were calculated considering the CTA result as reference standard. In a subgroup of patients, a second EP-sonographer performed FoCUS to evaluate interobserver agreement for the diagnosis of ascending aorta dilation. A total of 140 patients were enrolled in the study. Ascending aorta dilation and aneurysm were detected with FoCUS in 50 (35.7%) and in 27 (17.8%) patients, respectively. Sensitivity and specificity of FoCUS were 78.6% (95% confidence interval [CI] = 65.6% to 88.4%) and 92.9% (95% CI = 85.1% to 97.3%), respectively, for ascending aorta dilation and 64.7% (95% CI = 46.5% to 80.2%) and 95.3% (95% CI = 89.3% to 98.4%), respectively, for ascending aorta aneurysm. Interobserver agreement of FoCUS was k = 0.82. FoCUS performed by EP is specific for ascending aorta dilation and aneurysm when compared to CTA and appears a reproducible technique. © 2015 by the Society for Academic Emergency Medicine.

'I've Changed My Mind', Mindfulness-Based Childbirth and Parenting (MBCP) for pregnant women with a high level of fear of childbirth and their partners: study protocol of the quasi-experimental controlled trial.

PubMed

Veringa, Irena K; de Bruin, Esther I; Bardacke, Nancy; Duncan, Larissa G; van Steensel, Francisca J A; Dirksen, Carmen D; Bögels, Susan M

2016-11-07

Approximately 25 % of pregnant women suffer from a high level of Fear of Childbirth (FoC), as assessed by the Wijma Delivery Expectancy Questionnaire (W-DEQ-A, score ≥66). FoC negatively affects pregnant women's mental health and adaptation to the perinatal period. Mindfulness-Based Childbirth and Parenting (MBCP) seems to be potentially effective in decreasing pregnancy-related anxiety and stress. We propose a theoretical model of Avoidance and Participation in Pregnancy, Birth and the Postpartum Period in order to explore FoC and to evaluate the underlying mechanisms of change of MBCP. The 'I've Changed My Mind' study is a quasi-experimental controlled trial among 128 pregnant women (week 16-26) with a high level of FoC, and their partners. Women will be allocated to MBCP (intervention group) or to Fear of Childbirth Consultation (FoCC; comparison group). Primary outcomes are FoC, labour pain, and willingness to accept obstetrical interventions. Secondary outcomes are anxiety, depression, general stress, parental stress, quality of life, sleep quality, fatigue, satisfaction with childbirth, birth outcome, breastfeeding self-efficacy and cost-effectiveness. The total study duration for women is six months with four assessment waves: pre- and post-intervention, following the birth and closing the maternity leave period. Given the high prevalence and severe negative impact of FoC this study can be of major importance if statistically and clinically meaningful benefits are found. Among the strengths of this study are the clinical-based experimental design, the extensive cognitive-emotional and behavioural measurements in pregnant women and their partners during the entire perinatal period, and the representativeness of study sample as well as generalizability of the study's results. The complex and innovative measurements of FoC in this study are an important strength in clinical research on FoC not only in pregnant women but also in their partners. Dutch Trial

A novel online Food Recall Checklist for use in an undergraduate student population: a comparison with diet diaries

PubMed Central

Comrie, Fiona; Masson, Lindsey F; McNeill, Geraldine

2009-01-01

Background University students are commonly overlooked when diet of populations is measured and there is a lack of comprehensive dietary assessment in whole university student populations. To measure diet of undergraduate students, a new online 121-item Food Recall Checklist (FoRC) was designed as an alternative to a non-weighed record (food diary). This article reports the comparison between the new dietary assessment method (FoRC) and the food diary as a measure of energy (kJ), fat (g), Non-Starch Polysaccharide (NSP) (g), fruit and vegetables (g), breakfast cereal (g) and bread (g) and alcohol (units) intake. Methods Fifty-three students at the University of Aberdeen completed four days of FoRC then four days food diary. Median agreement and correlation between the two methods was assessed for foods and nutrients using the Spearman's rank correlation co-efficient and the Wilcoxon signed ranks test. Agreement between FoRC and food diary was assessed using the Bland-Altman method. Results The mean time taken to complete FoRC for one day was 7.4 minutes. Intakes of fat (g and % food energy), NSP and bread were similar between FoRC and the food diary. Median energy intake was 8185 kJ in the food diary and 8007 kJ in FoRC. However, FoRC recorded significantly lower intakes of energy and alcohol and significantly higher intakes of fruit and vegetables and breakfast cereal compared with the food diary. There was considerable variation in agreement between methods at the individual level. For all variables except alcohol and percentage energy from fat, correlation co-efficients were statistically significant and greater than 0.5. Conclusion At the group level, four days of FoRC showed good median agreement with the food diary and there was high correlation between methods for most foods and nutrients. This suggests that this novel method of assessing diet can provide a useful alternative for assessing group mean intakes but that individual intakes may need to be

