Using the candidate gene approach for detecting genes underlying seed oil concentration and yield in soybean.

PubMed

Eskandari, Mehrzad; Cober, Elroy R; Rajcan, Istvan

2013-07-01

Increasing the oil concentration in soybean seeds has been given more attention in recent years because of demand for both edible oil and biodiesel production. Oil concentration in soybean is a complex quantitative trait regulated by many genes as well as environmental conditions. To identify genes governing seed oil concentration in soybean, 16 putative candidate genes of three important gene families (GPAT: acyl-CoA:sn-glycerol-3-phosphate acyltransferase, DGAT: acyl-CoA:diacylglycerol acyltransferase, and PDAT: phospholipid:diacylglycerol acyltransferase) involved in triacylglycerol (TAG) biosynthesis pathways were selected and their sequences retrieved from the soybean database ( http://www.phytozome.net/soybean ). Three sequence mutations were discovered in either coding or noncoding regions of three DGAT soybean isoforms when comparing the parents of a 203 recombinant inbreed line (RIL) population; OAC Wallace and OAC Glencoe. The RIL population was used to study the effects of these mutations on seed oil concentration and other important agronomic and seed composition traits, including seed yield and protein concentration across three field locations in Ontario, Canada, in 2009 and 2010. An insertion/deletion (indel) mutation in the GmDGAT2B gene in OAC Wallace was significantly associated with reduced seed oil concentration across three environments and reduced seed yield at Woodstock in 2010. A mutation in the 3' untranslated (3'UTR) region of GmDGAT2C was associated with seed yield at Woodstock in 2009. A mutation in the intronic region of GmDGAR1B was associated with seed yield and protein concentration at Ottawa in 2010. The genes identified in this study had minor effects on either seed yield or oil concentration, which was in agreement with the quantitative nature of the traits. However, the novel gene-specific markers designed in the present study can be used in soybean breeding for marker-assisted selection aimed at increasing seed yield and oil

Super-optimal CO2 reduces seed yield but not vegetative growth in wheat

NASA Technical Reports Server (NTRS)

Grotenhuis, T. P.; Bugbee, B.

1997-01-01

Although terrestrial atmospheric CO2 levels will not reach 1000 micromoles mol-1 (0.1%) for decades, CO2 levels in growth chambers and greenhouses routinely exceed that concentration. CO2 levels in life support systems in space can exceed 10000 micromoles mol-1(1%). Numerous studies have examined CO2 effects up to 1000 micromoles mol-1, but biochemical measurements indicate that the beneficial effects of CO2 can continue beyond this concentration. We studied the effects of near-optimal (approximately 1200 micromoles mol-1) and super-optimal CO2 levels (2400 micromoles mol-1) on yield of two cultivars of hydroponically grown wheat (Triticum aestivum L.) in 12 trials in growth chambers. Increasing CO2 from sub-optimal to near-optimal (350-1200 micromoles mol-1) increased vegetative growth by 25% and seed yield by 15% in both cultivars. Yield increases were primarily the result of an increased number of heads per square meter. Further elevation of CO2 to 2500 micromoles mol-1 reduced seed yield by 22% (P < 0.001) in cv. Veery-10 and by 15% (P < 0.001) in cv. USU-Apogee. Super-optimal CO2 did not decrease the number of heads per square meter, but reduced seeds per head by 10% and mass per seed by 11%. The toxic effect of CO2 was similar over a range of light levels from half to full sunlight. Subsequent trials revealed that super-optimal CO2 during the interval between 2 wk before and after anthesis mimicked the effect of constant super-optimal CO2. Furthermore, near-optimal CO2 during the same interval mimicked the effect of constant near-optimal CO2. Nutrient concentration of leaves and heads was not affected by CO2. These results suggest that super-optimal CO2 inhibits some process that occurs near the time of seed set resulting in decreased seed set, seed mass, and yield.

Phenology and Seed Yield Performance of Determinate Soybean Cultivars Grown at Elevated Temperatures in a Temperate Region.

PubMed

Choi, Doug-Hwan; Ban, Ho-Young; Seo, Beom-Seok; Lee, Kyu-Jong; Lee, Byun-Woo

2016-01-01

Increased temperature means and fluctuations associated with climate change are predicted to exert profound effects on the seed yield of soybean. We conducted an experiment to evaluate the impacts of global warming on the phenology and yield of two determinate soybean cultivars in a temperate region (37.27°N, 126.99°E; Suwon, South Korea). These two soybean cultivars, Sinpaldalkong [maturity group (MG) IV] and Daewonkong (MG VI), were cultured on various sowing dates within a four-year period, under no water-stress conditions. Soybeans were kept in greenhouses controlled at the current ambient temperature (AT), AT+1.5°C, AT+3.0°C, and AT+5.0°C throughout the growth periods. Growth periods (VE-R7) were significantly prolonged by the elevated temperatures, especially the R1-R5 period. Cultivars exhibited no significant differences in seed yield at the AT+1.5°C and AT+3.0°C treatments, compared to AT, while a significant yield reduction was observed at the AT+5.0°C treatment. Yield reductions resulted from limited seed number, which was due to an overall low numbers of pods and seeds per pod. Heat stress conditions induced a decrease in pod number to a greater degree than in seed number per pod. Individual seed weight exhibited no significant variation among temperature elevation treatments; thus, seed weight likely had negligible impacts on overall seed yield. A boundary line analysis (using quantile regression) estimated optimum temperatures for seed number at 26.4 to 26.8°C (VE-R5) for both cultivars; the optimum temperatures (R5-R7) for single seed weight were estimated at 25.2°C for the Sinpaldalkong smaller-seeded cultivar, and at 22.3°C for the Daewonkong larger-seeded cultivar. The optimum growing season (VE-R7) temperatures for seed yield, which were estimated by combining the two boundary lines for seed number and seed weight, were 26.4 and 25.0°C for the Sinpaldalkong and Daewonkong cultivars, respectively. Considering the current soybean

Natural variation of fecundity components in a widespread plant with dimorphic seeds

NASA Astrophysics Data System (ADS)

Braza, Rita; Arroyo, J.; García, M. B.

2010-09-01

The number and size of seeds are the basis of the quantity and quality components of female reproductive fitness in plants, playing a central role in the evolutionary ecology of life history diversification. In this study we show and analyze the natural variability of several fecundity variables (fruit set, seed production per fruit, seed size, total seed production per plant, and proportion of small seeds) in Plantago coronopus, a widespread, short-lived herb with dimorphic seeds. The structure of such variability was examined at the individual, population (eight locations with different environments within the same region), and life history levels (annual vs perennial), and correlated to soil fertility. There was no divergence associated to the life history for any of the variables studied. Total seed production (the quantity component of female fitness) was correlated with maternal resources, while the size of the large mucilaginous, basal seeds, and the proportion of the small apical seeds (quality component) were more associated to environmental resources. Thus, internal and external resources shape different fitness components, maximizing seed production, and fitting the size and proportion of different kind of seeds to local conditions irrespective of life history. P. coronopus illustrates the versatility of short-lived widespread plants to combine fecundity traits in a flexible manner, in order to increase fitness at each of the many possible habitats they occupy over heterogeneous environments.

Role of nitric oxide in cadmium-induced stress on growth, photosynthetic components and yield of Brassica napus L.

PubMed

Jhanji, Shalini; Setia, R C; Kaur, Navjyot; Kaur, Parminder; Setia, Neelam

2012-11-01

Experiments were carried out to study the effect of cadmium (Cd) and exogenous nitric oxide (NO) on growth, photosynthetic attributes, yield components and structural features of Brassica napus L. (cv. GSL 1). Cadmium in the growth medium at different levels (1, 2 and 4 Mm) retarded plant growth viz. shoot (27%) and root (51%) length as compared to control. The accumulation of total dry matter and its partitioning to different plant parts was also reduced by 31% due to Cd toxicity. Photosynthetic parameters viz., leaf area plant(-1) (51%), total Chl (27%), Chl a / Chl b ratio (22%) and Hill reaction activity of chloroplasts (42%) were greatly reduced in Cd-treated plants. Cd treatments adversely affected various yield parameters viz., number of branches (23) and siliquae plant(-1) (246), seed number siliqua(-1) (10.3), 1000-seed weight (2.30g) and seed yield plant(-1) (7.09g). Different Cd treatments also suppressed the differentiation of various tissues like vessels in the root with a maximum inhibition caused by 4mM Cd. Exogenous application of nitric oxide (NO) improved the various morpho-physiological and photosynthetic parameters in control as well as Cd-treated plants.

Combining ability analysis for within-boll yield components in upland cotton (Gossypium hirsutum L.).

PubMed

Imran, M; Shakeel, A; Azhar, F M; Farooq, J; Saleem, M F; Saeed, A; Nazeer, W; Riaz, M; Naeem, M; Javaid, A

2012-08-24

Cotton is an important cash crop worldwide, accounting for a large percentage of world agricultural exports; however, yield per acre is still poor in many countries, including Pakistan. Diallel mating system was used to identify parents for improving within-boll yield and fiber quality parameters. Combining ability analysis was employed to obtain suitable parents for this purpose. The parental genotypes CP-15/2, NIAB Krishma, CIM-482, MS-39, and S-12 were crossed in complete diallel mating under green house conditions during 2009. The F₀ seed of 20 hybrids and five parents were planted in the field in randomized complete block design with three replications during 2010. There were highly significant differences among all F₁ hybrids and their parents. Specific combining ability (SCA) variance was greater than general combining ability (GCA) variance for bolls per plant (9.987), seeds per boll (0.635), seed density (5.672), lint per seed (4.174), boll size (3.69), seed cotton yield (0.315), and lint percentage (0.470), showing predominance of non-additive genes; while seed volume (3.84) was controlled by additive gene action based on maximum GCA variance. Cultivar MS-39 was found to be the best general combiner for seed volume (0.102), seeds per boll (0.448), and lint per seed (0.038) and its utilization produced valuable hybrids, including MS-39 x NIAB Krishma and MS-39 x S-12. The parental line CIM-482 had high GCA effects for boll size (0.33) and seeds per boll (0.90). It also showed good SCA with S-12 and NIAB Krishma for bolls per plant, with CP- 15/2 for boll size, and with MS-39 for seeds per boll. The hybrids, namely, CP-15/2 x NIAB Krishma, NIAB Krishma x S-12, NIAB Krishma x CIM-482, MS-39 x NIAB Krishma, MS-39 x CP-15/2, and S-12 x MS-39 showed promising results. Correlation analysis revealed that seed cotton yield showed significant positive correlation with bolls per plant, boll size and seeds per boll while it showed negative correlation with lint

Maternal synthesis of abscisic acid controls seed development and yield in Nicotiana plumbaginifolia.

PubMed

Frey, Anne; Godin, Béatrice; Bonnet, Magda; Sotta, Bruno; Marion-Poll, Annie

2004-04-01

The role of maternally derived abscisic acid (ABA) during seed development has been studied using ABA-deficient mutants of Nicotiana plumbaginifolia Viviani. ABA deficiency induced seed abortion, resulting in reduced seed yield, and delayed growth of the remaining embryos. Mutant grafting onto wild-type stocks and reciprocal crosses indicated that maternal ABA, synthesized in maternal vegetative tissues and translocated to the seed, promoted early seed development and growth. Moreover ABA deficiency delayed both seed coat pigmentation and capsule dehiscence. Mutant grafting did not restore these phenotypes, indicating that ABA synthesized in the seed coat and capsule envelope may have a positive effect on capsule and testa maturation. Together these results shed light on the positive role of maternal ABA during N. plumbaginifolia seed development.

Effects of fungicide seed treatments on germination, population, and yield of maize grown from seed infected with fungal pathogens

USDA-ARS?s Scientific Manuscript database

Seedborne fungi can reduce survival, growth, and yield of maize (Zea mays L.). Laboratory, field, and growth chamber experiments were conducted to determine the effects of the seed treatment fungicides fludioxonil, mefenoxam, and azoxystrobin on germination, plant population, and grain yield of maiz...

Irrigation and cultivar effect on flax fiber and seed yield in the southeast USA

USDA-ARS?s Scientific Manuscript database

Flax (Linum usitatissimum L.) is a potential winter crop for the Southeast USA that can be grown for both seed and fiber. The objective of this research was to evaluate the effect of irrigation on flax straw, fiber, and seed yield of fiber-type and seed-type cultivars at different flax growth stage...

Impacts of adding different components of wood vinegar on rape (Brassica napus L.) seed germiantion

NASA Astrophysics Data System (ADS)

Shan, Xue; Liu, Xia; Zhang, Qian

2018-03-01

In recent years, wood vinegar has been widely used in the agricultural production. It can be used as the soil amendment, antibacterial agent and organic fertilizer. This study investigated the effect of wood vinegar on rape (Brassica napus L.) seed germination. The results in this study showed that 1% (v/v) wood vinegar had the greatest inhibition effect on the seed germination of rape (Brassica napus L.). The wood vinegar (WV) and the distilled wood vinegar at 98 - 130 °C (D2) significantly inhibited seed germination by 100%, compared to the control treatment. However, the distilled wood vinegar (D1) had significantly increased the shoot length and root length by 58.4% and 31.7%, respectively. These positive effects could be attributed to the improved soil fertility, increased nutrient supply, and further stimulated plant growth. Overall, the D1 could be a promising soil amendment to promote plants growth and enhance crop yields. Effect of adding different components of distilled wood vinegar on the seed germination of rape

Impact of heterozygosity and heterogeneity on cotton lint yield stability: II. Lint yield components

USDA-ARS?s Scientific Manuscript database

In order to determine which yield components may contribute to yield stability, an 18-environment field study was undertaken to observe the mean, standard deviation (SD), and coefficient of variation (CV) for cotton lint yield components in population types that differed for lint yield stability. Th...

Seed yield, development, and variation in diverse poa pratensis accessions

USDA-ARS?s Scientific Manuscript database

Post harvest residue removal is critical for continued high seed production of Kentucky bluegrass (Poa pratensis L.). Previous work showed some accessions have little or no yield reduction with mechanical residue removal compared with the controversial practice of open field burning. Using 10 of t...

[Infrared spectroscopic study on the component and vigor analysis of Cistanche deserticola seeds].

PubMed

Xu, Rong; Sun, Su-Qin; Chen, Jun; Chen, Shi-Lin; Zhou, Feng

2009-01-01

Comparative study of the different parts of cistanche deserticola seeds and their changes after different processing were examined by Fourier transform infrared spectroscopy spectra (FTIR). The results of the analysis showed that components in the cistanche deserticola seeds were abundant, which contained characteristic absorption peaks of protein, fat and carbohydrate. As well, pectin and aromatic compound can be also found in the seeds. However, the components were different in different parts of cistanche deserticola seeds. The characteristic absorption peak intensities of fat at 2,926, 1,746, 1,161 and 721 cm(-1) were the strongest in the seed kernels. However, the seed coats mainly consisted of carbohydrate and pectin, which were showed at 1,054 cm(-1). The contents of protein and carbohydrate were decreased distinctly in the moldy and dead seeds after processing. The characteristic absorption peak intensity ratio of protein to fat (I1,630/I1,745 ) was all higher than 1.05 in the live seeds. The characteristic absorption peak intensity ratio of amido link I of protein to fat (11,653/I1,745) in the dead seed kernels of the cistanche deserticola was decreased from 0.31 to 0. 23, which was 25.8% less than that in vital seed kernels. The results suggest that FTIR not only can be used in fast comprehensive analysis of seed components, but also can be used in the seed vigor analysis, seed longevity determination and seed quality evaluation.

Optimizing Hill Seeding Density for High-Yielding Hybrid Rice in a Single Rice Cropping System in South China

PubMed Central

Wang, Danying; Chen, Song; Wang, Zaiman; Ji, Chenglin; Xu, Chunmei; Zhang, Xiufu; Chauhan, Bhagirath Singh

2014-01-01

Mechanical hill direct seeding of hybrid rice could be the way to solve the problems of high seeding rates and uneven plant establishment now faced in direct seeded rice; however, it is not clear what the optimum hill seeding density should be for high-yielding hybrid rice in the single-season rice production system. Experiments were conducted in 2010 and 2011 to determine the effects of hill seeding density (25 cm×15 cm, 25 cm×17 cm, 25 cm×19 cm, 25 cm×21 cm, and 25 cm×23 cm; three to five seeds per hill) on plant growth and grain yield of a hybrid variety, Nei2you6, in two fields with different fertility (soil fertility 1 and 2). In addition, in 2012 and 2013, comparisons among mechanical hill seeding, broadcasting, and transplanting were conducted with three hybrid varieties to evaluate the optimum seeding density. With increases in seeding spacing from 25 cm×15 cm to 25 cm×23 cm, productive tillers per hill increased by 34.2% and 50.0% in soil fertility 1 and 2. Panicles per m2 declined with increases in seeding spacing in soil fertility 1. In soil fertility 2, no difference in panicles per m2 was found at spacing ranging from 25 cm×17 cm to 25 cm×23 cm, while decreases in the area of the top three leaves and aboveground dry weight per shoot at flowering were observed. Grain yield was the maximum at 25 cm×17 cm spacing in both soil fertility fields. Our results suggest that a seeding density of 25 cm×17 cm was suitable for high-yielding hybrid rice. These results were verified through on-farm demonstration experiments, in which mechanical hill-seeded rice at this density had equal or higher grain yield than transplanted rice. PMID:25290342

Alfalfa seed germination and yield ratio and alfalfa sprout microbial keeping quality following irradiation of seeds and sprouts.

PubMed

Rajkowski, K T; Thayer, D W

2001-12-01

Foods can be treated with gamma radiation, a nonthermal food process, to inactivate foodborne pathogens and fungi, to kill insects on or in fruits and vegetables, and to increase shelf life. Gamma irradiation is especially well suited for these treatments because of its ability to penetrate commercial pallets of foods. Irradiated fruits, vegetables, poultry, and hamburger have been received favorably by the public and are now available in supermarkets. The use of irradiation on fresh alfalfa sprouts was studied to determine its effect on keeping quality as related to aerobic microbial load. After an irradiation dose of 2 kGy, the total aerobic count decreased from 10(5-8) to 10(3-5) CFU/g, and the total coliform counts decreased from 10(5-8) to 10(3-0) CFU/g. The results showed that the sprouts maintained their structure after irradiation, and the keeping quality was extended to 21 days, which is an increase of 10 days from the usual shelf life. The effect of various doses of irradiation on alfalfa seeds as measured by percent germination and yield ratio (wt/wt) of sprouts was determined. There was little effect on the percent germination, but as the dose increased, the yield ratio of alfalfa sprouts decreased. As the length of growing time increased, so did the yield ratio of the lower dose irradiated seeds (1 to 2 kGy). The irradiation process can be used to increase the shelf life of alfalfa sprouts, and irradiating alfalfa seeds at doses up to 2 kGy does not unacceptably decrease the yield ratio for production of alfalfa sprouts.

Camelina Seed Yield and Fatty Acids as Influenced by Genotype and Environment

DOE PAGES

Obour, Augustine K.; Obeng, Eric; Mohammed, Yesuf A.; ...

2017-05-05

Camelina (Camelina sativa L. Crantz) is an alternative oilseed crop with potential for fallow replacement in dryland cereal-based crop production systems in the semiarid Great Plains. The interaction between genotype and environment was investigated on camelina seed yield, oil content, and fatty acid composition across two locations in the U.S. Great Plains. Treatments were three spring camelina genotypes (cultivars Blaine Creek, Pronghorn, and Shoshone), three growing seasons (2013, 2014, and 2015) and two locations (at Hays, KS, and Moccasin, MT). Our results showed camelina grown at Hays yielded 54% less than that at Moccasin. Blaine Creek yielded 17 and 42%more » more than Pronghorn and Shoshone at Hays but yields were not different among genotypes at Moccasin. Oil content ranged from 262 g kg -1 at Hays to 359 g kg -1 at Moccasin. The proportion of polyunsaturated fatty acids (PUFAs) ranged from 51% at Hays to 55% at Moccasin, whereas monounsaturated fatty acid (MUFA) and saturated fatty acid (SFA) contents were greater at Hays. The linolenic acid content ranged from 26% when Pronghorn was planted at Hays to 35% when planted at Moccasin. In general, the variations in seed yield and fatty acid profile corresponded well with growing season precipitation and temperatures at each environment.« less

Camelina Seed Yield and Fatty Acids as Influenced by Genotype and Environment

DOE Office of Scientific and Technical Information (OSTI.GOV)

Obour, Augustine K.; Obeng, Eric; Mohammed, Yesuf A.