Fluid Overload is Associated with Late Poor Outcomes in Neonates Following Cardiac Surgery

PubMed Central

Wilder, Nicole S; Yu, Sunkyung; Donohue, Janet E; Goldberg, Caren S; Blatt, Neal B

2016-01-01

Objective Acute kidney injury (AKI) is a severe complication of cardiac surgery associated with increased morbidity and mortality, yet AKI classification for neonates remains challenging. We characterized patterns of post-operative fluid overload (FO) as a surrogate marker for AKI and as a risk factor of poor post-operative outcomes in neonates undergoing cardiac surgery. Design Retrospective cohort study. Setting Single, congenital heart center destination program. Patients 435 neonates undergoing cardiac surgery with cardiopulmonary bypass from January 2006 through December 2010. Interventions None Measurements and Main Results Demographics, diagnosis, and perioperative clinical variables were collected, including daily weights and serum creatinine (SCr) levels. A composite poor clinical outcome (death, need for renal replacement therapy (RRT), or extracorporeal life support (ECLS) within 30 post-operative days) was considered the primary outcome measure. Twenty-one neonates (5%) had a composite poor outcome with 7 (2%) requiring RRT, 8 (2%) requiring ECLS, and 14 (3%) dying between 3 and 30 days post-surgery. Neonates with a composite poor outcome had significantly higher maximum FO (>20%) and were slower to diurese. A receiver-operating characteristic curve determined that FO ≥ 16% and SCr ≥ 0.9 on post-operative day 3 were the optimal cutoffs for significant discrimination on the primary outcome (area under the curve = 0.71 and 0.76, respectively). In multivariable analysis, FO ≥ 16% (adjusted odds ratio [AOR] = 3.7) and SCr ≥ 0.9 (AOR = 6.6) on post-operative day 3 remained an independent risk factor for poor outcome. FO ≥ 16% was also significantly associated with cardiac arrest requiring cardiopulmonary resuscitation, prolonged intensive care unit stay, and chest re-exploration. Conclusions This study highlights the importance of monitoring fluid balance in the neonatal cardiac surgical population, and suggests that daily FO, a readily

Performance of Solar Proxy Options of IRI-Plas Model for Equinox Seasons

NASA Astrophysics Data System (ADS)

Sezen, Umut; Gulyaeva, Tamara L.; Arikan, Feza

2018-02-01

International Reference Ionosphere (IRI) is the most acclaimed climatic model of the ionosphere. Since 2009, the range of the IRI model has been extended to the Global Positioning System (GPS) orbital height of 20,000 km in the plasmasphere. The new model, which is called IRI extended to Plasmasphere (IRI-Plas), can input not only the ionosonde foF2 and hmF2 but also the GPS-total electron content (TEC). IRI-Plas has been provided at www.ionolab.org, where online computation of ionospheric parameters is accomplished through a user-friendly interface. The solar proxies that are available in IRI-Plas can be listed as sunspot number (SSN1), SSN2, F10.7, global electron content (GEC), TEC, IG, Mg II, Lyman-α, and GEC_RZ. In this study, ionosonde foF2 data are compared with IRI-Plas foF2 values with the Consultative Committee International Radio (CCIR) and International Union of Radio Science (URSI) model choices for each solar proxy, with or without the GPS-TEC input for the equinox months of October 2011 and March 2015. It has been observed that the best fitting model choices in Root Mean Square (RMS) and Normalized RMS (NRMS) sense are the Jet Propulsion Laboratory global ionospheric maps-TEC input with Lyman-α solar proxy option for both months. The input of TEC definitely lowers the difference between the model and ionosonde foF2 values. The IG and Mg II solar proxies produce similar model foF2 values, and they usually are the second and third best fits to the ionosonde foF2 for the midlatitude ionosphere. In high-latitude regions, Jet Propulsion Laboratory global ionospheric map-TEC inputs to IRI-Plas with Lyman-α, GEC_RZ, and TEC solar proxies are the best choices. In equatorial region, the best fitting solar proxies are IG, Lyman-α, and Mg II.

Automatic detection of freezing of gait events in patients with Parkinson's disease.

PubMed

Tripoliti, Evanthia E; Tzallas, Alexandros T; Tsipouras, Markos G; Rigas, George; Bougia, Panagiota; Leontiou, Michael; Konitsiotis, Spiros; Chondrogiorgi, Maria; Tsouli, Sofia; Fotiadis, Dimitrios I

2013-04-01

The aim of this study is to detect freezing of gait (FoG) events in patients suffering from Parkinson's disease (PD) using signals received from wearable sensors (six accelerometers and two gyroscopes) placed on the patients' body. For this purpose, an automated methodology has been developed which consists of four stages. In the first stage, missing values due to signal loss or degradation are replaced and then (second stage) low frequency components of the raw signal are removed. In the third stage, the entropy of the raw signal is calculated. Finally (fourth stage), four classification algorithms have been tested (Naïve Bayes, Random Forests, Decision Trees and Random Tree) in order to detect the FoG events. The methodology has been evaluated using several different configurations of sensors in order to conclude to the set of sensors which can produce optimal FoG episode detection. Signals recorded from five healthy subjects, five patients with PD who presented the symptom of FoG and six patients who suffered from PD but they do not present FoG events. The signals included 93 FoG events with 405.6s total duration. The results indicate that the proposed methodology is able to detect FoG events with 81.94% sensitivity, 98.74% specificity, 96.11% accuracy and 98.6% area under curve (AUC) using the signals from all sensors and the Random Forests classification algorithm. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Fear of Progression in Parents of Children with Cancer: Results of An Online Expert Survey in Pediatric Oncology.

PubMed

Clever, Katharina; Schepper, Florian; Küpper, Luise; Christiansen, Holger; Martini, Julia

2018-04-01

Fear of Progression (FoP) is a commonly reported psychological strain in parents of children with cancer. This expert survey investigates how professionals in pediatric oncology estimate the burden and consequences of FoP in parents and how they assess and treat parental FoP. N=77 professionals in pediatric oncology (members and associates of the Psychosocial Association in Paediatric Oncology and Haematology, PSAPOH) were examined in an online survey with a self-developed questionnaire. Data were analyzed via descriptive statistics and qualitative content analysis. Three of four experts in clinical practice were (very) often confronted with parental FoP which was associated with more negative (e. g., psychosomatic reactions, reduced family functioning) than positive (e. g., active illness processing) consequences. N=40 experts indicated that they mainly assess parents' anxiety via clinical judgment (72.5%) and/or according to ICD-10/DSM-5 diagnostic criteria (37.5%), whereas standardized methods such as psycho-oncological questionnaires (12.5%) were applied less often. Only n=6 experts named a specific diagnostic approach to assess parental FoP. The most common treatment approaches for FoP were supportive counseling (74.0%), psychotherapy (59.7%) and/or relaxation techniques (55.8%). Parental FoP is frequently perceived by experts in clinical practice. A standardized diagnostic procedure would increase comparability of diagnostic judgments and harmonize treatment indications. © Georg Thieme Verlag KG Stuttgart · New York.

Effects of alpha lipoic acid, ascorbic acid-6-palmitate, and fish oil on the glutathione, malonaldehyde, and fatty acids levels in erythrocytes of streptozotocin induced diabetic male rats.