Camelina (Camelina sativa L. Crantz) is an alternative oilseed crop with potential for fallow replacement in dryland cereal-based crop production systems in the semiarid Great Plains. The interaction between genotype and environment was investigated on camelina seed yield, oil content, and fatty acid composition across two locations in the U.S. Great Plains. Treatments were three spring camelina genotypes (cultivars Blaine Creek, Pronghorn, and Shoshone), three growing seasons (2013, 2014, and 2015) and two locations (at Hays, KS, and Moccasin, MT). Our results showed camelina grown at Hays yielded 54% less than that at Moccasin. Blaine Creek yielded 17 and 42%more » more than Pronghorn and Shoshone at Hays but yields were not different among genotypes at Moccasin. Oil content ranged from 262 g kg -1 at Hays to 359 g kg -1 at Moccasin. The proportion of polyunsaturated fatty acids (PUFAs) ranged from 51% at Hays to 55% at Moccasin, whereas monounsaturated fatty acid (MUFA) and saturated fatty acid (SFA) contents were greater at Hays. The linolenic acid content ranged from 26% when Pronghorn was planted at Hays to 35% when planted at Moccasin. In general, the variations in seed yield and fatty acid profile corresponded well with growing season precipitation and temperatures at each environment.« less

Yield and composition of grape seed oils extracted by supercritical carbon dioxide and petroleum ether: varietal effects.

PubMed

Beveridge, Thomas H J; Girard, Benoit; Kopp, Thomas; Drover, John C G

2005-03-09

Grape seed has a well-known potential for production of oil as a byproduct of winemaking and is currently produced as a specialty oil byproduct of wine manufacture. Seed oils from eight varieties of grapes crushed for wine production in British Columbia were extracted by supercritical carbon dioxide (SCE) and petroleum ether (PE). Oil yields by SCE ranged from 5.85 +/- 0.33 to 13.6 +/- 0.46% (w/w), whereas PE yields ranged from 6.64 +/- 0.16 to 11.17 +/- 0.05% (+/- is standard deviation). The oils contained alpha-, beta-, and gamma-tocopherols and alpha- and gamma-tocotrienols, with gamma-tocotrienol being most important quantitatively. In both SCE- and PE-extracted oils, phytosterols were a prominent feature of the unsaponifiable fraction, with beta-sitosterol quantitatively most important with both extractants. Total phytosterol extraction was higher with SCE than with PE in seven of eight variety extractions. Fatty acid composition of oils from all varieties tested, and from both extraction methods, indicated linoleic acid as the major component ranging from 67.56 to 73.23% of the fatty acids present, in agreement with literature reports.

Study of optimal extraction conditions for achieving high yield and antioxidant activity of tomato seed oil.

PubMed

Shao, Dongyan; Atungulu, Griffiths G; Pan, Zhongli; Yue, Tianli; Zhang, Ang; Li, Xuan

2012-08-01

Value of tomato seed has not been fully recognized. The objectives of this research were to establish suitable processing conditions for extracting oil from tomato seed by using solvent, determine the impact of processing conditions on yield and antioxidant activity of extracted oil, and elucidate kinetics of the oil extraction process. Four processing parameters, including time, temperature, solvent-to-solid ratio and particle size were studied. A second order model was established to describe the oil extraction process. Based on the results, increasing temperature, solvent-to-solid ratio, and extraction time increased oil yield. In contrast, larger particle size reduced the oil yield. The recommended oil extraction conditions were 8 min of extraction time at temperature of 25 °C, solvent-to-solids ratio of 5/1 (v/w) and particle size of 0.38 mm, which gave oil yield of 20.32% with recovery rate of 78.56%. The DPPH scavenging activity of extracted oil was not significantly affected by the extraction parameters. The inhibitory concentration (IC(50) ) of tomato seed oil was 8.67 mg/mL which was notably low compared to most vegetable oils. A 2nd order model successfully described the kinetics of tomato oil extraction process and parameters of extraction kinetics including initial extraction rate (h), equilibrium concentration of oil (C(s) ), and the extraction rate constant (k) could be precisely predicted with R(2) of at least 0.957. The study revealed that tomato seed which is typically treated as a low value byproduct of tomato processing has great potential in producing oil with high antioxidant capability. The impact of processing conditions including time, temperature, solvent-to-solid ratio and particle size on yield, and antioxidant activity of extracted tomato seed oil are reported. Optimal conditions and models which describe the extraction process are recommended. The information is vital for determining the extraction processing conditions for industrial

Using normalized difference vegetation index (NDVI) to estimate sugarcane yield and yield components

USDA-ARS?s Scientific Manuscript database

Sugarcane (Saccharum spp.) yield and yield components are important traits for growers and scientists to evaluate and select cultivars. Collection of these yield data would be labor intensive and time consuming in the early selection stages of sugarcane breeding cultivar development programs with a ...

Validation of mega-environment universal and specific QTL associated with seed yield and agronomic traits in soybeans.

PubMed

Palomeque, Laura; Liu, Li-Jun; Li, Wenbin; Hedges, Bradley R; Cober, Elroy R; Smid, Mathew P; Lukens, Lewis; Rajcan, Istvan

2010-03-01

The value of quantitative trait loci (QTL) is dependent on the strength of association with the traits of interest, allelic diversity at the QTL and the effect of the genetic background on the expression of the QTL. A number of recent studies have identified QTL associated with traits of interest that appear to be independent of the environment but dependent on the genetic background in which they are found. Therefore, the objective of this study was to validate universal and/or mega-environment-specific seed yield QTL that have been previously reported in an independent recombinant inbred line (RIL) population derived from the cross between an elite Chinese and Canadian parent. The population was evaluated at two field environments in China and in five environments in Canada in 2005 and 2006. Of the seven markers linked to seed yield QTL reported by our group in a previous study, four were polymorphic between the two parents. No association between seed yield and QTL was observed. The result could imply that seed yield QTL were either not stable in this particular genetic background or harboured different alleles than the ones in the original mapping population. QTL(U) Satt162 was associated with several agronomic traits of which lodging was validated. Both the non-adapted and adapted parent contributed favourable alleles to the progeny. Therefore, plant introductions have been validated as a source of favourable alleles that could increase the genetic variability of the soybean germplasm pool and lead to further improvements in seed yield and other agronomic traits.

Thiamethoxam Seed Treatments Have No Impact on Pest Numbers or Yield in Cultivated Sunflowers.

PubMed

Bredeson, Michael M; Lundgren, Jonathan G

2015-12-01

The use of neonicotinoid seed treatments is a nearly ubiquitous practice in sunflower (Helianthus annuus) pest management. Sunflowers have a speciose pest complex, but also harbor a diverse and abundant community of beneficial, nontarget organisms which may be negatively affected by pest management practices. Here, we investigate how the foliar and subterranean arthropod pest communities in sunflower fields were affected by a thiamethoxam seed treatment over three site years (two years on one farm, and another year at an additional field in the second year). Thiamethoxam and its metabolite clothianidin in leaf tissue were quantified throughout the growing season, and yield differences between treatments were measured. Across site years, foliar herbivores and key pests of sunflowers were unaffected by the seed treatment. Likewise, subterranean herbivores were unaffected. Thiamethoxam was measurable in leaf tissue through the R1 plant stage, while its metabolite clothianidin was detected throughout flowering (R6). No difference in sunflower yield was observed between treatments across site years. This research suggests that neonicotinoid seed treatments in sunflowers do not always provide economic benefits to farmers in the form of pest reductions or yield improvements. Future research should focus on sunflower integrated pest management strategies that limit nontarget effects of agrochemicals, while providing greater economic returns to farmers. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

Effect of mechanical extraction parameters on the yield and quality of tobacco (Nicotiana tabacum L.) seed oil.

PubMed

Sannino, M; Del Piano, L; Abet, Massimo; Baiano, S; Crimaldi, M; Modestia, F; Raimo, F; Ricciardiello, G; Faugno, S

2017-11-01

The aim of this study was to investigate how the combination of extraction parameters, such as extraction temperature seeds preheating and screw rotation speed, influenced the yield and chemical quality of tobacco seed oil (TSO). For its peculiar properties, TSO can be used for several purposes, as raw material in the manufacturing of soap, paints, resins, lubricants, biofuels and also as edible oil. TSO was obtained using a mechanical screw press and the quality of the oil was evaluated by monitoring the free fatty acids (FFA), the peroxide value (PV), the spectroscopic indices K 232 , K 270 and ΔK and the fatty acid composition. The maximum extraction yield, expressed as percent of oil mechanically extracted respect to the oil content in the seeds, determined by solvent extraction, was obtained with the combination of the highest extraction temperature, the slowest screw rotation speed and seeds preheating. Under these conditions yield was 80.28 ± 0.33% (w/w), 25% higher than the lowest yield obtained among investigated conditions. The extraction temperature and seed preheating showed a significant effect on FFA, on spectroscopic indices K 232 , K 270 and ΔK values. The average values of these parameters slightly increased rising the temperature and in presence of preheating, the screw rotation speed did not affect the chemical characteristic tested. In the extraction conditions investigated no significant changes in PV and fatty acids composition of oil were observed.

Over-expression of AtPAP2 in Camelina sativa leads to faster plant growth and higher seed yield

PubMed Central

2012-01-01

Background Lipids extracted from seeds of Camelina sativa have been successfully used as a reliable source of aviation biofuels. This biofuel is environmentally friendly because the drought resistance, frost tolerance and low fertilizer requirement of Camelina sativa allow it to grow on marginal lands. Improving the species growth and seed yield by genetic engineering is therefore a target for the biofuels industry. In Arabidopsis, overexpression of purple acid phosphatase 2 encoded by Arabidopsis (AtPAP2) promotes plant growth by modulating carbon metabolism. Overexpression lines bolt earlier and produce 50% more seeds per plant than wild type. In this study, we explored the effects of overexpressing AtPAP2 in Camelina sativa. Results Under controlled environmental conditions, overexpression of AtPAP2 in Camelina sativa resulted in longer hypocotyls, earlier flowering, faster growth rate, higher photosynthetic rate and stomatal conductance, increased seed yield and seed size in comparison with the wild-type line and null-lines. Similar to transgenic Arabidopsis, activity of sucrose phosphate synthase in leaves of transgenic Camelina was also significantly up-regulated. Sucrose produced in photosynthetic tissues supplies the building blocks for cellulose, starch and lipids for growth and fuel for anabolic metabolism. Changes in carbon flow and sink/source activities in transgenic lines may affect floral, architectural, and reproductive traits of plants. Conclusions Lipids extracted from the seeds of Camelina sativa have been used as a major constituent of aviation biofuels. The improved growth rate and seed yield of transgenic Camelina under controlled environmental conditions have the potential to boost oil yield on an area basis in field conditions and thus make Camelina-based biofuels more environmentally friendly and economically attractive. PMID:22472516

A shrunken-2 Transgene Increases Maize Yield by Acting in Maternal Tissues to Increase the Frequency of Seed Development[W

PubMed Central

Hannah, L. Curtis; Futch, Brandon; Bing, James; Shaw, Janine R.; Boehlein, Susan; Stewart, Jon D.; Beiriger, Robert; Georgelis, Nikolaos; Greene, Thomas

2012-01-01

The maize (Zea mays) shrunken-2 (Sh2) gene encodes the large subunit of the rate-limiting starch biosynthetic enzyme, ADP-glucose pyrophosphorylase. Expression of a transgenic form of the enzyme with enhanced heat stability and reduced phosphate inhibition increased maize yield up to 64%. The extent of the yield increase is dependent on temperatures during the first 4 d post pollination, and yield is increased if average daily high temperatures exceed 33°C. As found in wheat (Triticum aestivum) and rice (Oryza sativa), this transgene increases maize yield by increasing seed number. This result was surprising, since an entire series of historic observations at the whole-plant, enzyme, gene, and physiological levels pointed to Sh2 playing an important role only in the endosperm. Here, we present several lines of evidence that lead to the conclusion that the Sh2 transgene functions in maternal tissue to increase seed number and, in turn, yield. Furthermore, the transgene does not increase ovary number; rather, it increases the probability that a seed will develop. Surprisingly, the number of fully developed seeds is only ∼50% of the number of ovaries in wild-type maize. This suggests that increasing the frequency of seed development is a feasible agricultural target, especially under conditions of elevated temperatures. PMID:22751213

Cone and seed yields in white spruce seed production areas

Treesearch

John A. Pitcher

1966-01-01

The source of seed is an important consideration in the reforestation program on the National Forests in the North Central Region. Thirty-five seed production areas have been set up in the Region, along the lines proposed by the North Central Forest Experiment Station, to provide control of seed source. Red pine, white pine, shortleaf and loblolly pine, and white...

Assessment of cluster yield components by image analysis.

PubMed

Diago, Maria P; Tardaguila, Javier; Aleixos, Nuria; Millan, Borja; Prats-Montalban, Jose M; Cubero, Sergio; Blasco, Jose

2015-04-01

Berry weight, berry number and cluster weight are key parameters for yield estimation for wine and tablegrape industry. Current yield prediction methods are destructive, labour-demanding and time-consuming. In this work, a new methodology, based on image analysis was developed to determine cluster yield components in a fast and inexpensive way. Clusters of seven different red varieties of grapevine (Vitis vinifera L.) were photographed under laboratory conditions and their cluster yield components manually determined after image acquisition. Two algorithms based on the Canny and the logarithmic image processing approaches were tested to find the contours of the berries in the images prior to berry detection performed by means of the Hough Transform. Results were obtained in two ways: by analysing either a single image of the cluster or using four images per cluster from different orientations. The best results (R(2) between 69% and 95% in berry detection and between 65% and 97% in cluster weight estimation) were achieved using four images and the Canny algorithm. The model's capability based on image analysis to predict berry weight was 84%. The new and low-cost methodology presented here enabled the assessment of cluster yield components, saving time and providing inexpensive information in comparison with current manual methods. © 2014 Society of Chemical Industry.

Acid soil infertility effects on peanut yields and yield components

DOE Office of Scientific and Technical Information (OSTI.GOV)

Blamey, F.P.C.

1983-01-01

The interpretation of soil amelioration experiments with peanuts is made difficult by the unpredictibility of the crop and by the many factors altered when ameliorating acid soils. The present study was conducted to investigate the effects of lime and gypsum applications on peanut kernel yield via the three first order yield components, pods per ha, kernels per pod, and kernel mass. On an acid medium sandy loam soil (typic Plinthustult), liming resulted in a highly significant kernel yield increase of 117% whereas gypsum applications were of no significant benefit. As indicated by path coefficient analysis, an increase in the numbermore » of pods per ha was markedly more important in increasing yield than an increase in either the number of kernels per pod or kernel mass. Furthermore, exch. Al was found to be particularly detrimental to pod number. It was postulated that poor peanut yields resulting from acid soil infertility were mainly due to the depressive effect of exch. Al on pod number. Exch. Ca appeared to play a secondary role by ameliorating the adverse effects of exch. Al.« less

A photorespiratory bypass increases plant growth and seed yield in biofuel crop Camelina sativa

DOE PAGES

Dalal, Jyoti; Lopez, Harry; Vasani, Naresh B.; ...

2015-10-29

Camelina sativa is an oilseed crop with great potential for biofuel production on marginal land. The seed oil from camelina has been converted to jet fuel and improved fuel efficiency in commercial and military test flights. Hydrogenation-derived renewable diesel from camelina is environmentally superior to that from canola due to lower agricultural inputs, and the seed meal is FDA approved for animal consumption. However, relatively low yield makes its farming less profitable. Our study is aimed at increasing camelina seed yield by reducing carbon loss from photorespiration via a photorespiratory bypass. Genes encoding three enzymes of the Escherichia coli glycolatemore » catabolic pathway were introduced: glycolate dehydrogenase (GDH), glyoxylate carboxyligase (GCL) and tartronic semialdehyde reductase (TSR). These enzymes compete for the photorespiratory substrate, glycolate, convert it to glycerate within the chloroplasts, and reduce photorespiration. As a by-product of the reaction, CO 2 is released in the chloroplast, which increases photosynthesis. Camelina plants were transformed with either partial bypass (GDH), or full bypass (GDH, GCL and TSR) genes. Furthermore, transgenic plants were evaluated for physiological and metabolic traits.« less

A photorespiratory bypass increases plant growth and seed yield in biofuel crop Camelina sativa

DOE Office of Scientific and Technical Information (OSTI.GOV)

Dalal, Jyoti; Lopez, Harry; Vasani, Naresh B.

Camelina sativa is an oilseed crop with great potential for biofuel production on marginal land. The seed oil from camelina has been converted to jet fuel and improved fuel efficiency in commercial and military test flights. Hydrogenation-derived renewable diesel from camelina is environmentally superior to that from canola due to lower agricultural inputs, and the seed meal is FDA approved for animal consumption. However, relatively low yield makes its farming less profitable. Our study is aimed at increasing camelina seed yield by reducing carbon loss from photorespiration via a photorespiratory bypass. Genes encoding three enzymes of the Escherichia coli glycolatemore » catabolic pathway were introduced: glycolate dehydrogenase (GDH), glyoxylate carboxyligase (GCL) and tartronic semialdehyde reductase (TSR). These enzymes compete for the photorespiratory substrate, glycolate, convert it to glycerate within the chloroplasts, and reduce photorespiration. As a by-product of the reaction, CO 2 is released in the chloroplast, which increases photosynthesis. Camelina plants were transformed with either partial bypass (GDH), or full bypass (GDH, GCL and TSR) genes. Furthermore, transgenic plants were evaluated for physiological and metabolic traits.« less

A Risk Assessment Framework for Seed Degeneration: Informing an Integrated Seed Health Strategy for Vegetatively Propagated Crops.

PubMed

Thomas-Sharma, S; Andrade-Piedra, J; Carvajal Yepes, M; Hernandez Nopsa, J F; Jeger, M J; Jones, R A C; Kromann, P; Legg, J P; Yuen, J; Forbes, G A; Garrett, K A

2017-10-01

Pathogen buildup in vegetative planting material, termed seed degeneration, is a major problem in many low-income countries. When smallholder farmers use seed produced on-farm or acquired outside certified programs, it is often infected. We introduce a risk assessment framework for seed degeneration, evaluating the relative performance of individual and combined components of an integrated seed health strategy. The frequency distribution of management performance outcomes was evaluated for models incorporating biological and environmental heterogeneity, with the following results. (1) On-farm seed selection can perform as well as certified seed, if the rate of success in selecting healthy plants for seed production is high; (2) when choosing among within-season management strategies, external inoculum can determine the relative usefulness of 'incidence-altering management' (affecting the proportion of diseased plants/seeds) and 'rate-altering management' (affecting the rate of disease transmission in the field); (3) under severe disease scenarios, where it is difficult to implement management components at high levels of effectiveness, combining management components can be synergistic and keep seed degeneration below a threshold; (4) combining management components can also close the yield gap between average and worst-case scenarios. We also illustrate the potential for expert elicitation to provide parameter estimates when empirical data are unavailable. [Formula: see text] Copyright © 2017 The Author(s). This is an open access article distributed under the CC BY-NC-ND 4.0 International license .

Yellow jackets may be an underestimated component of an ant-seed mutualism

USGS Publications Warehouse

Bale, M.T.; Zettler, J.A.; Robinson, B.A.; Spira, T.P.; Allen, Craig R.

2003-01-01

Yellow jackets (Hymenoptera: Vespidae) are attracted to the typically ant-dispersed seeds of trilliums and will take seeds from ants in the genus Aphaenogaster. To determine if yellow jacket, Vespula maculifrons (Buysson), presence interferes with seed foraging by ants, we presented seeds of Trillium discolor Wray to three species (A. texana carolinensis Wheeler, Formica schaufussi Mayr, and Solenopsis invicta Buren) of seed-carrying ants in areas where vespids were present or excluded. We found that interspecific aggression between yellow jackets and ants is species specific. Vespid presence decreased average foraging time and increased foraging efficiency of two of the three ant species studied, a situation that might reflect competition for a limited food source. We also found that yellow jackets removed more seeds than ants, suggestive that vespids are important, albeit underestimated, components of ant-seed mutualisms.

Yield and size of oyster mushroom grown on rice/wheat straw basal substrate supplemented with cotton seed hull.