PubMed

Yilmaz, Okkeş; Ozkan, Yusuf; Yildirim, Mehmet; Oztürk, A Ihsan; Erşan, Yasemin

2002-01-01

In this research, it has been aimed to evaluate the improvement effects of alpha lipoic acid (ALA), ascorbic acid-6-palmitate (AA6P), fish oil (FO), and their combination (COM) on some biochemical properties in erythrocytes of streptozotocin (STZ)-induced diabetic male rats. According to experimental results, glutathione (GSH) level in erythrocytes decreased in diabetes (P < 0.01), D + ALA, and D + AA6P groups (P < 0.001). Malonaldehyde (MA) level increased in diabetes (P < 0.05), D + FO, and D + COM groups (P < 0.001), but its level in D + AA6P and D + ALA groups was lower in diabetes group (P < 0.01). Total lipid level in diabetes and diabetes plus antioxidant administered groups were higher than control. Total cholesterol level was high in diabetes and D + ALA groups (P < 0.05), but its level reduced in D + FO compared to control and diabetes groups, P < 0.05, < 0.001, respectively. Total triglyceride (TTG) level was high in the D + ALA (P < 0.05) and D + COM (P < 0.001) groups. In contrast, TTG level in blood of diabetes group was higher than diabetes plus antioxidant and FO administered groups (P < 0.001). According to gas chromatography analysis results, while the palmitic acid raised in diabetes group (P < 0.05), stearic acid in D + FO, D + ALA, and diabetes groups was lower than control (P < 0.05), oleic acid reduced in D + COM and D + FO groups, but its level raised in D + AA6P and D + ALA groups (P < 0.01). As the linoleic acid (LA) elevated in ALA + D, D + AA6P, and diabetes groups, linolenic acid level in diabetes, D + AA6P, and D + FO groups was lower than control (P < 0.001). Arachidonic acid (AA) decreased in D + ALA, D+ AA6P, and diabetes groups (P < 0.01), but its level in D + COM and D + FO was higher than control (P < 0.05). Docosahexaenoic acid (DHA) increased in D + AA6P and D + COM (P < 0.05). While the total saturated fatty acid level raised in diabetes group, its level reduced in D + ALA and D + FO groups (P < 0.05). In contrast, total

Changes in Quality Characteristics of Pork Patties Containing Multilayered Fish Oil Emulsion during Refrigerated Storage

PubMed Central

Jo, Yeon-Ji; Kwon, Yun-Joong; Min, Sang-Gi

2015-01-01

This study was performed to determine the effect of multilayered fish oil (FO) emulsion without or with trans-cinnamaldehyde on pork patties. Multilayered FO (-primary, -secondary, -tertiary) emulsions were prepared using a layer-by-layer deposition technique with Tween 20, chitosan, and low methoxyl pectin, and were added to pork patties at the same concentration. Pork patties were then stored for 20 d in a refrigerator (5℃) to study changes in quality. The results showed that the pH value of all samples significantly decreased but cooking loss increased during storage (p<0.05). However, water-holding capacity and moisture content showed no remarkable difference between treatments and storage periods (p>0.05). All pork patties containing multilayered FO (treated samples) showed higher values for lightness and significantly lower values for yellowness compared to control pork patties (untreated sample). Lipid oxidation was higher in treated pork patties than in control pork patties during storage. In addition, lipid oxidation and total viable bacterial count in pork patties decreased as the number of coating layers increased. However, hardness, cohesiveness, and springiness of all samples showed no significant change during storage (p>0.05) as compared to fresh pork patties. Furthermore, these did not remarkable change with addition of trans-cinnamaldehyde in all pork patties. From our results, we suggest that FO emulsion did not affect the texture characteristics of fresh pork patties, indicating that it could be used to improve the quality of pork patties by contributing high-quality fat such as unsaturated fatty acids. PMID:26761802

Wave behaviour of sporadic E-layer variations at the latitudes 30-70N

NASA Astrophysics Data System (ADS)

Ryabchenko, E. Yu.; Sherstyukov, O. N.

A wave behaviour of sporadic E-layer variations was investigated by analysing time series of twenty European ionosonde stations (30°N--80°N, 15°W--45°E) for 1985-1988. Wavelet transform was used to explore 3-30 periodicities in variations of Es-layer relative electron density δ NEs defined here as (foEs2--foE2)/foE2. Such compound parameter allowed us to partly exclude solar ionisation factor and concentrate on meteorological nature of Es-layer synoptical oscillations. A typical synoptical atmospheric 3-30 day oscillations were discovered in foEs and also in δ NEs. Due to nonorthgonal wavelet transform used in this work, it is advisable to divide frequency domain into several optimal intervals. Five periods 4,6,10,16 and 24 day were chosen which cover 3-5, 5-7, 8-12, 13-20 and 20-30 day intervals. Low value of oscillation amplitude not greater than 1.5 is typical for most of European ionospheric stations in January-March and September-December. A higher values were observed at latitudes higher than 60°N. A wave vortex were discovered during the analysis of dynamics of δ NEs spatio-temporal variations in summer for each period interval. In May and June we observed wave penetration from north and south into the middle latitudes 45°N--55°N with amplitudes up to 5.0 for the most of considered years. In Jule and August all amplitudes reach their average values.

A Figure-of-Merit for Design and Optimization of Inductive Power Transmission Links for Millimeter-Sized Biomedical Implants.

PubMed

Ibrahim, Ahmed; Kiani, Mehdi

2016-12-01

Power transmission efficiency (PTE) has been the key parameter for wireless power transmission (WPT) to biomedical implants with millimeter (mm) dimensions. It has been suggested that for mm-sized implants increasing the power carrier frequency (f p ) of the WPT link to hundreds of MHz improves PTE. However, increasing f p significantly reduces the maximum allowable power that can be transmitted under the specific absorption rate (SAR) constraints. This paper presents a new figure-of-merit (FoM) and a design methodology for optimal WPT to mm-sized implants via inductive coupling by striking a balance between PTE and maximum delivered power under SAR constraints (P L,SAR ). First, the optimal mm-sized receiver (Rx) coil geometry is identified for a wide range of f p to maximize the Rx coil quality factor (Q). Secondly, the optimal transmitter (Tx) coil geometry and f p are found to maximize the proposed FoM under a low-loss Rx matched-load condition. Finally, proper Tx coil and tissue spacing is identified based on FoM at the optimal f p . We demonstrate that f p in order of tens of MHz still offer higher P L,SAR and FoM, which is key in applications that demand high power such as optogenetics. An inductive link to power a 1 mm 3 implant was designed based on our FoM and verified through full-wave electromagnetic field simulations and measurements using de-embedding method. In our measurements, an Rx coil with 1 mm diameter, located 10 mm inside the tissue, achieved PTE and P L,SAR of 1.4% and 2.2 mW at f p of 20 MHz, respectively.

The effects of surface-charged submicron polystyrene particles on the structure and performance of PSF forward osmosis membrane

NASA Astrophysics Data System (ADS)

Zuo, Hao-Ran; Fu, Jia-Bei; Cao, Gui-Ping; Hu, Nian; Lu, Hui; Liu, Hui-Qing; Chen, Peng-Peng; Yu, Jie

2018-04-01

Monodisperse surface-charged submicron polystyrene particles were designed, synthesized, and blended into polysulfone (PSF) support layer to prepare forward osmosis (FO) membrane with high performance. The membrane incorporated with particles were characterized with respect to morphology, porosity, and internal osmotic pressure (IOP). Results showed that the polymer particles not only increased the hydrophilicity and porosity of support layer, but also generated considerable IOP, which helped markedly decreasing the structure parameter from 1550 to 670 μm. The measured mass transfer parameters further confirmed the beneficial effects of the surface-charged submicron polymer particles on the performance of FO membrane. For instance, the water permeability coefficient (5.37 L m-2 h-1 bar-1) and water flux (49.7 L m-2 h-1) of the FO membrane incorporated with 5 wt% particles were almost twice as much as that of FO membrane without incorporation. This study suggests that monodisperse surface-charged submicron polymer particles are potential modifiers for improving the performance of FO membranes.

Microalgae dewatering based on forward osmosis employing proton exchange membrane.

PubMed

Son, Jieun; Sung, Mina; Ryu, Hoyoung; Oh, You-Kwan; Han, Jong-In

2017-11-01

In this study, electrically-facilitated forward osmosis (FO) employing proton exchange membrane (PEM) was established for the purpose of microalgae dewatering. An increase in water flux was observed when an external voltage was applied to the FO equipped with the PEM; as expected, the trend became more dramatic with both concentration of draw solution and applied voltage raised. With this FO used for microalgae dewatering, 247% of increase in flux and 86% in final biomass concentration were observed. In addition to the effect on flux improvement, the electrically-facilitated FO exhibited the ability to remove chlorophyll from the dewatered biomass, down to 0.021±0015mg/g cell. All these suggest that the newly suggested electrically-facilitated FO, one particularly employed PEM, can indeed offer a workable way of dewatering of microalgae; it appeared to be so because it can also remove the ever-problematic chlorophyll from extracted lipids in a simultaneous fashion. Copyright © 2017 Elsevier Ltd. All rights reserved.

Enhanced Production of Two Bioactive Isoflavone Aglycones in Astragalus membranaceus Hairy Root Cultures by Combining Deglycosylation and Elicitation of Immobilized Edible Aspergillus niger.