PubMed

Yang, Wenjie; Guo, Fengling; Wan, Zhengjie

2013-10-01

Oyster mushroom (Pleurotus ostreatus) was cultivated on rice straw basal substrate, wheat straw basal substrate, cotton seed hull basal substrate, and wheat straw or rice straw supplemented with different proportions (15%, 30%, and 45% in rice straw substrate, 20%, 30%, and 40% in wheat straw substrate) of cotton seed hull to find a cost effective substrate. The effect of autoclaved sterilized and non-sterilized substrate on growth and yield of oyster mushroom was also examined. Results indicated that for both sterilized substrate and non-sterilized substrate, oyster mushroom on rice straw and wheat basal substrate have faster mycelial growth rate, comparatively poor surface mycelial density, shorter total colonization period and days from bag opening to primordia formation, lower yield and biological efficiency, lower mushroom weight, longer stipe length and smaller cap diameter than that on cotton seed hull basal substrate. The addition of cotton seed hull to rice straw and wheat straw substrate slowed spawn running, primordial development and fruit body formation. However, increasing the amount of cotton seed hull can increase the uniformity and white of mycelium, yield and biological efficiency, and increase mushroom weight, enlarge cap diameter and shorten stipe length. Compared to the sterilized substrate, the non-sterilized substrate had comparatively higher mycelial growth rate, shorter total colonization period and days from bag opening to primordia formation. However, the non-sterilized substrate did not gave significantly higher mushroom yield and biological efficiency than the sterilized substrate, but some undesirable characteristics, i.e. smaller mushroom cap diameter and relatively long stipe length.

Combining-ability for cacao (Theobroma cacao L.) yield components under southern Bahia conditions.

PubMed

Dias, L A; Kageyama, P Y

1995-03-01

The objective of this study was to assess five cacao cultivars (selfs) and 20 hybrids with regard to their general-and specific-combining ability for yield components using method 1, model I, of the diallel analysis system. The selfings and the hybrids were obtained through controlled crossings, tested in the field in a random block design with four replications and plots containing 16 plants. The experiment was set up in the Centro de Pesquisas do Cacau, in Itabuna, Bahia, Brasil, in 1975. The characteristics studied were: the number of healthy and collected fruits per plant (NHFP and NCFP), the weight of humid seeds per plant and per fruit (WHSP and WHSF), and the percentage of diseased fruits per plant (PDFP), for 5 years (1986-1990). The F-test values, highly significant for general combining ability (GCA) and specific combining ability (SCA), demonstrated the existence of variability for both effects. However, the effects of SCA were greater than those of GCA, when compared in terms of the average squared effects. This condition held for the characteristics NHFP, NCFP and WHSP, which shows the relative importance of the non-additive genetic effects over the additive effects. The reciprocal effects did not show significance. Breeding methods which explore the additive portion of genetic variance should be employed for obtaining higher-yielding cacao and high seed weight. For this, the segregant populations should involve cultivars CEPEC 1, SIAL 169 and ICS 1. Combinations involving the cultivar ICS 1 presented the most favorable results for the characteristics WHSP and WHSF, where the hybrid SIAL 169 x ICS 1 and its reciprocal were outstanding.

Imidacloprid seed treatments affect individual ant behavior and community structure but not egg predation, pest abundance or soybean yield.

PubMed

Penn, Hannah J; Dale, Andrew M

2017-08-01

Neonicotinoid seed treatments are under scrutiny because of their variable efficacy against crop pests and for their potential negative impacts on non-target organisms. Ants provide important biocontrol services in agroecosystems and can be indicators of ecosystem health. This study tested for effects of exposure to imidacloprid plus fungicide or fungicide-treated seeds on individual ant survival, locomotion and foraging capabilities and on field ant community structure, pest abundance, ant predation and yield. Cohorts of ants exposed to either type of treated seed had impaired locomotion and a higher incidence of morbidity and mortality but no loss of foraging capacity. In the field, we saw no difference in ant species richness, regardless of seed treatment. Blocks with imidacloprid did have higher species evenness and diversity, probably owing to variable effects of the insecticide on different ant species, particularly Tetramorium caespitum. Ant predation on sentinel eggs, pest abundance and soybean growth and yield were similar in the two treatments. Both seed treatments had lethal and sublethal effects on ant individuals, and the influence of imidacloprid seed coating in the field was manifested in altered ant community composition. Those effects, however, were not strong enough to affect egg predation, pest abundance or soybean yield in field blocks. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

The effect of high concentrations of glufosinate ammonium on the yield components of transgenic spring wheat (Triticum aestivum L.) constitutively expressing the bar gene.

PubMed

Áy, Zoltán; Mihály, Róbert; Cserháti, Mátyás; Kótai, Éva; Pauk, János

2012-01-01

We present an experiment done on a bar(+) wheat line treated with 14 different concentrations of glufosinate ammonium-an effective component of nonselective herbicides-during seed germination in a closed experimental system. Yield components as number of spikes per plant, number of grains per spike, thousand kernel weight, and yield per plant were thoroughly analysed and statistically evaluated after harvesting. We found that a concentration of glufosinate ammonium 5000 times the lethal dose was not enough to inhibit the germination of transgenic plants expressing the bar gene. Extremely high concentrations of glufosinate ammonium caused a bushy phenotype, significantly lower numbers of grains per spike, and thousand kernel weights. Concerning the productivity, we observed that concentrations of glufosinate ammonium 64 times the lethal dose did not lead to yield depression. Our results draw attention to the possibilities implied in the transgenic approaches.

Identification and validation of quantitative trait loci for seed yield, oil and protein contents in two recombinant inbred line populations of soybean.

PubMed

Wang, Xianzhi; Jiang, Guo-Liang; Green, Marci; Scott, Roy A; Song, Qijian; Hyten, David L; Cregan, Perry B

2014-10-01

Soybean seeds contain high levels of oil and protein, and are the important sources of vegetable oil and plant protein for human consumption and livestock feed. Increased seed yield, oil and protein contents are the main objectives of soybean breeding. The objectives of this study were to identify and validate quantitative trait loci (QTLs) associated with seed yield, oil and protein contents in two recombinant inbred line populations, and to evaluate the consistency of QTLs across different environments, studies and genetic backgrounds. Both the mapping population (SD02-4-59 × A02-381100) and validation population (SD02-911 × SD00-1501) were phenotyped for the three traits in multiple environments. Genetic analysis indicated that oil and protein contents showed high heritabilities while yield exhibited a lower heritability in both populations. Based on a linkage map constructed previously with the mapping population and using composite interval mapping and/or interval mapping analysis, 12 QTLs for seed yield, 16 QTLs for oil content and 11 QTLs for protein content were consistently detected in multiple environments and/or the average data over all environments. Of the QTLs detected in the mapping population, five QTLs for seed yield, eight QTLs for oil content and five QTLs for protein content were confirmed in the validation population by single marker analysis in at least one environment and the average data and by ANOVA over all environments. Eight of these validated QTLs were newly identified. Compared with the other studies, seven QTLs for seed yield, eight QTLs for oil content and nine QTLs for protein content further verified the previously reported QTLs. These QTLs will be useful for breeding higher yield and better quality cultivars, and help effectively and efficiently improve yield potential and nutritional quality in soybean.

Effect of high oleic acid soybean on seed oil, protein concentration, and yield

USDA-ARS?s Scientific Manuscript database

Soybeans with high oleic acid content are desired by oil processors because of their improved oxidative stability for broader use in food, fuel and other products. However, non-GMO high-oleic soybeans have tended to have low seed yield. The objective of this study was to test non-GMO, high-oleic s...

Investigation of liquid wax components of Egyptian jojoba seeds.

PubMed

El-Mallah, Mohammed Hassan; El-Shami, Safinaz Mohammed

2009-01-01

Egyptian jojoba seeds newly cultivated in Ismailia desert in Egypt promoted us to determine its lipid components. Fatty alcohols, fatty acids, wax esters and sterols patterns were determined by capillary GLC whereas, tocopherols profile, isopropenoid alcohols and sterylglycosides were determined by HPLC. The Egyptian seeds are rich in wax esters (55 %) with fatty alcohols C20:1 and C22:1 as major components and amounted to 43.0 % and 45.6 % respectively followed by C24:1 and C18:1(9.6 % and 1.3 % respectively). The fatty acids profile showed that C20:1 is the major constituent (60 %) followed by C18:1 and C22:1 (14.5 and 11.8 % respectively) whereas C24:1 was present at low concentration amounted to 1.6 %. In addition, the Egyptian jojoba wax contained C18:2 fatty acid at a level of 8.7 %. Wax esters composition showed that the local wax had C42 and C40 esters as major components amounted to 51.1 and 30.1 % respectively. Also, it had C44 and C38 at reasonable amounts (10.0 and 6.3 % respectively). Whereas C36 and C46 were present at lower concentrations amounted to 1.4 and 1.1 respectively. The sterols analysis showed the presence of campe-, stigma-, beta-sito-, and isofuco- sterol amounting to 18.4 %, 6.9 %, 68.7 %, and 6.0 % respectively. The tocopherols pattern revealed that the local seed wax contained gamma-tocopherol as major constituent (79.2 %) followed by alpha-tocopherol (20.3 %). beta-tocopherol as well as delta-tocopherol were found as minor constituents. The isopropenoid alcohols and the sterylglycosides (free and acylated) were not detected. The wax is proposed to be used in oleo chemistry and cosmetics.

Ultrasound-assisted extraction (UAE) and solvent extraction of papaya seed oil: yield, fatty acid composition and triacylglycerol profile.

PubMed

Samaram, Shadi; Mirhosseini, Hamed; Tan, Chin Ping; Ghazali, Hasanah Mohd

2013-10-10

The main objective of the current work was to evaluate the suitability of ultrasound-assisted extraction (UAE) for the recovery of oil from papaya seed as compared to conventional extraction techniques (i.e., Soxhlet extraction (SXE) and solvent extraction (SE)). In the present study, the recovery yield, fatty acid composition and triacylglycerol profile of papaya seed oil obtained from different extraction methods and conditions were compared. Results indicated that both solvent extraction (SE, 12 h/25 °C) and ultrasound-assisted extraction (UAE) methods recovered relatively high yields (79.1% and 76.1% of total oil content, respectively). Analysis of fatty acid composition revealed that the predominant fatty acids in papaya seed oil were oleic (18:1, 70.5%-74.7%), palmitic (16:0, 14.9%-17.9%), stearic (18:0, 4.50%-5.25%), and linoleic acid (18:2, 3.63%-4.6%). Moreover, the most abundant triacylglycerols of papaya seed oil were triolein (OOO), palmitoyl diolein (POO) and stearoyl oleoyl linolein (SOL). In this study, ultrasound-assisted extraction (UAE) significantly (p < 0.05) influenced the triacylglycerol profile of papaya seed oil, but no significant differences were observed in the fatty acid composition of papaya seed oil extracted by different extraction methods (SXE, SE and UAE) and conditions.

Canopy warming caused photosynthetic acclimation and reduced seed yield in maize grown at ambient and elevated [CO2 ].

PubMed

Ruiz-Vera, Ursula M; Siebers, Matthew H; Drag, David W; Ort, Donald R; Bernacchi, Carl J

2015-11-01

Rising atmospheric CO2 concentration ([CO2 ]) and attendant increases in growing season temperature are expected to be the most important global change factors impacting production agriculture. Although maize is the most highly produced crop worldwide, few studies have evaluated the interactive effects of elevated [CO2 ] and temperature on its photosynthetic physiology, agronomic traits or biomass, and seed yield under open field conditions. This study investigates the effects of rising [CO2 ] and warmer temperature, independently and in combination, on maize grown in the field throughout a full growing season. Free-air CO2 enrichment (FACE) technology was used to target atmospheric [CO2 ] to 200 μmol mol(-1) above ambient [CO2 ] and infrared heaters to target a plant canopy increase of 3.5 °C, with actual season mean heating of ~2.7 °C, mimicking conditions predicted by the second half of this century. Photosynthetic gas-exchange parameters, leaf nitrogen and carbon content, leaf water potential components, and developmental measurements were collected throughout the season, and biomass and yield were measured at the end of the growing season. As predicted for a C4 plant, elevated [CO2 ] did not stimulate photosynthesis, biomass, or yield. Canopy warming caused a large shift in aboveground allocation by stimulating season-long vegetative biomass and decreasing reproductive biomass accumulation at both CO2 concentrations, resulting in decreased harvest index. Warming caused a reduction in photosynthesis due to down-regulation of photosynthetic biochemical parameters and the decrease in the electron transport rate. The reduction in seed yield with warming was driven by reduced photosynthetic capacity and by a shift in aboveground carbon allocation away from reproduction. This field study portends that future warming will reduce yield in maize, and this will not be mitigated by higher atmospheric [CO2 ] unless appropriate adaptation traits can be introduced

Phosphorus, zinc, and boron influence yield components in Earliglow strawberry

DOE Office of Scientific and Technical Information (OSTI.GOV)

May, G.M.; Pritts, M.P.

1993-01-01

The main effects and interactions of soil-applied P, B, and Zn on yield and its components were examined in the field at two pH levels with Earliglow' strawberries (Fragaria ananassa Duch.). Applied nutrients had significant effects on several yield components, but responses depended on the levels of other nutrients or the soil pH. At a soil pH of 5.5, yield responded linearly to B and quadratically to P. At pH 6.5, P interacted with B and Zn. Fruit count per inflorescence was the yield component most strongly associated with yield, followed by individual fruit weight. However, these two yield componentsmore » responded differently to soil-applied nutrients. Foliar nutrient levels generally did not increase with the amount of applied nutrient, but often an applied nutrient had a strong effect on the level of another nutrient. Leaf nutrient levels were often correlated with fruit levels, but foliar and fruit levels at harvest were not related to reproductive performance. The study identifies some of the problems inherent in using foliar nutrient levels to predict a yield response and demonstrates how plant responses to single nutrients depend on soil chemistry and the presence of other nutrients.« less

Birds and bats diverge in the qualitative and quantitative components of seed dispersal of a pioneer tree

NASA Astrophysics Data System (ADS)

Jacomassa, Fábio André F.; Pizo, Marco Aurélio

2010-09-01

Although the overlap in fruit diet between birds and bats is low, they sometimes consume and compete for fruits of the same plant species. What is poorly known is how birds and bats compare with each other in relation to the effectiveness of seed dispersal. In this paper we contrasted birds and bats in relation to quantitative (the amount of fruits removed from plants) and qualitative (germination performance of seeds) components of the seed dispersal of Solanum granuloso- leprosum, a pioneer, small-seeded tree of open areas and forest edges in south Brazil. We tagged fruits on the plants and monitored their removal by day and night. We compared the final percent of germination and speed of germination of seeds ingested by birds and bats with non-ingested, control seeds. While bats removed more fruits than birds, performing better in the quantitative component, birds improved the germination performance of seeds, an aspect of the qualitative component of seed dispersal effectiveness. Although bats are more likely to deposit seeds in highly disturbed sites that favor the recruitment of pioneer plant species, birds frequent forest edges, which is also suitable habitat for S. granuloso- leprosum, We concluded that birds and bats are not 'redundant' seed dispersers for S. granuloso- leprosum because in conjunction they may enhance its recruitment by diversifying the microsites where seeds are deposited, performing in addition different ecological functions in terms of quantity and quality of dispersal.

Evaluation of seeding depth and guage-wheel load effects on maize emergence and yield

USDA-ARS?s Scientific Manuscript database

Planting represents perhaps the most important field operation with errors likely to negatively affect crop yield and thereby farm profitability. Performance of row-crop planters are evaluated by their ability to accurately place seeds into the soil at an adequate and pre-determined depth, the goal ...

The importance of key floral bioactive compounds to honey bees for the detection and attraction of hybrid vegetable crops and increased seed yield.

PubMed

Mas, Flore; Harper, Aimee; Horner, Rachael; Welsh, Taylor; Jaksons, Peter; Suckling, David M

2018-02-15

Crop breeding programmes generally select for traits for improved yield and human consumption preferences. Yet, they often overlook one fundamental trait essential for insect-pollinated crops: pollinator attraction. This is even more critical for hybrid plants that rely on cross-pollination between the male-fertile line and the male-sterile line to set seeds. This study investigated the role of floral odours for honey bee pollination that could explain the poor seed yield in hybrid crops. The key floral bioactive compounds that honey bees detect were identified for three vegetable hybrid crops. It was found that 30% of the variation in bioactive compound quantities was explained by variety. Differences in quantities of the bioactive compounds triggered different degrees of olfactory response and were also associated with varied appetitive response. Correlating the abundance of each bioactive compound with seed yield, it was found that aldehydes such as nonanal and decanal can have a strong negative influence on seed yield with increasing quantity. Using these methodologies to identify relevant bioactive compounds associated with honey bee pollination, plant breeding programmes should also consider selecting for floral traits attractive to honey bees to improve crop pollination for enhanced seed yield. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

Environmental effect on yield, composition and technological seed traits of some Italian ecotypes of grass pea (Lathyrus sativus L.).

PubMed

Piergiovanni, Angela R; Lupo, Francesco; Zaccardelli, Massimo

2011-01-15

Grass pea seeds are a good source of vegetable proteins, but the presence of toxic and antinutritional compounds represents a barrier to their large-scale use as food or animal feed. How much growing location and/or seasonal climate might affect the storage of these factors has been little investigated. Fourteen Italian ecotypes of grass pea were cultivated in two locations in southern Italy characterised by different climatic conditions. The seven ecotypes with the best yields and/or seed quality were investigated for a further two growing seasons. From a statistical point of view the physicochemical and nutritional traits among ecotypes were not the same from one year to the next. Moreover, a significant positive correlation was found between β-oxalyl-diamino-propionic acid and trypsin inhibitor contents. The lowest levels of both these compounds were associated with the highest amount of rainfall during the plant vegetative cycle. Principal component analysis of the data showed that the overall seed composition was affected by the growing location. Consequently, each grass pea genotype should also be carefully investigated in relation to different environments before being considered for release as safe for widespread human or animal consumption. Copyright © 2010 Society of Chemical Industry.

Engineering Camelina sativa (L.) Crantz for enhanced oil and seed yields by combining diacylglycerol acyltransferase1 and glycerol-3-phosphate dehydrogenase expression.

PubMed

Chhikara, Sudesh; Abdullah, Hesham M; Akbari, Parisa; Schnell, Danny; Dhankher, Om Parkash

2018-05-01

Plant seed oil-based liquid transportation fuels (i.e., biodiesel and green diesel) have tremendous potential as environmentally, economically and technologically feasible alternatives to petroleum-derived fuels. Due to their nutritional and industrial importance, one of the major objectives is to increase the seed yield and oil production of oilseed crops via biotechnological approaches. Camelina sativa, an emerging oilseed crop, has been proposed as an ideal crop for biodiesel and bioproduct applications. Further increase in seed oil yield by increasing the flux of carbon from increased photosynthesis into triacylglycerol (TAG) synthesis will make this crop more profitable. To increase the oil yield, we engineered Camelina by co-expressing the Arabidopsis thaliana (L.) Heynh. diacylglycerol acyltransferase1 (DGAT1) and a yeast cytosolic glycerol-3-phosphate dehydrogenase (GPD1) genes under the control of seed-specific promoters. Plants co-expressing DGAT1 and GPD1 exhibited up to 13% higher seed oil content and up to 52% increase in seed mass compared to wild-type plants. Further, DGAT1- and GDP1-co-expressing lines showed significantly higher seed and oil yields on a dry weight basis than the wild-type controls or plants expressing DGAT1 and GPD1 alone. The oil harvest index (g oil per g total dry matter) for DGTA1- and GPD1-co-expressing lines was almost twofold higher as compared to wild type and the lines expressing DGAT1 and GPD1 alone. Therefore, combining the overexpression of TAG biosynthetic genes, DGAT1 and GPD1, appears to be a positive strategy to achieve a synergistic effect on the flux through the TAG synthesis pathway, and thereby further increase the oil yield. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Yield and seed oil content response of dwarf, rapid-cycling Brassica to nitrogen treatments, planting density, and carbon dioxide enrichment

NASA Technical Reports Server (NTRS)

Frick, J.; Nielsen, S. S.; Mitchell, C. A.

1994-01-01

Effects of N level (15 to 30 mM), time of N increase (14 to 28 days after planting), and planting density (1163 to 2093 plants/m2) were determined for crop yield responses of dwarf, rapid-cycling brassica (Brassica napus L., CrGC 5-2, Genome: ACaacc). Crops were grown in solid-matrix hydroponic systems and under controlled-environment conditions, including nonsupplemented (ambient) or elevated CO2 concentrations (998 +/- 12 micromoles mol-1). The highest seed yield rate obtained (4.4 g m-2 day-1) occurred with the lowest N level (15 mM) applied at the latest treatment time (day 28). In all trials, CO2 enrichment reduced seed yield rate and harvest index by delaying the onset of flowering and senescence and stimulating vegetative shoot growth. The highest shoot biomass accumulation rate (55.5 g m-2 day-1) occurred with the highest N level (30 mM) applied at the earliest time (day 14). Seed oil content was not significantly affected by CO2 enrichment. Maximum seed oil content (30% to 34%, dry weight basis) was obtained using the lowest N level (15 mM) initiated at the latest treatment time (day 28). In general, an increase in seed oil content was accompanied by a decrease in seed protein. Seed carbohydrate, moisture, and ash contents did not vary significantly in response to experimental treatments. Effects of N level and time of N increase were consistently significant for most crop responses. Planting density was significant only under elevated CO2 conditions.

Impact of Lygus spp. (Hemiptera: Miridae) on damage, yield and quality of lesquerella (Physaria fendleri), a potential new oil-seed crop.

PubMed

Naranjo, Steven E; Ellsworth, Peter C; Dierig, David A

2011-10-01

Lesquerella, Physaria fendleri (A. Gray) S. Watson, is a mustard native to the western United States and is currently being developed as a commercial source of valuable hydroxy fatty acids that can be used in a number of industrial applications, including biolubricants, biofuel additives, motor oils, resins, waxes, nylons, plastics, corrosion inhibitors, cosmetics, and coatings. The plant is cultivated as a winter-spring annual and in the desert southwest it harbors large populations of arthropods, several of which could be significant pests once production expands. Lygus spp. (Hemiptera: Miridae) are common in lesquerella and are known pests of a number of agronomic and horticultural crops where they feed primarily on reproductive tissues. A 4-yr replicated plot study was undertaken to evaluate the probable impact of Lygus spp. on production of this potential new crop. Plant damage and subsequent seed yield and quality were examined relative to variable and representative densities of Lygus spp. (0.3-4.9 insects per sweep net) resulting from variable frequency and timing of insecticide applications. Increasing damage to various fruiting structures (flowers [0.9-13.9%], buds [1.2-7.1%], and seed pods [19.4-42.5%]) was significantly associated with increasing pest abundance, particularly the abundance of nymphs, in all years. This damage, however, did not consistently translate into reductions in seed yield (481-1,336 kg/ha), individual seed weight (0.5-0.7 g per 1,000 seed), or seed oil content (21.8-30.4%), and pest abundance generally explained relatively little of the variation in crop yield and quality. Negative effects on yield were not sensitive to the timing of pest damage (early versus late season) but were more pronounced during years when potential yields were lower due to weed competition and other agronomic factors. Results suggest that if the crop is established and managed in a more optimal fashion, Lygus spp. may not significantly limit yield

Seed priming with iron and zinc in bread wheat: effects in germination, mitosis and grain yield.

PubMed

Reis, Sara; Pavia, Ivo; Carvalho, Ana; Moutinho-Pereira, José; Correia, Carlos; Lima-Brito, José

2018-07-01

Currently, the biofortification of crops like wheat with micronutrients such as iron (Fe) and zinc (Zn) is extremely important due to the deficiencies of these micronutrients in the human diet and in soils. Agronomic biofortification with Fe and Zn can be done through different exogenous strategies such as soil application, foliar spraying, and seed priming. However, the excess of these micronutrients can be detrimental to the plants. Therefore, in the last decade, a high number of studies focused on the evaluation of their phytotoxic effects to define the best strategies for biofortification of bread wheat. In this study, we investigated the effects of seed priming with different dosages (1 mg L -1 to 8 mg L -1 ) of Fe and/or Zn in germination, mitosis and yield of bread wheat cv. 'Jordão' when compared with control. Overall, our results showed that: micronutrient dosages higher than 4 mg L -1 negatively affect the germination; Fe and/or Zn concentrations higher than 2 mg L -1 significantly decrease the mitotic index and increase the percentage of dividing cells with anomalies; treatments performed with 8 mg L -1 of Fe and/or 8 mg L -1 Zn caused negative effects in germination, mitosis and grain yield. Moreover, seed priming with 2 mg L -1 Fe + 2 mg L -1 Zn has been shown to be non-cytotoxic, ensuring a high rate of germination (80%) and normal dividing cells (90%) as well as improving tillering and grain yield. This work revealed that seed priming with Fe and Zn micronutrients constitutes a useful and alternative approach for the agronomic biofortification of bread wheat.

Historical gains in soybean (Glycine max Merr.) seed yield are driven by linear increases in light interception, energy conversion, and partitioning efficiencies

PubMed Central

Koester, Robert P.; Skoneczka, Jeffrey A.; Cary, Troy R.; Diers, Brian W.; Ainsworth, Elizabeth A.

2014-01-01

Soybean (Glycine max Merr.) is the world’s most widely grown leguminous crop and an important source of protein and oil for food and feed. Soybean yields have increased substantially throughout the past century, with yield gains widely attributed to genetic advances and improved cultivars as well as advances in farming technology and practice. Yet, the physiological mechanisms underlying the historical improvements in soybean yield have not been studied rigorously. In this 2-year experiment, 24 soybean cultivars released between 1923 and 2007 were grown in field trials. Physiological improvements in the efficiencies by which soybean canopies intercepted light (εi), converted light energy into biomass (εc), and partitioned biomass into seed (εp) were examined. Seed yield increased by 26.5kg ha–1 year–1, and the increase in seed yield was driven by improvements in all three efficiencies. Although the time to canopy closure did not change in historical soybean cultivars, extended growing seasons and decreased lodging in more modern lines drove improvements in εi. Greater biomass production per unit of absorbed light resulted in improvements in εc. Over 84 years of breeding, soybean seed biomass increased at a rate greater than total aboveground biomass, resulting in an increase in εp. A better understanding of the physiological basis for yield gains will help to identify targets for soybean improvement in the future. PMID:24790116

Growth, pod, and seed yield, and gas exchange of hydroponically grown peanut in response to CO2 enrichment

NASA Technical Reports Server (NTRS)

Stanciel, K.; Mortley, D. G.; Hileman, D. R.; Loretan, P. A.; Bonsi, C. K.; Hill, W. A.

2000-01-01

The effects of elevated CO2 on growth, pod, and seed yield, and gas exchange of 'Georgia Red' peanut (Arachis hypogaea L.) were evaluated under controlled environmental conditions. Plants were exposed to concentrations of 400 (ambient), 800, and 1200 micromoles mol-1 CO2 in reach-in growth chambers. Foliage fresh and dry weights increased with increased CO2 up to 800 micromoles mol-1, but declined at 1200 micromoles mol-1. The number and the fresh and dry weights of pods also increased with increasing CO2 concentration. However, the yield of immature pods was not significantly influenced by increased CO2. Total seed yield increased 33% from ambient to 800 micromoles mol-1 CO2, and 4% from 800 to 1200 micromoles mol-1 CO2. Harvest index increased with increasing CO2. Branch length increased while specific leaf area decreased linearly as CO2 increased from ambient to 1200 micromoles mol-1. Net photosynthetic rate was highest among plants grown at 800 micromoles mol-1. Stomatal conductance decreased with increased CO2. Carboxylation efficiency was similar among plants grown at 400 and 800 micromoles mol-1 and decreased at 1200 micromoles mol-1 CO2. These results suggest that CO2 enrichment from 400 to 800 micromoles mol-1 had positive effects on peanut growth and yield, but above 800 micromoles mol-1 enrichment seed yield increased only marginally.

Identifying seedling root architectural traits associated with yield and yield components in wheat.

PubMed

Xie, Quan; Fernando, Kurukulasuriya M C; Mayes, Sean; Sparkes, Debbie L

2017-05-01

Plant roots growing underground are critical for soil resource acquisition, anchorage and plant-environment interactions. In wheat ( Triticum aestivum ), however, the target root traits to improve yield potential still remain largely unknown. This study aimed to identify traits of seedling root system architecture (RSA) associated with yield and yield components in 226 recombinant inbred lines (RILs) derived from a cross between the bread wheat Triticum aestivum 'Forno' (small, wide root system) and spelt Triticum spelta 'Oberkulmer' (large, narrow root system). A 'pouch and wick' high-throughput phenotyping pipeline was used to determine the RSA traits of 13-day-old RIL seedlings. Two field experiments and one glasshouse experiment were carried out to investigate the yield, yield components and phenology, followed by identification of quantitative trait loci (QTLs). There was substantial variation in RSA traits between genotypes. Seminal root number and total root length were both positively associated with grains m -2 , grains per spike, above-ground biomass m -2 and grain yield. More seminal roots and longer total root length were also associated with delayed maturity and extended grain filling, likely to be a consequence of more grains being defined before anthesis. Additionally, the maximum width of the root system displayed positive relationships with spikes m -2 , grains m -2 and grain yield. Ten RILs selected for the longest total roots exhibited the same effects on yield and phenology as described above, compared with the ten lines with the shortest total roots. Genetic analysis revealed 38 QTLs for the RSA, and QTL coincidence between the root and yield traits was frequently observed, indicating tightly linked genes or pleiotropy, which concurs with the results of phenotypic correlation analysis. Based on the results from the Forno × Oberkulmer population, it is proposed that vigorous early root growth, particularly more seminal roots and longer total

A High-Resolution InDel (Insertion–Deletion) Markers-Anchored Consensus Genetic Map Identifies Major QTLs Governing Pod Number and Seed Yield in Chickpea

PubMed Central

Srivastava, Rishi; Singh, Mohar; Bajaj, Deepak; Parida, Swarup K.

2016-01-01

Development and large-scale genotyping of user-friendly informative genome/gene-derived InDel markers in natural and mapping populations is vital for accelerating genomics-assisted breeding applications of chickpea with minimal resource expenses. The present investigation employed a high-throughput whole genome next-generation resequencing strategy in low and high pod number parental accessions and homozygous individuals constituting the bulks from each of two inter-specific mapping populations [(Pusa 1103 × ILWC 46) and (Pusa 256 × ILWC 46)] to develop non-erroneous InDel markers at a genome-wide scale. Comparing these high-quality genomic sequences, 82,360 InDel markers with reference to kabuli genome and 13,891 InDel markers exhibiting differentiation between low and high pod number parental accessions and bulks of aforementioned mapping populations were developed. These informative markers were structurally and functionally annotated in diverse coding and non-coding sequence components of genome/genes of kabuli chickpea. The functional significance of regulatory and coding (frameshift and large-effect mutations) InDel markers for establishing marker-trait linkages through association/genetic mapping was apparent. The markers detected a greater amplification (97%) and intra-specific polymorphic potential (58–87%) among a diverse panel of cultivated desi, kabuli, and wild accessions even by using a simpler cost-efficient agarose gel-based assay implicating their utility in large-scale genetic analysis especially in domesticated chickpea with narrow genetic base. Two high-density inter-specific genetic linkage maps generated using aforesaid mapping populations were integrated to construct a consensus 1479 InDel markers-anchored high-resolution (inter-marker distance: 0.66 cM) genetic map for efficient molecular mapping of major QTLs governing pod number and seed yield per plant in chickpea. Utilizing these high-density genetic maps as anchors, three major

Adaptation of six shallots varieties to phosphate solubilizing bacteria on the flower formation, seeds fromation, and yields on the lowland

NASA Astrophysics Data System (ADS)

Triharyanto, E.; Sudadi; Rawandari, S.

2018-03-01

Using seeds as planting materials is a solution to improve the quality and quantity of shallot. This study aims to determine the interaction between shallot varieties and Phosphate- Solubilizing Bacteria (PSB) on the flowering and shallot yield on the lowlands. The research was conducted in Mijil Village, Jaten, Karanganyar, 98 m altitude with Vertisol-type soil order in June to December 2016, using Randomized Complete Block Design (RCBD) with two factors. Shallot varieties used as factors are Bima, Manjung, Ilokos, Bima (bulb seeds), Mentes and Rubaru. PSB factors are control and with PSB inoculation. Observed variables included plant height, number of leaves, flowering percentage, seed formation and shallot bulb yield. Results showed that there was no interaction between varieties and PSB inoculation on all observed variables. However, PSB inoculation were able to increase the number of flowering plants and seed weight per plot. Bima variety have the highest average yield compared to other varieties in terms of number of leaves, number of bulbs per plant and bulb weight per plot (fresh harvest weight 317.74 g equivalent to 17.65 ton per hectare and dry weight 288.16 g consumption equivalent to 16 ton per hectare).

Effects of Presowing Pulsed Electromagnetic Treatment of Tomato Seed on Growth, Yield, and Lycopene Content

PubMed Central

Efthimiadou, Aspasia; Katsenios, Nikolaos; Papastylianou, Panayiota; Triantafyllidis, Vassilios; Travlos, Ilias; Bilalis, Dimitrios J.

2014-01-01

The use of magnetic field as a presowing treatment has been adopted by researchers as a new environmental friendly technique. The aim of this study was to determine the effect of magnetic field exposure on tomato seeds covering a range of parameters such as transplanting percentage, plant height, shoot diameter, number of leaves per plant, fresh weight, dry weight, number of flowers, yield, and lycopene content. Pulsed electromagnetic field was used for 0, 5, 10, and 15 minutes as a presowing treatment of tomato seeds in a field experiment for two years. Papimi device (amplitude on the order of 12.5 mT) has been used. The use of pulsed electromagnetic field as a presowing treatment was found to enhance plant growth in tomato plants at certain duration of exposure. Magnetic field treatments and especially the exposure of 10 and 15 minutes gave the best results in all measurements, except plant height and lycopene content. Yield per plant was higher in magnetic field treatments, compared to control. MF-15 treatment yield was 80.93% higher than control treatment. Lycopene content was higher in magnetic field treatments, although values showed no statistically significant differences. PMID:25097875

Suppression of the SUGAR-DEPENDENT1 triacylglycerol lipase family during seed development enhances oil yield in oilseed rape (Brassica napus L.).

PubMed

Kelly, Amélie A; Shaw, Eve; Powers, Stephen J; Kurup, Smita; Eastmond, Peter J

2013-04-01

Increasing the productivity of oilseed crops is an important challenge for plant breeders and biotechnologists. To date, attempts to increase oil production in seeds via metabolic pathway engineering have focused on boosting synthetic capacity. However, in the tissues of many organisms, it is well established that oil levels are determined by both anabolism and catabolism. Indeed, the oil content of rapeseed (Brassica napus L.) has been reported to decline by approximately 10% in the final stage of development, as the seeds desiccate. Here, we show that RNAi suppression of the SUGAR-DEPENDENT1 triacylglycerol lipase gene family during seed development results in up to an 8% gain in oil yield on either a seed, plant or unit area basis in the greenhouse, with very little adverse impact on seed vigour. Suppression of lipolysis could therefore constitute a new method for enhancing oil yield in oilseed crops. © 2012 The Authors Plant Biotechnology Journal © 2012 Society for Experimental Biology, Association of Applied Biologists and Blackwell Publishing Ltd.

Evaluation of Exotically-Derived Soybean Breeding Lines for Seed Yield, Germination, Damage, and Composition under Dryland Production in the Midsouthern USA

PubMed Central

Bellaloui, Nacer; Smith, James R.; Mengistu, Alemu; Ray, Jeffery D.; Gillen, Anne M.

2017-01-01

Although the Early Soybean Production System (ESPS) in the Midsouthern USA increased seed yield under irrigated and non-irrigated conditions, heat stress and drought still lead to poor seed quality in heat sensitive soybean cultivars. Our breeding goal was to identify breeding lines that possess high germination, nutritional quality, and yield potential under high heat and dryland production conditions. Our hypothesis was that breeding lines derived from exotic germplasm might possess physiological and genetic traits allowing for higher seed germinability under high heat conditions. In a 2-year field experiment, breeding lines derived from exotic soybean accessions, previously selected for adaptability to the ESPS in maturity groups (MG) III and IV, were grown under non-irrigated conditions. Results showed that three exotic breeding lines had consistently superior germination across 2 years. These lines had a mean germination percentage of >80%. Two (25-1-1-4-1-1 and 34-3-1-2-4-1) out of the three lines with ≥80% germination in both years maintained high seed protein, oleic acid, N, P, K, B, Cu, and Mo in both years. Significant (P < 0.05) positive correlations were found between germination and oleic acid and with K and Cu in both years. Significant negative correlations were found between germination and linoleic acid, Ca, and hard seed in both years. There were positive correlations between germination and N, P, B, Mo, and palmitic acid only in 2013. A negative correlation was found between germination and green seed damage and linolenic acid in 2013 only. Seed wrinkling was significantly negatively correlated with germination in 2012 only. A lower content of Ca in the seed of high germinability genotypes may explain the lower rates of hard seed in those lines, which could lead to higher germination. Many of the differences in yield, germination, diseases, and seed composition between years are likely due to heat and rainfall differences between years. The

Soil nitrogen dynamics in switchgrass seeded to a marginally yielding cropland of South Dakota

USDA-ARS?s Scientific Manuscript database

Soil nitrate (NO3-), nitrate leaching, and nitrous oxide (N2O) emissions for 2009 through 2015 were monitored to explore N dynamics in switchgrass (Panicum virgatum L.) seeded to a marginally yielding cropland. Our findings indicated that N rate impacted soil NO3- (0-5 cm depth) and soil surface N2O...

Historical gains in soybean (Glycine max Merr.) seed yield are driven by linear increases in light interception, energy conversion, and partitioning efficiencies.

PubMed

Koester, Robert P; Skoneczka, Jeffrey A; Cary, Troy R; Diers, Brian W; Ainsworth, Elizabeth A

2014-07-01

Soybean (Glycine max Merr.) is the world's most widely grown leguminous crop and an important source of protein and oil for food and feed. Soybean yields have increased substantially throughout the past century, with yield gains widely attributed to genetic advances and improved cultivars as well as advances in farming technology and practice. Yet, the physiological mechanisms underlying the historical improvements in soybean yield have not been studied rigorously. In this 2-year experiment, 24 soybean cultivars released between 1923 and 2007 were grown in field trials. Physiological improvements in the efficiencies by which soybean canopies intercepted light (εi), converted light energy into biomass (εc), and partitioned biomass into seed (εp) were examined. Seed yield increased by 26.5kg ha(-1) year(-1), and the increase in seed yield was driven by improvements in all three efficiencies. Although the time to canopy closure did not change in historical soybean cultivars, extended growing seasons and decreased lodging in more modern lines drove improvements in εi. Greater biomass production per unit of absorbed light resulted in improvements in εc. Over 84 years of breeding, soybean seed biomass increased at a rate greater than total aboveground biomass, resulting in an increase in εp. A better understanding of the physiological basis for yield gains will help to identify targets for soybean improvement in the future. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Photomorphogenesis, photosynthesis, and seed yield of wheat plants grown under red light-emitting diodes (LEDs) with and without supplemental blue lighting

NASA Technical Reports Server (NTRS)

Goins, G. D.; Yorio, N. C.; Sanwo, M. M.; Brown, C. S.; Sager, J. C. (Principal Investigator)

1997-01-01

Red light-emitting diodes (LEDs) are a potential light source for growing plants in spaceflight systems because of their safety, small mass and volume, wavelength specificity, and longevity. Despite these attractive features, red LEDs must satisfy requirements for plant photosynthesis and photomorphogenesis for successful growth and seed yield. To determine the influence of gallium aluminium arsenide (GaAlAs) red LEDs on wheat photomorphogenesis, photosynthesis, and seed yield, wheat (Triticum aestivum L., cv. 'USU-Super Dwarf') plants were grown under red LEDs and compared to plants grown under daylight fluorescent (white) lamps and red LEDs supplemented with either 1% or 10% blue light from blue fluorescent (BF) lamps. Compared to white light-grown plants, wheat grown under red LEDs alone demonstrated less main culm development during vegetative growth through preanthesis, while showing a longer flag leaf at 40 DAP and greater main culm length at final harvest (70 DAP). As supplemental BF light was increased with red LEDs, shoot dry matter and net leaf photosynthesis rate increased. At final harvest, wheat grown under red LEDs alone displayed fewer subtillers and a lower seed yield compared to plants grown under white light. Wheat grown under red LEDs+10% BF light had comparable shoot dry matter accumulation and seed yield relative to wheat grown under white light. These results indicate that wheat can complete its life cycle under red LEDs alone, but larger plants and greater amounts of seed are produced in the presence of red LEDs supplemented with a quantity of blue light.

Antibacterial activity of essential oil components and their potential use in seed disinfection.