PubMed

Jiao, Jiao; Gai, Qing-Yan; Niu, Li-Li; Wang, Xi-Qing; Guo, Na; Zang, Yu-Ping; Fu, Yu-Jie

2017-10-18

A cocultivation system of Astragalus membranaceus hairy root cultures (AMHRCs) and immobilized food-grade fungi was established for the enhanced production of calycosin (CA) and formononetin (FO). The highest accumulations of CA (730.88 ± 63.72 μg/g DW) and FO (1119.42 ± 95.85 μg/g DW) were achieved in 34 day-old AMHRCs cocultured with immobilized A. niger (IAN) for 54 h, which were 7.72- and 18.78-fold higher than CA and FO in nontreated control, respectively. IAN deglycosylation could promote the formation of CA and FO by conversion of their glycoside precursors. IAN elicitation could intensify the generation of endogenous signal molecules involved in plant defense response, which contributed to the significantly up-regulated expression of genes in CA and FO biosynthetic pathway. Overall, the coupled culture of IAN and AMHRCs offered a promising and effective in vitro approach to enhance the production of two health-promoting isoflavone aglycones for possible nutraceutical and pharmaceutical uses.

Effect of fructo-oligosaccharide and isomalto-oligosaccharide addition on baking quality of frozen dough.

PubMed

Park, Eun Young; Jang, Sung-Bum; Lim, Seung-Taik

2016-12-15

The baking quality of frozen doughs containing different levels of fructo-oligosaccharides (FO) or isomalto-oligosaccharides (IMO) (3-9%, w/w flour), and stored for 0-8weeks at -18°C, was examined. The addition of FO or IMO increased the proof volume of the dough and the loaf volume of bread prepared from frozen dough. A 6% addition of FO or IMO was optimum, giving the highest proof volume and bread loaf volume, but a higher concentration than 6% induced low baking quality including lower proof volume and bread loaf volume. The bread crumb was moister and softer after the addition of FO or IMO before, and even after, frozen storage. Darker crumb colour was observed in the bread after the addition of FO or IMO. The oligosaccharides added to the frozen dough were effective in improving the quality of bread made from frozen dough, except for resulting in a darker bread crumb. Copyright © 2016. Published by Elsevier Ltd.

A Simple Algorithm to Predict Falls in Primary Care Patients Aged 65 to 74 Years: The International Mobility in Aging Study.

PubMed

Gomez, Fernando; Wu, Yan Yan; Auais, Mohammad; Vafaei, Afshin; Zunzunegui, Maria-Victoria

2017-09-01

Primary care practitioners need simple algorithms to identify older adults at higher risks of falling. Classification and regression tree (CaRT) analyses are useful tools for identification of clinical predictors of falls. Prospective cohort. Community-dwelling older adults at 5 diverse sites: Tirana (Albania), Natal (Brazil), Manizales (Colombia), Kingston (Ontario, Canada), and Saint-Hyacinthe (Quebec, Canada). In 2012, 2002 participants aged 65-74 years from 5 international sites were assessed in the International Mobility in Aging Study. In 2014 follow-up, 86% of the participants (n = 1718) were reassessed. These risk factors for the occurrence of falls in 2014 were selected based on relevant literature and were entered into the CaRT as measured at baseline in 2012: age, sex, body mass index, multimorbidity, cognitive deficit, depression, number of falls in the past 12 months, fear of falling (FoF) categories, and timed chair-rises, balance, and gait. The 1-year prevalence of falls in 2014 was 26.9%. CaRT procedure identified 3 subgroups based on reported number of falls in 2012 (none, 1, ≥2). The 2014 prevalence of falls in these 3 subgroups was 20%, 30%, and 50%, respectively. The "no fall" subgroup was split using FoF: 30% of the high FoF category (score >27) vs 20% of low and moderate FoF categories (scores: 16-27) experienced a fall in 2014. Those with multiple falls were split by their speed in the chair-rise test: 56% of the slow category (>16.7 seconds) and the fast category (<11.2 seconds) had falls vs 28% in the intermediate group (between 11.2 and 16.7 seconds). No additional variables entered into the decision tree. Three simple indicators: FoF, number of previous falls, and time of chair rise could identify those with more than 50% probability of falling. Copyright © 2017 AMDA – The Society for Post-Acute and Long-Term Care Medicine. Published by Elsevier Inc. All rights reserved.