PubMed

Lo Cantore, Pietro; Shanmugaiah, Vellasamy; Iacobellis, Nicola Sante

2009-10-28

Among the main (> or = 0.7%) components of some essential oils, considerable antibacterial activity was shown by terpenoid and phenylpropanoid derivatives containing phenol and alcohol functionalities. A reduced or no activity was shown by those derivatives containing ketones, aldehydes, ethers, and ester functionalities as well as the remaining terpenoids. Eugenol emulsion treatments (1-8 mg/mL) of bean seeds bearing about 2.6 x 10(6) cfu/seed of strain ICMP239 of Xanthomonas campestris pv. phaseoli var. fuscans determined a highly significant reduction of the bacteria on seeds. In particular, eugenol at 4 mg/mL disinfect seeds bearing about 7.0 x 10(2) cfu/seed and lower densities. However, after 72 h, incubation treatments with 2, 4, and 8 mg/mL of eugenol caused germination reduction of 3%, 7%, and 16%, respectively, which was significantly different from the controls. No effect on germination was observed with 1 mg/mL eugenol emulsion treatment. These data indicate eugenol as potentially useful for bean seed disinfection from X. campestris pv. phaseoli var. fuscans. Further studies on the effects on seed vitality and on formulation of essential oils are needed.

Dissection of genotype × environment interactions for mucilage and seed yield in Plantago species: Application of AMMI and GGE biplot analyses

PubMed Central

Shahriari, Zolfaghar; Dadkhodaie, Ali

2018-01-01

Genotype × environment interaction (GEI) is an important aspect of both plant breeding and the successful introduction of new cultivars. In the present study, additive main effects and multiplicative interactions (AMMI) and genotype (G) main effects and genotype (G) × environment (E) interaction (GGE) biplot analyses were used to identify stable genotypes and to dissect GEI in Plantago. In total, 10 managed field trials were considered as environments to analyze GEI in thirty genotypes belonging to eight Plantago species. Genotypes were evaluated in a drought stress treatment and in normal irrigation conditions at two locations in Shiraz (Bajgah) for three years (2013-2014- 2015) and Kooshkak (Marvdasht, Fars, Iran) for two years (2014–2015). Three traits, seed yield and mucilage yield and content, were measured at each experimental site and in natural Plantago habitats. AMMI2 biplot analyses identified genotypes from several species with higher stability for seed yield and other genotypes with stable mucilage content and yield. P. lanceolata (G26), P. officinalis (G10), P. ovata (G14), P. ampleexcaulis (G11) and P. major (G4) had higher stability for seed yield. For mucilage yield, G21, G18 and G20 (P. psyllium), G1, G2 and G4 (P. major), G9 and G10 (P. officinalis) and P. lanceolata were identified as stable. G13 (P. ovata), G5 and G6 (P. major) and G30 (P. lagopus) had higher stability for mucilage content. No one genotype was found to have high levels of stability for more than one trait but some species had more than one genotype exhibiting stable trait performance. Based on trait variation, GGE biplot analysis identified two representative environments, one for seed yield and one for mucilage yield and content, with good discriminating ability. The identification of stable genotypes and representative environments should assist the breeding of new Plantago cultivars. PMID:29715274

Dissection of genotype × environment interactions for mucilage and seed yield in Plantago species: Application of AMMI and GGE biplot analyses.

PubMed

Shahriari, Zolfaghar; Heidari, Bahram; Dadkhodaie, Ali

2018-01-01

Genotype × environment interaction (GEI) is an important aspect of both plant breeding and the successful introduction of new cultivars. In the present study, additive main effects and multiplicative interactions (AMMI) and genotype (G) main effects and genotype (G) × environment (E) interaction (GGE) biplot analyses were used to identify stable genotypes and to dissect GEI in Plantago. In total, 10 managed field trials were considered as environments to analyze GEI in thirty genotypes belonging to eight Plantago species. Genotypes were evaluated in a drought stress treatment and in normal irrigation conditions at two locations in Shiraz (Bajgah) for three years (2013-2014- 2015) and Kooshkak (Marvdasht, Fars, Iran) for two years (2014-2015). Three traits, seed yield and mucilage yield and content, were measured at each experimental site and in natural Plantago habitats. AMMI2 biplot analyses identified genotypes from several species with higher stability for seed yield and other genotypes with stable mucilage content and yield. P. lanceolata (G26), P. officinalis (G10), P. ovata (G14), P. ampleexcaulis (G11) and P. major (G4) had higher stability for seed yield. For mucilage yield, G21, G18 and G20 (P. psyllium), G1, G2 and G4 (P. major), G9 and G10 (P. officinalis) and P. lanceolata were identified as stable. G13 (P. ovata), G5 and G6 (P. major) and G30 (P. lagopus) had higher stability for mucilage content. No one genotype was found to have high levels of stability for more than one trait but some species had more than one genotype exhibiting stable trait performance. Based on trait variation, GGE biplot analysis identified two representative environments, one for seed yield and one for mucilage yield and content, with good discriminating ability. The identification of stable genotypes and representative environments should assist the breeding of new Plantago cultivars.

Evaluation of exotically-derived soybean breeding lines for seed yield, germination, damage, and composition under dryland production in the midsouthern USA

USDA-ARS?s Scientific Manuscript database

Although the Early Soybean Production System (ESPS) in the Midsouthern USA increased seed yield under irrigated and non-irrigated conditions, heat stress and drought still lead to poor seed quality in heat sensitive soybean cultivars. Our goal was to identify breeding lines that possess high germin...

Adaptability and stability of soybean cultivars for grain yield and seed quality.

PubMed

Silva, K B; Bruzi, A T; Zambiazzi, E V; Soares, I O; Pereira, J L A R; Carvalho, M L M

2017-05-10

This study aimed at verifying the adaptability and stability of soybean cultivars, considering the grain yield and quality of seeds, adopting univariate and multivariate approaches. The experiments were conducted in two crops, three environments, in 2013/2014 and 2014/2015 crop seasons, in the county of Inconfidentes, Lavras, and Patos de Minas, in the Minas Gerais State, Brazil. We evaluated 17 commercial soybean cultivars. For adaptability and stability evaluations, the Graphic and GGE biplot methods were employed. Previously, a selection index was estimated based on the sum of the standardized variables (Z index). The data relative to grain yield, mass of one thousand grain, uniformity test (sieve retention), and germination test were standardized (Z ij ) per cultivar. With the sum of Z ij , we obtained the selection index for the four traits evaluated together. In the Graphic method evaluation, cultivars NA 7200 RR and CD 2737 RR presented the highest values for selection index Z. By the GGE biplot method, we verified that cultivar NA 7200 RR presented greater stability in both univariate evaluations, for grain yield, and for selection index Z.

Estimation of genetic parameters and selection of high-yielding, upright common bean lines with slow seed-coat darkening.

PubMed

Alvares, R C; Silva, F C; Melo, L C; Melo, P G S; Pereira, H S

2016-11-21

Slow seed coat darkening is desirable in common bean cultivars and genetic parameters are important to define breeding strategies. The aims of this study were to estimate genetic parameters for plant architecture, grain yield, grain size, and seed-coat darkening in common bean; identify any genetic association among these traits; and select lines that associate desirable phenotypes for these traits. Three experiments were set up in the winter 2012 growing season, in Santo Antônio de Goiás and Brasília, Brazil, including 220 lines obtained from four segregating populations and five parents. A triple lattice 15 x 15 experimental design was used. The traits evaluated were plant architecture, grain yield, grain size, and seed-coat darkening. Analyses of variance were carried out and genetic parameters such as heritability, gain expected from selection, and correlations, were estimated. For selection of superior lines, a "weight-free and parameter-free" index was used. The estimates of genetic variance, heritability, and gain expected from selection were high, indicating good possibility for success in selection of the four traits. The genotype x environment interaction was proportionally more important for yield than for the other traits. There was no strong genetic correlation observed among the four traits, which indicates the possibility of selection of superior lines with many traits. Considering simultaneous selection, it was not possible to join high genetic gains for the four traits. Forty-four lines that combined high yield, more upright plant architecture, slow darkening grains, and commercial grade size were selected.

Fine phenotyping of pod and seed traits in Arachis germplasm accessions using digital image analysis

USDA-ARS?s Scientific Manuscript database

Reliable and objective phenotyping of peanut pod and seed traits is important for cultivar selection and genetic mapping of yield components. To develop useful and efficient methods to quantitatively define peanut pod and seed traits, a group of peanut germplasm with high levels of phenotypic varia...

Seed vigour and crop establishment: extending performance beyond adaptation.

PubMed

Finch-Savage, W E; Bassel, G W

2016-02-01

Seeds are central to crop production, human nutrition, and food security. A key component of the performance of crop seeds is the complex trait of seed vigour. Crop yield and resource use efficiency depend on successful plant establishment in the field, and it is the vigour of seeds that defines their ability to germinate and establish seedlings rapidly, uniformly, and robustly across diverse environmental conditions. Improving vigour to enhance the critical and yield-defining stage of crop establishment remains a primary objective of the agricultural industry and the seed/breeding companies that support it. Our knowledge of the regulation of seed germination has developed greatly in recent times, yet understanding of the basis of variation in vigour and therefore seed performance during the establishment of crops remains limited. Here we consider seed vigour at an ecophysiological, molecular, and biomechanical level. We discuss how some seed characteristics that serve as adaptive responses to the natural environment are not suitable for agriculture. Past domestication has provided incremental improvements, but further actively directed change is required to produce seeds with the characteristics required both now and in the future. We discuss ways in which basic plant science could be applied to enhance seed performance in crop production. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Yield and quality attributes of faba bean inbred lines grown under marginal environmental conditions of Sudan.

PubMed

Gasim, Seif; Hamad, Solafa A A; Abdelmula, Awadalla; Mohamed Ahmed, Isam A

2015-11-01

Faba beans (Vicia faba L.) represent an essential source of food protein for many people in Sudan, especially those who cannot afford to buy animal meat. The demand for faba bean seeds is greatly increased in recent years, and consequently its production area was extended southward where the climate is marginally suitable. Therefore, this study was aimed to evaluate seed yield and nutritional quality of five faba bean inbred lines grown under marginal environmental conditions of Sudan. The inbred lines have considerable (P ≤ 0.05) variability in yield and yield components, and seed chemical composition. The mean carbohydrate content was very high (501.1 g kg(-1)) and negatively correlated with seed yield, whereas the average protein content was relatively high (253.1 g kg(-1)) and positively correlated with seed yield. Globulin was the significant fraction (613.5 g kg(-1)protein) followed by albumin (200.2 g kg(-1)protein). Biplot analysis indicates that inbred lines Hudeiba/93-S5 and Ed-damar-S5 outscore other lines in terms of seed yield and nutritional quality. This study demonstrates that Hudeiba/93-S5 and Ed-damar-S5 are useful candidates in faba bean breeding program to terminate the protein deficiency malnutrition and provide healthy and nutritious meal for people living in subtropical areas.

Seed-Specific Expression of OsDWF4, a Rate-Limiting Gene Involved in Brassinosteroids Biosynthesis, Improves Both Grain Yield and Quality in Rice.

PubMed

Li, Qian-Feng; Yu, Jia-Wen; Lu, Jun; Fei, Hong-Yuan; Luo, Ming; Cao, Bu-Wei; Huang, Li-Chun; Zhang, Chang-Quan; Liu, Qiao-Quan

2018-04-18

Brassinosteroids (BRs) are essential plant-specific steroidal hormones that regulate diverse growth and developmental processes in plants. We evaluated the effects of OsDWF4, a gene that encodes a rate-limiting enzyme in BR biosynthesis, on both rice yield and quality when driven by the Gt1 or Ubi promoter, which correspond to seed-specific or constitutive expression, respectively. Generally, transgenic plants expressing OsDWF4 showed increased grain yield with more tillers and longer and heavier seeds. Moreover, the starch physicochemical properties of the transgenic rice were also improved. Interestingly, OsDWF4 was found to exert different effects on either rice yield or quality when driven by the different promoters. The overall performance of the pGt1::OsDWF4 lines was better than that of the pUbi::OsDWF4 lines. Our data not only demonstrate the effects of OsDWF4 overexpression on both rice yield and quality but also suggest that a seed-specific promoter is a good choice in BR-mediated rice breeding programs.

Effect of cooking time on some nutrient and antinutrient components of bambaragroundnut seeds.

PubMed

Omoikhoje, Stanley Omoh; Aruna, Mohammed Bashiru; Bamgbose, Adeyemi Mustapha

2009-02-01

The proximate composition, gross energy, mineral composition, percentage sugar, oligosaccharides and antinutrient substances of bambaragroundnut seeds subjected to different cooking times were determined. The seeds were cooked for 30, 60, 90 and 120 min. Results of the proximate analysis showed that only the ether extract and ash were significantly (P < 0.05) reduced as the cooking time increased. In contrast, gross energy values significantly (P < 0.05) increased with increased cooking time. Amongst, the mineral elements assayed, calcium, magnesium and iron were significantly (P < 0.05) increased, while phosphorous, potassium, sodium and copper were reduced significantly (P > 0.05) with inreased cooking time. Percentage sucrose and glucose of bambaragroundnut seeds were significantly (P < 0.05) lowest in the raw form, but increased progressively with increased of cooking time. Raffinose and stachyose levels were reduced significantly by increased cookinf time (P < 0.05) with the least value in seeds cooked for 120 min. Trypsin inhibitor, hemagglutinin and tannin were completely eliminated in seeds cooked for 60 min or longer, but the phytin level was reduced significantly (P < 0.05) by cooking. For a significant detoxification of antinutrient substances and for optimal bioavailability of the component nutrients of bambaragroundnut seeds, an optimum cooking time of 60 min at 100 degrees C is therefore recommended.

Modeling Biometric Traits, Yield and Nutritional and Antioxidant Properties of Seeds of Three Soybean Cultivars Through the Application of Biostimulant Containing Seaweed and Amino Acids

PubMed Central

Kocira, Sławomir; Szparaga, Agnieszka; Kocira, Anna; Czerwińska, Ewa; Wójtowicz, Agnieszka; Bronowicka-Mielniczuk, Urszula; Koszel, Milan; Findura, Pavol

2018-01-01

In recent years, attempts have been made to use preparations that allow obtaining high and good quality yields, while reducing the application of pesticides and mineral fertilizers. These include biostimulants that are safe for the natural environment and contribute to the improvement of yield size and quality, especially after the occurrence of stressors. Their use is advisable in the case of crops sensitive to such biotic stress factors like low temperatures or drought. One of these is soybean which is a very important plant from the economic viewpoint. Field experiments were established in the years 2014-2016 in a random block design in four replicates on experimental plots of 10 m2. Three soybean cultivars: Annushka, Mavka, and Atlanta were planted in the third decade of April. Fylloton biostimulant was used at 0.7% or 1% concentrations as single spraying (BBCH 13-15) or double spraying (BBCH 13-15, BBCH 61) in the vegetation period. The number of seeds per 1 m2, seed yield, thousand seed weight, number of pods per plant, number of nodes in the main shoot, height of plants, and protein and fat contents in seeds were determined. The content of phenolic compounds, antioxidant capacity and antioxidant effect of soybean seeds were assayed as well. Foliar treatment of soybean with Fylloton stimulated the growth and yield of plants without compromising their nutritional and nutraceutical properties. The double application of the higher concentration of Fylloton was favorable for the plant height, seed number and soybean yield. Moreover, the highest number of pods was obtained after single treatment of plants with the lower biostimulant concentration. There was also a positive effect of using this biostimulant on the content and activity of some bioactive compounds, such as phenolics and flavonoids, and on the reducing power. PMID:29636764

Modeling Biometric Traits, Yield and Nutritional and Antioxidant Properties of Seeds of Three Soybean Cultivars Through the Application of Biostimulant Containing Seaweed and Amino Acids.

PubMed

Kocira, Sławomir; Szparaga, Agnieszka; Kocira, Anna; Czerwińska, Ewa; Wójtowicz, Agnieszka; Bronowicka-Mielniczuk, Urszula; Koszel, Milan; Findura, Pavol

2018-01-01

In recent years, attempts have been made to use preparations that allow obtaining high and good quality yields, while reducing the application of pesticides and mineral fertilizers. These include biostimulants that are safe for the natural environment and contribute to the improvement of yield size and quality, especially after the occurrence of stressors. Their use is advisable in the case of crops sensitive to such biotic stress factors like low temperatures or drought. One of these is soybean which is a very important plant from the economic viewpoint. Field experiments were established in the years 2014-2016 in a random block design in four replicates on experimental plots of 10 m 2 . Three soybean cultivars: Annushka, Mavka, and Atlanta were planted in the third decade of April. Fylloton biostimulant was used at 0.7% or 1% concentrations as single spraying (BBCH 13-15) or double spraying (BBCH 13-15, BBCH 61) in the vegetation period. The number of seeds per 1 m 2 , seed yield, thousand seed weight, number of pods per plant, number of nodes in the main shoot, height of plants, and protein and fat contents in seeds were determined. The content of phenolic compounds, antioxidant capacity and antioxidant effect of soybean seeds were assayed as well. Foliar treatment of soybean with Fylloton stimulated the growth and yield of plants without compromising their nutritional and nutraceutical properties. The double application of the higher concentration of Fylloton was favorable for the plant height, seed number and soybean yield. Moreover, the highest number of pods was obtained after single treatment of plants with the lower biostimulant concentration. There was also a positive effect of using this biostimulant on the content and activity of some bioactive compounds, such as phenolics and flavonoids, and on the reducing power.

Improving sustainable seed yield in Wyoming big sagebrush

Treesearch

Jeremiah C. Armstrong

2007-01-01

As part of the Great Basin Restoration Initiative, the effects of browsing, competition removal, pruning, fertilization and seed collection methods on increasing seed production in Wyoming big sagebrush (Artemisia tridentata Nutt. spp wyomingensis Beetle & Young) were studied. Study sites were located in Idaho, Nevada, and Utah. A split-plot...

Sunflower seeds as eliciting agents of Compositae dermatitis.

PubMed

Paulsen, Evy; El-Houri, Rime B; Andersen, Klaus E; Christensen, Lars P

2015-03-01

Sunflowers may cause dermatitis because of allergenic sesquiterpene lactones (SLs). Contact sensitization to sunflower seeds has also been reported, but the allergens are unknown. To analyse sunflower seeds for the presence of SLs and to assess the prevalence of sunflower sensitization in Compositae-allergic individuals. Sunflower-sensitive patients were identified by aimed patch testing. A dichloromethane extract of whole sunflower seeds was analysed by liquid chromatography-mass spectrometry and high-performance liquid chromatography. The prevalence of sensitivity to sunflower in Compositae-allergic individuals was 56%. A solvent wash of whole sunflower seeds yielded an extract containing SLs, the principal component tentatively being identified as argophyllin A or B, other SLs being present in minute amounts. The concentration of SLs on the sunflower seeds is considered high enough to elicit dermatitis in sensitive persons, and it seems appropriate to warn Compositae-allergic subjects against handling sunflower seeds. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Optimization of processing parameters of UAV integral structural components based on yield response

NASA Astrophysics Data System (ADS)

Chen, Yunsheng

2018-05-01

In order to improve the overall strength of unmanned aerial vehicle (UAV), it is necessary to optimize the processing parameters of UAV structural components, which is affected by initial residual stress in the process of UAV structural components processing. Because machining errors are easy to occur, an optimization model for machining parameters of UAV integral structural components based on yield response is proposed. The finite element method is used to simulate the machining parameters of UAV integral structural components. The prediction model of workpiece surface machining error is established, and the influence of the path of walking knife on residual stress of UAV integral structure is studied, according to the stress of UAV integral component. The yield response of the time-varying stiffness is analyzed, and the yield response and the stress evolution mechanism of the UAV integral structure are analyzed. The simulation results show that this method is used to optimize the machining parameters of UAV integral structural components and improve the precision of UAV milling processing. The machining error is reduced, and the deformation prediction and error compensation of UAV integral structural parts are realized, thus improving the quality of machining.

[Effects of simulated acid rain on oilseed rape (Brassica napus) physiological characteristics at flowering stage and yield].

PubMed

Cao, Chun-Xin; Zhou, Qin; Han, Liang-Liang; Zhang, Pei; Jiang, Hai-Dong

2010-08-01

A pot experiment was conducted to study the effects of different acidity simulated acid rain on the physiological characteristics at flowering stage and yield of oilseed rape (B. napus cv. Qinyou 9). Comparing with the control (pH 6.0), weak acidity (pH = 4.0-5.0) simulated acid rain stimulated the rape growth to some extent, but had less effects on the plant biomass, leaf chlorophyll content, photosynthetic characteristics, and yield. With the further increase of acid rain acidity, the plant biomass, leaf chlorophyll content, photosynthetic rate, antioxidative enzyme activities, and non-enzyme antioxidant contents all decreased gradually, while the leaf malonyldialdehyde (MDA) content and relative conductivity increased significantly. As the results, the pod number per plant, seed number per pod, seed weight, and actual yield decreased. However, different yield components showed different sensitivity to simulated acid rain. With the increasing acidity of simulated acid rain, the pod number per plant and the seed number per pod decreased significantly, while the seed weight was less affected.

Natural variation in PTB1 regulates rice seed setting rate by controlling pollen tube growth.

PubMed

Li, Shuangcheng; Li, Wenbo; Huang, Bin; Cao, Xuemei; Zhou, Xingyu; Ye, Shumei; Li, Chengbo; Gao, Fengyan; Zou, Ting; Xie, Kailong; Ren, Yun; Ai, Peng; Tang, Yangfan; Li, Xuemei; Deng, Qiming; Wang, Shiquan; Zheng, Aiping; Zhu, Jun; Liu, Huainian; Wang, Lingxia; Li, Ping

2013-01-01

Grain number, panicle seed setting rate, panicle number and grain weight are the most important components of rice grain yield. To date, several genes related to grain weight, grain number and panicle number have been described in rice. However, no genes regulating the panicle seed setting rate have been functionally characterized. Here we show that the domestication-related POLLEN TUBE BLOCKED 1 (PTB1), a RING-type E3 ubiquitin ligase, positively regulates the rice panicle seed setting rate by promoting pollen tube growth. The natural variation in expression of PTB1 which is affected by the promoter haplotype and the environmental temperature, correlates with the rice panicle seed setting rate. Our results support the hypothesis that PTB1 is an important maternal sporophytic factor of pollen tube growth and a key modulator of the rice panicle seed setting rate. This finding has implications for the improvement of rice yield.

The effect of organic solvent, temperature and mixing time on the production of oil from Moringa oleifera seeds

NASA Astrophysics Data System (ADS)

Ghazali, Q.; Yasin, N. H. M.

2016-06-01

The effect of three different organic solvent, temperature and mixing time on the production of oil from M.oleifera seeds were studied to evaluate the effectiveness in obtaining the high oil yield based on the percentage of oil production. The modified version of Soxhlet extraction method was carried out to extract the oil from M.oleifera seeds by using hexane, heptane and ethanol as the organic solvent. Among the three solvents, it is found that heptane yield higher oil from M.oleifera seeds with maximum oil yield of 36.37% was obtained followed by hexane and ethanol with 33.89% and 18.46%, respectively. By using heptane as a solvent, the temperature (60oC, 70oC, 80oC) and mixing time (6 h, 7 h, and 8 h) were investigated to ensure the high oil yield over the experimental ranges employed and high oil yield was obtained at 600C for 6 h with percentage oil yield of 36.37%. The fatty acid compositions of M.oleifera seeds oil were analyzed using Gas Chromatography/Mass Spectrometry (GC-MS). The main components of fatty acid contained in the oil extracted from M.oleifera seeds was oleic acid, followed by palmitic acid and arachidic acid, and small amount of behenic acid and margaric acid.

Effect of oxidant concentration, exposure time, and seed particles on secondary organic aerosol chemical composition and yield

NASA Astrophysics Data System (ADS)

Lambe, A. T.; Chhabra, P. S.; Onasch, T. B.; Brune, W. H.; Hunter, J. F.; Kroll, J. H.; Cummings, M. J.; Brogan, J. F.; Parmar, Y.; Worsnop, D. R.; Kolb, C. E.; Davidovits, P.

2015-03-01

We performed a systematic intercomparison study of the chemistry and yields of secondary organic aerosol (SOA) generated from OH oxidation of a common set of gas-phase precursors in a Potential Aerosol Mass (PAM) continuous flow reactor and several environmental chambers. In the flow reactor, SOA precursors were oxidized using OH concentrations ranging from 2.0 × 108 to 2.2 × 1010 molec cm-3 over exposure times of 100 s. In the environmental chambers, precursors were oxidized using OH concentrations ranging from 2 × 106 to 2 × 107 molec cm-3 over exposure times of several hours. The OH concentration in the chamber experiments is close to that found in the atmosphere, but the integrated OH exposure in the flow reactor can simulate atmospheric exposure times of multiple days compared to chamber exposure times of only a day or so. In most cases, for a specific SOA type the most-oxidized chamber SOA and the least-oxidized flow reactor SOA have similar mass spectra, oxygen-to-carbon and hydrogen-to-carbon ratios, and carbon oxidation states at integrated OH exposures between approximately 1 × 1011 and 2 × 1011 molec cm-3 s, or about 1-2 days of equivalent atmospheric oxidation. This observation suggests that in the range of available OH exposure overlap for the flow reactor and chambers, SOA elemental composition as measured by an aerosol mass spectrometer is similar whether the precursor is exposed to low OH concentrations over long exposure times or high OH concentrations over short exposure times. This similarity in turn suggests that both in the flow reactor and in chambers, SOA chemical composition at low OH exposure is governed primarily by gas-phase OH oxidation of the precursors rather than heterogeneous oxidation of the condensed particles. In general, SOA yields measured in the flow reactor are lower than measured in chambers for the range of equivalent OH exposures that can be measured in both the flow reactor and chambers. The influence of sulfate seed

Effect of oxidant concentration, exposure time, and seed particles on secondary organic aerosol chemical composition and yield

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lambe, A. T.; Chhabra, P. S.; Onasch, T. B.

influence of sulfate seed particles on isoprene SOA yield measurements was examined in the flow reactor. The studies show that seed particles increase the yield of SOA produced in flow reactors by a factor of 3 to 5 and may also account in part for higher SOA yields obtained in the chambers, where seed particles are routinely used.« less

Effect of oxidant concentration, exposure time, and seed particles on secondary organic aerosol chemical composition and yield

DOE PAGES

Lambe, A. T.; Chhabra, P. S.; Onasch, T. B.; ...

2015-03-18

influence of sulfate seed particles on isoprene SOA yield measurements was examined in the flow reactor. The studies show that seed particles increase the yield of SOA produced in flow reactors by a factor of 3 to 5 and may also account in part for higher SOA yields obtained in the chambers, where seed particles are routinely used.« less

Improvement of plant growth and seed yield in Jatropha curcas by a novel nitrogen-fixing root associated Enterobacter species

PubMed Central

2013-01-01

Background Jatropha curcas L. is an oil seed producing non-leguminous tropical shrub that has good potential to be a fuel plant that can be cultivated on marginal land. Due to the low nutrient content of the targeted plantation area, the requirement for fertilizer is expected to be higher than other plants. This factor severely affects the commercial viability of J. curcas. Results We explored the feasibility to use endophytic nitrogen-fixing bacteria that are native to J. curcas to improve plant growth, biomass and seed productivity. We demonstrated that a novel N-fixing endophyte, Enterobacter sp. R4-368, was able to colonize in root and stem tissues and significantly promoted early plant growth and seed productivity of J. curcas in sterilized and non-sterilized soil. Inoculation of young seedling led to an approximately 57.2% increase in seedling vigour over a six week period. At 90 days after planting, inoculated plants showed an average increase of 25.3%, 77.7%, 27.5%, 45.8% in plant height, leaf number, chlorophyll content and stem volume, respectively. Notably, inoculation of the strain led to a 49.0% increase in the average seed number per plant and 20% increase in the average single seed weight when plants were maintained for 1.5 years in non-sterilized soil in pots in the open air. Enterobacter sp. R4-368 cells were able to colonize root tissues and moved systemically to stem tissues. However, no bacteria were found in leaves. Promotion of plant growth and leaf nitrogen content by the strain was partially lost in nifH, nifD, nifK knockout mutants, suggesting the presence of other growth promoting factors that are associated with this bacterium strain. Conclusion Our results showed that Enterobacter sp. R4-368 significantly promoted growth and seed yield of J. curcas. The application of the strains is likely to significantly improve the commercial viability of J. curcas due to the reduced fertilizer cost and improved oil yield. PMID:24083555

Effects of methanol-to-oil ratio, catalyst amount and reaction time on the FAME yield by in situ transesterification of rubber seeds (Hevea brasiliensis)

NASA Astrophysics Data System (ADS)

Abdulkadir, Bashir Abubakar; Uemura, Yoshimitsu; Ramli, Anita; Osman, Noridah B.; Kusakabe, Katsuki; Kai, Takami

2014-10-01

In this research, biodiesel is produced by in situ transesterification (direct transesterification) method from the rubber seeds using KOH as a catalyst. The influence of methanol to seeds mass ratio, duration of reaction, and catalyst loading was investigated. The result shows that, the best ratio of seeds to methanol is 1:6 (10 g seeds with 60 g methanol), 120 minutes reaction time and catalyst loading of 3.0 g. The maximum FAME yield obtain was 70 %. This findings support FAME production from the seeds of rubber tree using direct transesterifcation method from the seeds of rubber tree as an alternative to diesel fuel. Also, significant properties of biodiesel such as cloud point, density, pour point, specific gravity, and viscosity were investigated.

Processing scale-up of sicklepod (Senna obtusifolia L.) seed.

PubMed

Harry-O'Kuru, Rogers E; Mohamed, Abdellatif

2009-04-08

Sicklepod (Senna obtusifolia L.) is an invasive weed species especially of soybean and other field crops in the southeastern United States. The seeds contain a small amount (5-7%) of a highly colored fat as well as various phenolics, proteins, and galactomannans. The color of sicklepod seed oil is such that the presence of a small amount of the weed seed in a soybean crush lowers the quality of the soybean oil. Sicklepod is very prolific, and even volunteer stands yield >1000 lb of seed per acre, and prudence calls for tapping the potential of this weed as an alternative economic crop in the affected region. Pursuant to this, we have shown in laboratory-scale work the feasibility of separating the components of sicklepod seed. However, at kilogram and higher processing quantities, difficulties arise leading to modification of the earlier approach in order to efficiently separate components of the defatted seed meal. In a version for cleanly separating the proteins, the defatted meal was extracted with 0.5 M NaCl solution to remove globular proteins. Prolamins were extracted from the pellet left after salt extraction using 80% ethanol, and glutelins were then obtained in 0.1 N alkali from the residual solids left from ethanol treatment. In a pilot-scale version for water-soluble polysaccharides, the defatted meal was stirred with deionized water (DI) and centrifuged. The pooled centrifugates were heated to 92 degrees C (20-25 min), filtered, cooled to room temperature, and passed through a column of Amberlite XAD-4 to separate the polysaccharides from the anthraquinones. Senna obtusifolia L. is a one-stop-shop of a seed (from food components to medicinals).

The Douglas-fir seed-source movement trial yields early results

Treesearch

Constance A. Harrington; Brad St. Clair

2017-01-01

Climate change in the 21st century is likely to dramatically alter the growing conditions that Pacific Northwest tree species experience. It has been suggested that foresters plan for these changes by moving seed sources to locations where the seed-source environment and the future climate will be similar. Some people have called this type of seed-source movement “...

Comparison of HeNe laser and sinusoidal non-uniform magnetic field seed pre-sowing treatment effect on Glycine max (Var 90-I) germination, growth and yield.

PubMed

Asghar, Tehseen; Iqbal, Munawar; Jamil, Yasir; Zia-Ul-Haq; Nisar, Jan; Shahid, Muhammad

2017-01-01

Recently, laser and magnetic field pre-sowing seed treatments attracted the attention of the scientific community in response to their positive effect on plant characteristics and the present study was exemplified for Glycine max Var 90-I. Seeds were exposed to laser (HeNe-wave length 632nm and density power of 1mW/cm 2 ) and magnetic field (sinusoidal non-uniform-50, 75 and 100mT for 3, 5min with exposure) and seed germination, seedling growth and yield attributes were compared. The germination (mean germination, germination percentage, emergence index, germination speed, relative germination coefficient, emergence coefficient of uniformity) growth (root dry weight, root length, shoot fresh weight and shoot dry weight, leaf dry & fresh weight, root fresh weight, leaf area, shoot length, plant total dry weight at different stages, stem diameter, number of leaves, vigor index I & II), biochemical (essential oil) and yield attributes (seed weight, count) were enhanced significantly in response to both laser and magnetic field treatments. However, magnetic field treatment furnished slightly higher response versus laser except relative water contents, whole plant weight and shoot length. Results revealed that both laser and magnetic field pre-sowing seed treatments affect the germination, seedling growth, and yield characteristics positively and could possibly be used to enhance Glycine max productivity. Copyright © 2016 Elsevier B.V. All rights reserved.

Overexpression of MYB115, AAD2, or AAD3 in Arabidopsis thaliana seeds yields contrasting omega-7 contents

PubMed Central

To, Alexandra; Barthole, Guillaume; Lepiniec, Loïc

2018-01-01

Omega-7 monoenoic fatty acids (ω-7 FAs) are increasingly exploited both for their positive effects on health and for their industrial potential. Some plant species produce fruits or seeds with high amounts of ω-7 FAs. However, the low yields and poor agronomic properties of these plants preclude their commercial use. As an alternative, the metabolic engineering of oilseed crops for sustainable ω-7 FA production has been proposed. Two palmitoyl-ACP desaturases (PADs) catalyzing ω-7 FA biosynthesis were recently identified and characterized in Arabidopsis thaliana, together with MYB115 and MYB118, two transcription factors that positively control the expression of the corresponding PAD genes. In the present research, we examine the biotechnological potential of these new actors of ω-7 metabolism for the metabolic engineering of plant-based production of ω-7 FAs. We placed the PAD and MYB115 coding sequences under the control of a promoter strongly induced in seeds and evaluated these different constructs in A. thaliana. Seeds were obtained that exhibit ω-7 FA contents ranging from 10 to >50% of the total FAs, and these major compositional changes have no detrimental effect on seed germination. PMID:29381741

Integrated utilization of red radish seeds for the efficient production of seed oil and sulforaphene.

PubMed

Zhang, Jie; Zhou, Xing; Fu, Min

2016-02-01

Supercritical CO2 was used to obtain seed oil from red radish seeds. The influence of pressure, temperature, CO2 flow rate and time on extraction yield of oil were investigated in detail. The maximum extraction yield of oil was 92.07 ± 0.76% at the optimal extraction conditions. The physicochemical properties and fatty acid composition of oil indicated that the seed oil can be used as a dietary oil. Meanwhile, the high purity sulforaphene (96.84 ± 0.17%) was separated by solvent extraction coupled with preparative high performance liquid chromatography from red radish seed meal. The initial pH, R, extraction temperature and extraction time for each cycle had a considerable influence both on the extraction yield and purity of sulforaphene of crude product. The extraction of oil was directly responsible for an increase of 18.32% in the yield of sulforaphene. Copyright © 2015 Elsevier Ltd. All rights reserved.

Yield potential of pigeon pea cultivars

USDA-ARS?s Scientific Manuscript database

Yield potential of twelve vegetable pigeon pea (Cajanus cajun) cultivars was evaluated at two locations in eastern Kenya during 2012 and 2013 cropping years. Pigeon pea pod numbers, seeds per pod, seed mass, grain yield and shelling percentage were quantified in three replicated plots, arranged in a...

The impact of sulfate restriction on seed yield and quality of winter oilseed rape depends on the ability to remobilize sulfate from vegetative tissues to reproductive organs

PubMed Central

Girondé, Alexandra; Dubousset, Lucie; Trouverie, Jacques; Etienne, Philippe; Avice, Jean-Christophe

2014-01-01

Our current knowledge about sulfur (S) management by winter oilseed rape to satisfy the S demand of developing seeds is still scarce, particularly in relation to S restriction. Our goals were to determine the physiological processes related to S use efficiency that led to maintain the seed yield and quality when S limitation occurred at the bolting or early flowering stages. To address these questions, a pulse-chase 34SO2−4 labeling method was carried out in order to study the S fluxes from uptake and remobilization at the whole plant level. In response of S limitation at the bolting or early flowering stages, the leaves are the most important source organ for S remobilization during reproductive stages. By combining 34S-tracer with biochemical fractionation in order to separate sulfate from other S-compounds, it appeared that sulfate was the main form of S remobilized in leaves at reproductive stages and that tonoplastic SULTR4-type transporters were specifically involved in the sulfate remobilisation in case of low S availability. In response to S limitation at the bolting stage, the seed yield and quality were dramatically reduced compared to control plants. These data suggest that the increase of both S remobilization from source leaves and the root proliferation in order to maximize sulfate uptake capacities, were not sufficient to maintain the seed yield and quality. When S limitation occurred at the early flowering stage, oilseed rape can optimize the mobilization of sulfate reserves from vegetative organs (leaves and stem) to satisfy the demand of seeds and maintain the seed yield and quality. Our study also revealed that the stem may act as a transient storage organ for remobilized S coming from source leaves before its utilization by seeds. The physiological traits (S remobilization, root proliferation, transient S storage in stem) observed under S limitation could be used in breeding programs to select oilseed rape genotypes with high S use efficiency

Effects of physical agitation on yield of greenhouse-grown soybean

NASA Technical Reports Server (NTRS)

Jones, R. S.; Mitchell, C. A.

1992-01-01

Agronomic and horticultural crop species experience reductions in growth and harvestable yield after exposure to physical agitation (also known as mechanical stress), as by wind or rain. A greenhouse study was conducted to test the influence of mechanical stress on soybean yield and to determine if exposure to mechanical stress during discrete growth periods has differential effects on seed yield. A modified rotatory shaker was used to apply seismic (i.e., shaking) stress. Brief, periodic episodes of seismic stress reduced stem length, total seed dry weight, and seed number of soybean [Glycine max (L.) Merr.]. Lodging resistance was greater for plants stressed during vegetative growth or throughout vegetative and reproductive growth than during reproductive growth only. Seed dry weight yield was reduced regardless of the timing or duration of stress application, but was lowest when applied during reproductive development. Seismic stress applied during reproductive growth stages R1 to R2 (Days 3 to 4) was as detrimental to seed dry weight accumulation as was stress applied during growth stages R1 to R6 (Days 39 to 42). Seed dry weight per plant was highly correlated with seed number per plant, and seed number was correlated with the seed number of two- and three-seeded pods. Dry weight per 100 seeds was unaffected by seismic-stress treatment. Growth and yield reductions resulting from treatments applied only during the vegetative stage imply that long-term mechanical effects were induced, from which the plants did not fully recover. It is unclear which yield-controlling physiological processes were affected by mechanical stress. Both transient and long-term effects on yield-controlling processes remain to be elucidated.

Evidence for Proteomic and Metabolic Adaptations Associated with Alterations of Seed Yield and Quality in Sulfur-limited Brassica napus L*

PubMed Central

D'Hooghe, Philippe; Dubousset, Lucie; Gallardo, Karine; Kopriva, Stanislav; Avice, Jean-Christophe; Trouverie, Jacques

2014-01-01

In Brassica napus, seed yield and quality are related to sulfate availability, but the seed metabolic changes in response to sulfate limitation remain largely unknown. To address this question, proteomics and biochemical studies were carried out on mature seeds obtained from plants grown under low sulfate applied at the bolting (LS32), early flowering (LS53), or start of pod filling (LS70) stage. The protein quality of all low-sulfate seeds was reduced and associated with a reduction of S-rich seed storage protein accumulation (as Cruciferin Cru4) and an increase of S-poor seed storage protein (as Cruciferin BnC1). This compensation allowed the protein content to be maintained in LS70 and LS53 seeds but was not sufficient to maintain the protein content in LS32 seeds. The lipid content and quality of LS53 and LS32 seeds were also affected, and these effects were primarily associated with a reduction of C18-derivative accumulation. Proteomics changes related to lipid storage, carbohydrate metabolism, and energy (reduction of caleosins, phosphoglycerate kinase, malate synthase, ATP-synthase β-subunit, and thiazole biosynthetic enzyme THI1 and accumulation of β-glucosidase and citrate synthase) provide insights into processes that may contribute to decreased oil content and altered lipid composition (in favor of long-chain fatty acids in LS53 and LS32 seeds). These data indicate that metabolic changes associated with S limitation responses affect seed storage protein composition and lipid quality. Proteins involved in plant stress response, such as dehydroascorbate reductase and Cu/Zn-superoxide dismutase, were also accumulated in LS53 and LS32 seeds, and this might be a consequence of reduced glutathione content under low S availability. LS32 treatment also resulted in (i) reduced germination vigor, as evidenced by lower germination indexes, (ii) reduced seed germination capacity, related to a lower seed viability, and (iii) a strong decrease of glyoxysomal malate

In Vitro Inhibition of Cholera Toxin Production in Vibrio cholerae by Methanol Extract of Sweet Fennel Seeds and Its Components.