Fiber Optic Rosette Strain Gauge Development and Application on a Large-Scale Composite Structure

NASA Technical Reports Server (NTRS)

Moore, Jason P.; Przekop, Adam; Juarez, Peter D.; Roth, Mark C.

2015-01-01

A detailed description of the construction, application, and measurement of 196 FO rosette strain gauges that measured multi-axis strain across the outside upper surface of the forward bulkhead component of a multibay composite fuselage test article is presented. A background of the FO strain gauge and the FO measurement system as utilized in this application is given and results for the higher load cases of the testing sequence are shown.

Fructo-oligosaccharide attenuates the production of pro-inflammatory cytokines and the activation of JNK/Jun pathway in the lungs of D-galactose-treated Balb/cJ mice.

PubMed

Yeh, Shu-Lan; Wu, Tzu-Chin; Chan, Shu-Ting; Hong, Meng-Jun; Chen, Hsiao-Ling

2014-01-01

This study determined the effects of long-term D-galactose (DG) injection on the lung pro-inflammatory and fibrotic status and whether fructo-oligosaccharide (FO) could attenuate such effects. Forty Balb/cJ mice (12 weeks of age) were divided into four groups: control (s.c. saline) (basal diet), DG (s.c. 1.2 g DG/kg body weight) (basal diet), DG + FO (FO diet, 2.5% w/w FO), and DG + E (vitamin E diet, α-tocopherol 0.2% w/w) serving as an antioxidant control group. These animals were killed after 49 day of treatments. Another group of naturally aging (NA) mice without any injection was killed at 64 weeks of age to be an aging control group. D-galactose treatment, generally similar to NA, increased the lung pro-inflammatory status, as shown in the IL-6 and IL-1β levels and the expression of phospho-Jun and phospho-JNK, and the fibrotic status as shown in the hydroxyproline level compared to the vehicle. FO diminished the DG-induced increases in the lung IL-1β level and expressions of total Jun, phospho-JNK, and attenuated DG effects on lung IL-6 and hydroxyproline, while α-tocopherol exerted anti-inflammatory effects on all parameters determined. FO, as well as α-tocopherol, modulated the large bowel ecology by increasing the fecal bifidobacteria and cecal butyrate levels compared with DG. D-galactose treatment mimicked the lung pro-inflammatory status as shown in the NA mice. FO attenuated the DG-induced lung pro-inflammatory status and down-regulated JNK/Jun pathway in the lung, which could be mediated by the prebiotic effects and metabolic products of FO in the large intestine.

[Fear of progression in parents of children with cancer: adaptation of the Fear of Progression Questionnaire and correlates].

PubMed

Schepper, F; Abel, K; Herschbach, P; Christiansen, H; Mehnert, A; Martini, J

2015-05-01

Fear of Progression (FoP), the fear of further disease progression, is one of the most common psychological strains of chronically ill patients and can also be found in healthy partners of cancer patients. Parents of children with cancer are also at risk of developing distinct fears that may persist after medical treatment. This study aimed to assess FoP in parents of children with cancer and to investigate relationships between FoP in parents of children with cancer and disease- and treatment-related issues, the child's current medical condition and parents' quality of life. In this study 76 parents (51 mothers, 25 fathers) whose children were in inpatient treatment or follow-up care were surveyed. The short form of the FoP Questionnaire was adapted by rephrasing the items for the parental perspective (FoP-Q-SF/PR). The FoP-Q-SF/PR is a short questionnaire with adequate psychometric properties (e. g. Cronbach's α=0.90) and satisfying results in terms of construct validity. Significant correlations with FoP are found for the child's current medical condition (r=0.35), time since diagnosis (r=- 0.30), parents' capacity to cope with disease-related fears (r=- 0.45) and parents' quality of life (r=- 0.55). A cut-off value of 46 points is recommended. The FoP-Q-SF/PR offers a feasible and sensitive battery to assess disease-related fears. For clinicians, evaluation of individual results can provide insight into specific problem areas for parents of children with cancer. The questionnaire is thus well suited for use in psychosocial care of families within the field of paediatric oncology. © Georg Thieme Verlag KG Stuttgart · New York.

Advances in Using Fiber-Optic Distributed Temperature Sensing to Identify the Mixing of Waters

NASA Astrophysics Data System (ADS)