PubMed

Chatterjee, Shruti; Zahid, M Shamim Hasan; Awasthi, Sharda Prasad; Chowdhury, Nityananda; Asakura, Masahiro; Hinenoya, Atsushi; Ramamurthy, T; Iwaoka, Emiko; Aoki, Shunji; Yamasaki, Shinji

2016-09-21

A newly emerged Vibrio cholerae O1 El Tor variant strain with multidrug resistance is considered a threat to public health. Recent strategies to suppress virulence factors production instead of bacterial growth may lead to less selective pressure for the emergence of resistant strains. The use of spices and their active constituents as the inhibitory agents against cholera toxin (CT) production in V. cholerae may be an alternative approach to treat cholera. In this study, we examined the potential of sweet fennel seed (Foeniculum vulgare Miller var. dulce) methanol extract to inhibit CT production in V. cholerae without affecting viability. The methanol extract of sweet fennel seeds significantly inhibited CT production in various V. cholerae strains, regardless of serogroup or biotype. Interestingly, trans-anethole and 4-allylanisole, essential oil components of sweet fennel seeds, also demonstrated similar effects. Here, we report that sub-bactericidal concentrations of sweet fennel seed methanol extract and its major components can drastically inhibit CT production in various V. cholerae strains.

Mapping QTLs for 100-seed weight in an interspecific soybean cross of Williams 82 (Glycine max) x PI 366121 (Glycine soja)

USDA-ARS?s Scientific Manuscript database

100-seed weight is a critical component for soybean quality and yield. The objective of the present study was to identify quantitative trait loci (QTLs) for 100-seed weight using 169 recombinant inbred lines (RILs) derived from the cross of Williams 82 x PI 366121. The parental lines and RILs were g...

Phomopsis seed decay of soybean

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) causes poor seed quality and suppresses yield in most soybean-growing countries. The disease is caused primarily by the fungal pathogen Phomopsis longicolla along with other Phomopsis and Diaporthe spp. Infected seed range from symptomless to shriveled, elongated, ...

Salt-induced modulation in inorganic nutrients, antioxidant enzymes, proline content and seed oil composition in safflower (Carthamus tinctorius L.).

PubMed

Siddiqi, Ejaz Hussain; Ashraf, Muhammad; Al-Qurainy, Fahad; Akram, Nudrat Aisha

2011-12-01

Safflower (Carthamus tinctorius L.) has gained considerable ground as a potential oil-seed crop. However, its yield and oil production are adversely affected under saline conditions. The present study was conducted to appraise the influence of salt (NaCl) stress on yield, accumulation of different inorganic elements, free proline and activities of some key antioxidant enzymes in plant tissues as well as seed oil components in safflower. Two safflower accessions differing in salt tolerance (Safflower-33 (salt sensitive) and Safflower-39 (salt tolerant)) were grown under saline (150 mmol L(-1) ) conditions and salt-induced changes in the earlier-mentioned physiological attributes were determined. Salt stress enhanced leaf and root Na(+) , Cl(-) and proline accumulation and activities of leaf superoxide dismutase, catalase and peroxidase, while it decreased K(+) , Ca(2+) and K(+) /Ca(2+) and Ca(2+) /Na(+) ratios and seed yield, 100-seed weight, number of seeds, as well as capitula, seed oil contents and oil palmitic acid. No significant effect of salt stress was observed on seed oil α-tocopherols, stearic acid, oleic acid or linoleic acid contents. Of the two safflower lines, salt-sensitive Safflower-33 was higher in leaf and root Na(+) and Cl(-) , while Safflower-39 was higher in leaf and root K(+) , K(+) /Ca(2+) and Ca(2+) /Na(+) and seed yield, 100-seed weight, catalase activity, seed oil contents, seed oil α-tocopherol and palmitic acid. Other attributes remained almost unaffected in both accessions. Overall, high salt tolerance of Safflower-39 could be attributed to Na(+) and Cl(-) exclusion, high accumulation of K(+) and free proline, enhanced CAT activity, seed oil α-tocopherols and palmitic acid contents. Copyright © 2011 Society of Chemical Industry.

Efficacy of Selected Insecticides Applied to Hybrid Rice Seed

PubMed Central

Adams, A.; Gore, J.; Musser, F.; Cook, D.; Walker, T.; Dobbins, C.

2016-01-01

Hybrid rice and insecticide seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel, have altered the landscape of rice production. The effect of reduced seeding rates on seed treatment efficacy in hybrid rice has not been studied. During 2011 and 2012, an experiment was conducted at seven locations to determine the relationship between low seeding rates used in hybrid rice and efficacy of selected insecticidal seed treatments as measured by rice water weevil densities and yield. Labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin were compared with higher rates of these products to determine if labeled rates provide an acceptable level of control of the rice water weevil. Study locations were divided into low, moderate, and high groups based on rice water weevil larval densities. All seed treatments and seed treatment rates reduced rice water weevil densities. However, there was no observed yield or economic benefit from the use of an insecticidal seed treatment in areas of low pressure. Differences in yield were observed among seed treatments and seed treatment rates in moderate and high pressure locations, and all seed treatments yielded better than the untreated plots, but these differences were not always economical. All seed treatments showed an economic advantage in areas of high weevil pressure, and there were no differences among seed treatment products or rates, suggesting that currently labeled seed treatment rates in hybrid rice are effective for rice water weevil management. PMID:26537671

New observations on gametogenic development and reproductive experimental tools to support seed yield improvement in cowpea [Vigna unguiculata (L.) Walp].

PubMed

Salinas-Gamboa, Rigel; Johnson, Susan D; Sánchez-León, Nidia; Koltunow, Anna M G; Vielle-Calzada, Jean-Philippe

2016-06-01

Cowpea reproductive tools. Vigna unguiculata L. Walp. (cowpea) is recognized as a major legume food crop in Africa, but seed yields remain low in most varieties adapted to local conditions. The development of hybrid cowpea seed that could be saved after each generation, enabling significant yield increases, will require manipulation of reproductive development from a sexual to an asexual mode. To develop new technologies that could support the biotechnological manipulation of reproductive development in cowpea, we examined gametogenesis and seed formation in two transformable, African-adapted, day-length-insensitive varieties. Here, we show that these two varieties exhibit distinct morphological and phenological traits but share a common developmental sequence in terms of ovule formation and gametogenesis. We present a reproductive calendar that allows prediction of male and female gametogenesis on the basis of sporophytic parameters related to floral bud size and reproductive organ development, determining that gametogenesis occurs more rapidly in the anther than in the ovule. We also show that the mode of megagametogenesis is of the Polygonum-type and not Oenothera-type, as previously reported. Finally, we developed a whole-mount immunolocalization protocol and applied it to detect meiotic proteins in the cowpea megaspore mother cell, opening opportunities for comparing the dynamics of protein localization during male and female meiosis, as well as other reproductive events in this emerging legume model system.

The proteins of the grape (Vitis vinifera L.) seed endosperm: fractionation and identification of the major components.

PubMed

Gazzola, Diana; Vincenzi, Simone; Gastaldon, Luca; Tolin, Serena; Pasini, Gabriella; Curioni, Andrea

2014-07-15

In the present study, grape (Vitis vinifera L.) seed endosperm proteins were characterized after sequential fractionation, according to a modified Osborne procedure. The salt-soluble fraction (albumins and globulins) comprised the majority (58.4%) of the total extracted protein. The protein fractions analysed by SDS-PAGE showed similar bands, indicating different solubility of the same protein components. SDS-PAGE in non-reducing and reducing conditions revealed the polypeptide composition of the protein bands. The main polypeptides, which were similar in all the grape varieties analysed, were identified by LC-MS/MS as homologous to the 11S globulin-like seed storage proteins of other plant species, while a monomeric 43 kDa protein presented high homology with the 7S globulins of legume seeds. The results provide new insights about the identity, structure and polypeptide composition of the grape seed storage proteins. Copyright © 2014 Elsevier Ltd. All rights reserved.

Use of Direct and Indirect Estimates of Crown Dimensions to Predict One Seed Juniper Woody Biomass Yield for Alternative Energy Uses

USDA-ARS?s Scientific Manuscript database

Throughout the western United States there is increased interest in utilizing woodland biomass as an alternative energy source. We conducted a pilot study to predict one seed juniper (Juniperus monosperma) chip yield from tree-crown dimensions measured on the ground or derived from Very Large Scale ...

Engineering salt-tolerant Brassica plants: characterization of yield and seed oil quality in transgenic plants with increased vacuolar sodium accumulation.

PubMed

Zhang, H X; Hodson, J N; Williams, J P; Blumwald, E

2001-10-23

Transgenic Brassica napus plants overexpressing AtNHX1, a vacuolar Na(+)/H(+) antiport from Arabidopsis thaliana, were able to grow, flower, and produce seeds in the presence of 200 mM sodium chloride. Although the transgenic plants grown in high salinity accumulated sodium up to 6% of their dry weight, growth of the these plants was only marginally affected by the high salt concentration. Moreover, seed yields and the seed oil quality were not affected by the high salinity of the soil. Our results demonstrate the potential use of these transgenic plants for agricultural use in saline soils. Our findings, showing that the modification of a single trait significantly improved the salinity tolerance of this crop plant, suggest that with a combination of breeding and transgenic plants it could be possible to produce salt-tolerant crops with far fewer target traits than had been anticipated.

Analysis of components and study on antioxidant and antimicrobial activities of oil in apple seeds.

PubMed

Tian, Hong-Lei; Zhan, Ping; Li, Kai-Xiong

2010-06-01

In order to improve the comprehensive utilization of major by-products in apple-juice processing, the components, antioxidant and antimicrobial activities of oil in two species apple seeds, Fuji and New Red Star, were investigated. The Soxhlet extracted oil content of apple seeds raged from 20.69 to 24.32 g/100 g. The protein, fiber and ash contents were found to be 38.85-49.55 g/100 g, 3.92-4.32 g/100 g and 4.31-5.20 g/100 g, respectively; the extracted oils exhibited an iodine value of 94.14-101.15 g I/100 g oil; refractive index (40 degrees C) was 1.465-1.466; density (25 degrees C) was 0.902-0.903 mg/ml; saponification value was 179.01-197.25 mg KOH/g oil; and the acid value was 4.036-4.323 mg KOH/g oil. The apple seed oils mainly consisted of linoleic acid (50.7-51.4 g/100 g) and oleic acid (37.49-38.55 g/100 g). Other prominent fatty acids were palmitic acid (6.51-6.60 g/100 g), stearic acid (1.75-1.96 g/100 g) and arachidic acid (1.49-1.54 g/100 g). Apple seed oil was proven to possess interesting properties, emerging from its chemical composition and from the evaluation of its in vitro biological activities. The apple seed oil was almost completely active against bacteria, mildews were less sensitive to apple seed oil than yeasts, and the minimum inhibitory concentration (MIC) of apple seed oil ranged from 0.3 to 0.6 mg/ml. The observed biological activities showed that the oil had a good potential for use in the food industry and pharmacy.

Inducing mutations through γ-irradiation in seeds of Mucuna pruriens for developing high L-DOPA-yielding genotypes.

PubMed

Singh, Susheel Kumar; Yadav, Deepti; Lal, Raj Kishori; Gupta, Madan M; Dhawan, Sunita Singh

2017-04-01

To develop elite genotypes in Mucuna pruriens (L.) DC with high L-DOPA (L-3, 4 dihydroxyphenylalanine) yields, with non-itching characteristics and better adaptability by applying γ-irradiation. Molecular and chemical analysis was performed for screening based on specific characteristics desired for developing suitable genotypes. Developed, mutant populations were analyzed for L-DOPA % in seeds through TLC (thin layer chromatography), and the results obtained were validated with the HPLC (High performance liquid chromatography). The DNA (Deoxyribonucleic acid) was isolated from the leaf at the initial stage and used for DNA polymorphism. RNA (Ribonucleic acid) was isolated from the leaf during maturity and used for expression analysis. The selected mutant T-I-7 showed 5.7% L-DOPA content compared to 3.18% of parent CIM-Ajar. The total polymorphism obtained was 57% with the molecular marker analysis. The gene expression analysis showed higher fold change expression of the dopadecarboxylase gene (DDC) in control compared to selected mutants (T-I-7, T-II-23, T-IV-9, T-VI-1). DNA polymorphism was used for the screening of mutants for efficient screening at an early stage. TLC was found suitable for the large-scale comparative chemical analysis of L-DOPA. The expression profile of DDC clearly demonstrated the higher yields of L-DOPA in selected mutants developed by γ-irradiation in the seeds of the control.

Salicylic acid deficiency in NahG transgenic lines and sid2 mutants increases seed yield in the annual plant Arabidopsis thaliana

PubMed Central

Abreu, Maria Elizabeth; Munné-Bosch, Sergi

2009-01-01

Salicylic acid-deficient NahG transgenic lines and sid2 mutants were used to evaluate the role of this compound in the development of the short-lived, annual plant Arabidopsis thaliana, with a particular focus on the interplay between salicylic acid and other phytohormones. Low salicylic acid levels led to increased growth, as well as to smaller abscisic acid levels and reduced damage to PSII (as indicated by Fv/Fm ratios) during the reproductive stages in rosette leaves of NahG transgenic lines and sid2 mutants, compared with wild-type plants. Furthermore, salicylic acid deficiency highly influenced seed yield and composition. Seed production increased by 4.4-fold and 3.5-fold in NahG transgenic lines and sid2 mutants, respectively, compared to the wild type. Salicylic acid deficiency also improved seed composition in terms of antioxidant vitamin concentrations, seeds of salicylic acid-deficient plants showing higher levels of α- and γ-tocopherol (vitamin E) and β-carotene (pro-vitamin A) than seeds of wild-type plants. Seeds of salicylic acid-deficient plants also showed higher nitrogen concentrations than seeds of wild-type plants. It is concluded that (i) the sid2 gene, which encodes for isochorismate synthase, plays a central role in salicylic acid biosynthesis during plant development in A. thaliana, (ii) salicylic acid plays a role in the regulation of growth, senescence, and seed production, (iii) there is a cross-talk between salicylic acid and other phytohormones during plant development, and (iv) the concentrations of antioxidant vitamins in seeds may be influenced by the endogenous levels of salicylic acid in plants. PMID:19188277

Effect of weed management and seed rate on crop growth under direct dry seeded rice systems in Bangladesh.

PubMed

Ahmed, Sharif; Salim, Muhammad; Chauhan, Bhagirath S

2014-01-01

Weeds are a major constraint to the success of dry-seeded rice (DSR). The main means of managing these in a DSR system is through chemical weed control using herbicides. However, the use of herbicides alone may not be sustainable in the long term. Approaches that aim for high crop competitiveness therefore need to be exploited. One such approach is the use of high rice seeding rates. Experiments were conducted in the aman (wet) seasons of 2012 and 2013 in Bangladesh to evaluate the effect of weed infestation level (partially-weedy and weed-free) and rice seeding rate (20, 40, 60, 80, and 100 kg ha(-1)) on weed and crop growth in DSR. Under weed-free conditions, higher crop yields (5.1 and 5.2 t ha(-1) in the 2012 and 2013 seasons, respectively) were obtained at the seeding rate of 40 kg ha(-1) and thereafter, yield decreased slightly beyond 40 kg seed ha(-1). Under partially-weedy conditions, yield increased by 30 to 33% (2.0-2.2 and 2.9-3.2 t ha(-1) in the 2012 and 2013 seasons, respectively) with increase in seeding rate from 20 to 100 kg ha(-1). In the partially-weedy plots, weed biomass decreased by 41-60% and 54-56% at 35 days after sowing and at crop anthesis, respectively, when seeding rate increased from 20 to 100 kg ha(-1). Results from our study suggest that increasing seeding rates in DSR can suppress weed growth and reduce grain yield losses from weed competition.

Effect of Weed Management and Seed Rate on Crop Growth under Direct Dry Seeded Rice Systems in Bangladesh

PubMed Central

Ahmed, Sharif; Salim, Muhammad; Chauhan, Bhagirath S.

2014-01-01

Weeds are a major constraint to the success of dry-seeded rice (DSR). The main means of managing these in a DSR system is through chemical weed control using herbicides. However, the use of herbicides alone may not be sustainable in the long term. Approaches that aim for high crop competitiveness therefore need to be exploited. One such approach is the use of high rice seeding rates. Experiments were conducted in the aman (wet) seasons of 2012 and 2013 in Bangladesh to evaluate the effect of weed infestation level (partially-weedy and weed-free) and rice seeding rate (20, 40, 60, 80, and 100 kg ha−1) on weed and crop growth in DSR. Under weed-free conditions, higher crop yields (5.1 and 5.2 t ha−1 in the 2012 and 2013 seasons, respectively) were obtained at the seeding rate of 40 kg ha−1 and thereafter, yield decreased slightly beyond 40 kg seed ha−1. Under partially-weedy conditions, yield increased by 30 to 33% (2.0–2.2 and 2.9–3.2 t ha−1 in the 2012 and 2013 seasons, respectively) with increase in seeding rate from 20 to 100 kg ha−1. In the partially-weedy plots, weed biomass decreased by 41–60% and 54–56% at 35 days after sowing and at crop anthesis, respectively, when seeding rate increased from 20 to 100 kg ha−1. Results from our study suggest that increasing seeding rates in DSR can suppress weed growth and reduce grain yield losses from weed competition. PMID:25000520

Effects of imidacloprid and clothianidin seed treatments on wheat aphids and their natural enemies on winter wheat.

PubMed

Zhang, Peng; Zhang, Xuefeng; Zhao, Yunhe; Wei, Yan; Mu, Wei; Liu, Feng

2016-06-01

Wheat aphid (Hemiptera: Aphididae) is one of the major pests of winter wheat and has posed a significant threat to winter wheat production in China. Although neonicotinoid insecticidal seed treatments have been suggested to be a control method, the season-long efficacy on pests and the impact on their natural enemies are still uncertain. Experiments were conducted to determine the efficacy of imidacloprid and clothianidin on the control of aphids, the number of their natural enemies and the emergence rate and yield of wheat during 2011-2014. Imidacloprid and clothianidin seed treatments had no effect on the emergence rate of winter wheat and could prevent yield losses and wheat aphid infestations throughout the winter wheat growing season. Furthermore, their active ingredients were detected in winter wheat leaves up to 200 days after sowing. Imidacloprid and clothianidin seed treatments had no adverse effects on ladybirds, hoverflies or parasitoids, and instead increased the spider-aphid ratios. Wheat seeds treated with imidacloprid and clothianidin were effective against wheat aphids throughout the winter wheat growing season and reduced the yield loss under field conditions. Imidacloprid and clothianidin seed treatments may be an important component of the integrated management of wheat aphids on winter wheat. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

Occurrence ofCis-6-hexadecenoic acid as the major component ofThunbergia alata seed oil.

PubMed

Spencer, G F; Kleiman, R; Miller, R W; Earle, F R

1971-10-01

An unusual series of monoenoic fatty acids constitutes about 85% of the total acids in seed oil fromThunbergia alata. The major component in the oil,cis-6-hexadecenoic acid (82%), is accompanied by the homologous 4-tetradecenoic (ca. 0.2%) and 8-octadecenoic (1.8%) acids. Another homologous series is represented by 5-tetradecenoic (ca. 0.2%), 7-hexadecenoic (1.8%) and the familiar 9-octadecenoic (4.4%) acids. Traces (<0.1%) of three other acids, 6-tetradecenoic and 10- and 11-octadecenoic, are also present along with palmitic (5.8%), stearic (0.6%) and linoleic (2.2%) acids. Some of the monoenoic acids have not previously been known to occur in seed oils.

Estimating Cone and Seed Production and Monitoring Pest Damage in Southern Pine Seed Orchards

Treesearch

Carl W. Fatzinger; H. David Muse; Thomas Miller; Helen T. Bhattacharyya

1988-01-01

Field sampling procedures and computer programs are described for monitoring seed production and pest damage in southern pine seed orchards. The system estimates total orchard yields of female strobili and seeds, quantifies pest damage, determines times of year when losses occur, and produces life tables for female strobili. An example is included to illustrate the...

Rapidly differentiating grape seeds from different sources based on characteristic fingerprints using direct analysis in real time coupled with time-of-flight mass spectrometry combined with chemometrics.

PubMed

Song, Yuqiao; Liao, Jie; Dong, Junxing; Chen, Li

2015-09-01

The seeds of grapevine (Vitis vinifera) are a byproduct of wine production. To examine the potential value of grape seeds, grape seeds from seven sources were subjected to fingerprinting using direct analysis in real time coupled with time-of-flight mass spectrometry combined with chemometrics. Firstly, we listed all reported components (56 components) from grape seeds and calculated the precise m/z values of the deprotonated ions [M-H](-) . Secondly, the experimental conditions were systematically optimized based on the peak areas of total ion chromatograms of the samples. Thirdly, the seven grape seed samples were examined using the optimized method. Information about 20 grape seed components was utilized to represent characteristic fingerprints. Finally, hierarchical clustering analysis and principal component analysis were performed to analyze the data. Grape seeds from seven different sources were classified into two clusters; hierarchical clustering analysis and principal component analysis yielded similar results. The results of this study lay the foundation for appropriate utilization and exploitation of grape seed samples. Due to the absence of complicated sample preparation methods and chromatographic separation, the method developed in this study represents one of the simplest and least time-consuming methods for grape seed fingerprinting. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Piriformospora indica promotes growth, seed yield and quality of Brassica napus L.

PubMed

Su, Zhen-Zhu; Wang, Ting; Shrivastava, Neeraj; Chen, You-Yuan; Liu, Xiaoxi; Sun, Chao; Yin, Yufeng; Gao, Qi-Kang; Lou, Bing-Gan

2017-06-01

In current scenario, crop productivity is being challenged by decreasing soil fertility. To cope up with this problem, different beneficial microbes are explored to increase the crop productivity with value additions. In this study, Brassica napus L., an important agricultural economic oilseed crop with rich source of nutritive qualities, was interacted with Piriformospora indica, a unique root colonizing fungus with wide host range and multifunctional aspects. The fungus-treated plants showed a significant increase in agronomic parameters with plant biomass, lodging-resistance, early bolting and flowering, oil yield and quality. Nutritional analysis revealed that plants treated by P. indica had reduced erucic acid and glucosinolates contents, and increased the accumulation of N, Ca, Mg, P, K, S, B, Fe and Zn elements. Low erucic acid and glucosinolates contents are important parameters for high quality oil, because oils high in erucic acid and glucosinolates are considered undesirable for human nutrition. Furthermore, the expression profiles of two encoding enzyme genes, Bn-FAE1 and BnECR, which are responsible for regulating erucic acid biosynthesis, were down-regulated at mid- and late- life stages during seeds development in colonized plants. These results demonstrated that P. indica played an important role in enhancing plant growth, rapeseed yield and quality improvement of B. napus. Copyright © 2017 Elsevier GmbH. All rights reserved.

Response of barley to grasshopper defoliation in interior Alaska: dry matter and grain yield.

PubMed

Begna, Sultan H; Fielding, Dennis J

2005-12-01

Barley, Hordeum vulgare L., is well adapted to subarctic Alaska growing conditions, but little is known about its response to grasshopper defoliation. A field experiment was conducted to study dry matter and grain yield in response to a combination of grasshopper defoliation and weeds in 2002 and 2003 near Delta Junction, AK (63 degrees 55' N, 145 degrees 20' W). Barley plants at third to fourth leaf stage were exposed to a combination of two levels of weeds (present or absent) and four densities of grasshoppers (equivalent to 0, 25, 50, and 75 grasshoppers per m2) of third to fourth instars of Melanoplus sanguinipes (F). Dry matter accumulation by the barley plants was determined at three times during the growing seasons: approximately 10 d after introduction of the grasshoppers, shortly after anthesis, and at maturity. Dry matter accumulation and grain yield were much lower in 2003 than in 2002, probably due to very low levels of soil moisture early in the growing season of 2003. Head clipping accounted for a greater portion of yield loss in 2003 than in 2002. The percentage of reduction in harvestable yield due to grasshoppers remained fairly constant between years (1.9 and 1.4 g per grasshopper per m2 in 2002 and 2003, respectively) despite a large difference in overall yield. Examination of the yield components suggest that yields were reduced by the early season drought in 2003 primarily through fewer seeds per head, whereas grasshoppers in both years reduced average seed weight, but not numbers of seeds.

In vitro antifungal activity of different components of Centratherum anthelminticum and Ocimum sanctum seed oils and their synergism against oral pathogenic fungi

PubMed Central

H Gopalkrishna, Aparna; M, Seshagiri; Muddaiah, Sunil; R, Shashidara

2016-01-01

Background. Opportunistic fungal infections like candidiasis are common in the oral cavity. In recent years Candida species have shown resistance against a number of synthetic drugs. This study assessed the antifungal activity of Centratherum anthelminticum and Ocimum sanctum seed oils against six common pathogenic Candida strains. Synergistic activity of the major oil components was also studied. Methods. Antifungal activity of Centratherum anthelminticum and Ocimum sanctum seed oils were tested against six oral fungal pathogens, Candida albicans ATCC 90028, Candida krusei 6258, Candida tropicalis 13803, Candida parapsilosis22019, Candida glabrata 90030 and Candida dubliniensis MYA 646, by disc diffusion and broth microdilution methods to determine the diameter of inhibition zone (DIZ) and minimum inhibitory concentration (MIC), respectively. The oil was extracted using Soxhlet apparatus from seeds subjected to columnchromatography (CC) and thin layer chromatography (TLC) and major components were separated and quantified. Results. All the six Candida strains showed growth inhibition to a variable degree when tested with both seed oils. Both seed oils showed antifungal activity. For Centratherum anthelminticum seed oil maximum DIZ at 7 μL was recorded at 75.7 mm for Candida albicans ATCC 90028, and the least DIZ was 45.7 mm for Candida dubliniensis MYA 646. For Ocimum sanctum seed oil maximum DIZ at 7 μL was 61.0 mm for Candida krusei ATCC 6258 and the least DIZ was 46.7 mm for Candida tropicalis ATCC 13803. The mixtures of phospholipids and unsaponifiable matter exhibitedMIC values at 1.25 μL for both oils, whereas neutral lipids fraction and unsaponifiable matter exhibited similar MIC at 2.5 μL against Candida albicans and Candida krusei. Conclusion.Centratherum anthelminticum and Ocimum sanctumseed oils exhibited strong antifungal activity against six different species of Candida and this may be attributed to various active components in the oil and their

Genetic architecture, inter-relationship and selection criteria for yield improvement in rice (Oryza sativa L.).

PubMed

Yadav, S K; Pandey, P; Kumar, B; Suresh, B G

2011-05-01

This study has been conducted to determine the extent of genetic association between yield of Rice (Oryza sativa L.) and its components. The present experiment was carried out with 40 Rice (Oryza sativa L.) genotypes which were evaluated in a randomized block design with 3 replications during wet season of 2007 and 2008. Results showed that sufficient amount of variability was found in the entire gene pool for all traits studied. Higher magnitude of genotypic and phenotypic coefficients of variation was recorded for seed yield, harvest index, biological yield, number of spikelets per panicle, flag leaf length, plant height and number of tillers indicates that these characters are least influence by environment. High heritability coupled with high genetic advance as percent of mean was registered for seed yield, harvest index, number of spikelets per panicle, biological yield and flag leaf length, suggesting preponderance of additive gene action in the expression of these characters. Grain yield was significantly and positively associated with harvest index, number of tillers per hill, number of panicle per plant, panicle length, number of spikelet's per panicle and test weight at both genotypic and phenotypic levels. Path coefficient analysis revealed that harvest index, biological yield, number of tillers per hill, panicle length, number of spikelets per panicle, plant height and test weight had direct positive effect on seed yield, indicating these are the main contributors to yield. From this study it may be concluded that harvest index, number of tillers per hill, panicle length and number of spikelet per panicle and test weight are the most important characters that contributed directly to yield. Thus, these characters may serve selection criteria for improving genetic potential of rice.

Semiconductor Seeded Nanorods with Graded Composition Exhibiting High Quantum-Yield, High Polarization, and Minimal Blinking.

PubMed

Hadar, Ido; Philbin, John P; Panfil, Yossef E; Neyshtadt, Shany; Lieberman, Itai; Eshet, Hagai; Lazar, Sorin; Rabani, Eran; Banin, Uri

2017-04-12

Seeded semiconductor nanorods represent a unique family of quantum confined materials that manifest characteristics of mixed dimensionality. They show polarized emission with high quantum yield and fluorescence switching under an electric field, features that are desirable for use in display technologies and other optical applications. So far, their robust synthesis has been limited mainly to CdSe/CdS heterostructures, thereby constraining the spectral tunability to the red region of the visible spectrum. Herein we present a novel synthesis of CdSe/Cd 1-x Zn x S seeded nanorods with a radially graded composition that show bright and highly polarized green emission with minimal intermittency, as confirmed by ensemble and single nanorods optical measurements. Atomistic pseudopotential simulations elucidate the importance of the Zn atoms within the nanorod structure, in particular the effect of the graded composition. Thus, the controlled addition of Zn influences and improves the nanorods' optoelectronic performance by providing an additional handle to manipulate the degree confinement beyond the common size control approach. These nanorods may be utilized in applications that require the generation of a full, rich spectrum such as energy-efficient displays and lighting.

Closing oil palm yield gaps among Indonesian smallholders through industry schemes, pruning, weeding and improved seeds

PubMed Central

Soliman, T.; Lim, F. K. S.; Lee, J. S. H.

2016-01-01

Oil palm production has led to large losses of valuable habitats for tropical biodiversity. Sparing of land for nature could in theory be attained if oil palm yields increased. The efficiency of oil palm smallholders is below its potential capacity, but the factors determining efficiency are poorly understood. We employed a two-stage data envelopment analysis approach to assess the influence of agronomic, supply chain and management factors on oil palm production efficiency in 190 smallholders in six villages in Indonesia. The results show that, on average, yield increases of 65% were possible and that fertilizer and herbicide use was excessive and inefficient. Adopting industry-supported scheme management practices, use of high-quality seeds and higher pruning and weeding rates were found to improve efficiency. Smallholder oil palm production intensification in Indonesia has the capacity to increase production by 26%, an equivalent of 1.75 million hectares of land. PMID:27853605

Closing oil palm yield gaps among Indonesian smallholders through industry schemes, pruning, weeding and improved seeds.

PubMed

Soliman, T; Lim, F K S; Lee, J S H; Carrasco, L R

2016-08-01

Oil palm production has led to large losses of valuable habitats for tropical biodiversity. Sparing of land for nature could in theory be attained if oil palm yields increased. The efficiency of oil palm smallholders is below its potential capacity, but the factors determining efficiency are poorly understood. We employed a two-stage data envelopment analysis approach to assess the influence of agronomic, supply chain and management factors on oil palm production efficiency in 190 smallholders in six villages in Indonesia. The results show that, on average, yield increases of 65% were possible and that fertilizer and herbicide use was excessive and inefficient. Adopting industry-supported scheme management practices, use of high-quality seeds and higher pruning and weeding rates were found to improve efficiency. Smallholder oil palm production intensification in Indonesia has the capacity to increase production by 26%, an equivalent of 1.75 million hectares of land.

Seed Embryo Development Is Regulated via an AN3-MINI3 Gene Cascade

PubMed Central

Meng, Lai-Sheng; Wang, Yi-Bo; Loake, Gary J.; Jiang, Ji-Hong

2016-01-01

In agriculture, seed mass is one of the most important components related to seed yield. MINISEED3 (MINI3) which encodes the transcriptional activator WRKY10, is thought to be a pivotal regulator of seed mass. In Arabidopsis SHORT HYPOCOTYL UNDER BLUE1 (SHB1) associates with the promoter of MINI3, regulating embryo cell proliferation (both cell division and elongation), which, in turn, modulates seed mass. Furthermore, the recruitment of SHB1 via MINI3 to both its cognate promoter and that of IKU2 implies a two-step amplification for countering the low expression level of IKU2, which is thought to function as a molecular switch for seed cavity enlargement. However, it is largely unknown how embryo cell proliferation, which encompasses both cell division and elongation, is regulated by SHB1 and MINI3 function. Here, we show that a loss of function mutation within the transcriptional coactivator ANGUSTIFOLIA3 (AN3), increases seed mass. Further, AN3 associates with the MINI3 promoter in vivo. Genetic evidence indicates that the absence of MINI3 function suppresses the decrease of cell number observed in an3-4 mutants by regulating cell division and in turn inhibits increased cell size of the an3-4 line by controlling cell elongation. Thus, seed embryo development is modulated via an AN3-MINI3 gene cascade. This regulatory model provides a deeper understanding of seed mass regulation, which may in turn lead to increased crop yields. PMID:27857719

Biochemical methane potential, biodegradability, alkali treatment and influence of chemical composition on methane yield of yard wastes.

PubMed

Gunaseelan, Victor Nallathambi

2016-03-01

In this study, the biochemical CH4 potential, rate, biodegradability, NaOH treatment and the influence of chemical composition on CH4 yield of yard wastes generated from seven trees were examined. All the plant parts were sampled for their chemical composition and subjected to the biochemical CH4 potential assay. The component parts exhibited significant variation in biochemical CH4 potential, which was reflected in their ultimate CH4 yields that ranged from 109 to 382 ml g(-1) volatile solids added and their rate constants that ranged from 0.042 to 0.173 d(-1). The biodegradability of the yard wastes ranged from 0.26 to 0.86. Variation in the biochemical CH4 potential of the yard wastes could be attributed to variation in the chemical composition of the different fractions. In the Thespesia yellow withered leaf, Tamarindus fruit pericarp and Albizia pod husk, NaOH treatment enhanced the ultimate CH4 yields by 17%, 77% and 63%, respectively, and biodegradability by 15%, 77% and 61%, respectively, compared with the untreated samples. The effectiveness of NaOH treatment varied for different yard wastes, depending on the amounts of acid detergent fibre content. Gliricidia petals, Prosopis leaf, inflorescence and immature pod, Tamarindus seeds, Albizia seeds, Cassia seeds and Delonix seeds exhibited CH4 yields higher than 300 ml g(-1) volatile solids added. Multiple linear regression models for predicting the ultimate CH4 yield and biodegradability of yard wastes were designed from the results of this work. © The Author(s) 2016.

Seed set in guayule (Parthenium argentatum, Asteraceae) in relation to insect pollination

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mamood, A.N.; Waller, G.D.; Ray, D.T.

Guayule (Parthenium argentatum, Asteraceae) is one of two major plant species grown for natural rubber. Studies were conducted to determine the effect of honey bee (Apis mellifera) pollination and season on seed set and total seed yield/ha. The experiments involved four pollination treatments: plants caged with bees; plants caged without bees; plants open pollinated (uncovered); and plants individually covered. Seeds were harvested monthly July-September 1984, and May-September 1985. Plots with bees produced at least 150% more seeds than plots without bees, and there were no qualitative differences in the seed weights among treatments. Highest seed yield was in May andmore » September. Results indicate that (1) insect pollination in guayule increases seed yield and (2) fewer seeds are produced in the warmest months.« less

Neck blast disease influences grain yield and quality traits of aromatic rice.

PubMed

Khan, Mohammad Ashik Iqbal; Bhuiyan, Md Rejwan; Hossain, Md Shahadat; Sen, Partha Pratim; Ara, Anjuman; Siddique, Md Abubakar; Ali, Md Ansar

2014-11-01

A critical investigation was conducted to find out the effect of neck blast disease on yield-contributing characters, and seed quality traits of aromatic rice in Bangladesh. Both healthy and neck-blast-infected panicles of three aromatic rice cultivars (high-yielding and local) were collected and investigated at Plant Pathology Division, Bangladesh Rice Research Institute (BRRI), Gazipur, Bangladesh. All of the tested varieties were highly susceptible to neck blast disease under natural conditions, though no leaf blast symptoms appear on leaves. Neck blast disease increased grain sterility percentages, reduced grain size, yield and quality traits of seeds. The degrees of yield and seed quality reduction depended on disease severity and variety's genetic make-up. Unfilled grains were the main source of seed-borne pathogen, especially for blast in the seed lot. Transmission of blast pathogen from neck (panicle base) to seed was very poor. These findings are important, especially concerning the seed certification programme in which seed lots are certified on the basis of field inspection. Finally, controlled experiments are needed to draw more critical conclusions. Copyright © 2014 Académie des sciences. Published by Elsevier SAS. All rights reserved.

Pine seed tree growth and yield on the Crossett Experimental Forest

Treesearch

Don C. Bragg

2010-01-01

In late 2002, three small tracts of loblolly (Pinus taeda) and shortleaf (Pinus echinata) pine on the Crossett Experimental Forest in Ashley County, AR, were cut using a seed tree method. Immediately after harvest, these cutting units averaged 7.7 stems and 13.8 square feet of pine basal area per acre. By 2006, live seed tree...

Molecular mapping and genomics of soybean seed protein: a review and perspective for the future.

PubMed

Patil, Gunvant; Mian, Rouf; Vuong, Tri; Pantalone, Vince; Song, Qijian; Chen, Pengyin; Shannon, Grover J; Carter, Tommy C; Nguyen, Henry T

2017-10-01

Genetic improvement of soybean protein meal is a complex process because of negative correlation with oil, yield, and temperature. This review describes the progress in mapping and genomics, identifies knowledge gaps, and highlights the need of integrated approaches. Meal protein derived from soybean [Glycine max (L) Merr.] seed is the primary source of protein in poultry and livestock feed. Protein is a key factor that determines the nutritional and economical value of soybean. Genetic improvement of soybean seed protein content is highly desirable, and major quantitative trait loci (QTL) for soybean protein have been detected and repeatedly mapped on chromosomes (Chr.) 20 (LG-I), and 15 (LG-E). However, practical breeding progress is challenging because of seed protein content's negative genetic correlation with seed yield, other seed components such as oil and sucrose, and interaction with environmental effects such as temperature during seed development. In this review, we discuss rate-limiting factors related to soybean protein content and nutritional quality, and potential control factors regulating seed storage protein. In addition, we describe advances in next-generation sequencing technologies for precise detection of natural variants and their integration with conventional and high-throughput genotyping technologies. A syntenic analysis of QTL on Chr. 15 and 20 was performed. Finally, we discuss comprehensive approaches for integrating protein and amino acid QTL, genome-wide association studies, whole-genome resequencing, and transcriptome data to accelerate identification of genomic hot spots for allele introgression and soybean meal protein improvement.

Increasing seed size and quality by manipulating BIG SEEDS1 in legume species

PubMed Central

Ge, Liangfa; Yu, Jianbin; Wang, Hongliang; Luth, Diane; Bai, Guihua; Wang, Kan

2016-01-01

Plant organs, such as seeds, are primary sources of food for both humans and animals. Seed size is one of the major agronomic traits that have been selected in crop plants during their domestication. Legume seeds are a major source of dietary proteins and oils. Here, we report a conserved role for the BIG SEEDS1 (BS1) gene in the control of seed size and weight in the model legume Medicago truncatula and the grain legume soybean (Glycine max). BS1 encodes a plant-specific transcription regulator and plays a key role in the control of the size of plant organs, including seeds, seed pods, and leaves, through a regulatory module that targets primary cell proliferation. Importantly, down-regulation of BS1 orthologs in soybean by an artificial microRNA significantly increased soybean seed size, weight, and amino acid content. Our results provide a strategy for the increase in yield and seed quality in legumes. PMID:27791139

Solvent Extraction and GC-MS Analysis of Sesame Seeds for Determination of Bioactive Antioxidant Fatty Acid/Fatty Oil Components.

PubMed

Qadir, Abdul; Ali, Athar; Arif, Muhammad; Al-Rohaimi, Abdulmohsen H; Singh, Satya Prakash; Ahmad, Usama; Khalid, Mohd; Kumar, Arun

2018-06-01

The seed kernels of Sesamum indicum L. (family: Pedaliaceae) were extracted with ethanol and yield of components determined by Gas Chromatography/Mass Spectrometry (GC/MS). The free radical scavenging activities of ethanolic extract against1, 1-Diphenyl-2-picrylhydrazyl (DPPH) were determined by UV spectrophotometer at 517 nm. Phytochemical screening revealed the presence of numerous bioactive compounds including steroids, phenolic, terpenoids, fatty acids and different types of ester compounds. The ethanolic extract was purified and analyzed by GC MS.The prevailing compounds found in ethanolic extract were Carvacrol (0.04%),Sesamol (0.11%), 4-Allyl-2-methoxy-phenol(0.04%),Palmitic acid (1.08%), cis-9-Hexadecenal (85.40%), Lineoleoyl chloride (0.52%), Palmitic acid β-monoglyceride (0.40%), Dihydro-aplotaxene (0.61%), Oleoyl chloride (1.11%), (+)-Sesamin (4.73%), 1,3-Benzodioxole, 5-[4-(1,3-benzodioxol-5-yloxy)tetrahydro-1 H,3 H-furo [3,4-c]furan-1-yl], [1 S-(1,3,4,6α.), (2.01%)], 6-Nitrocholest-5-en-3-yl acetate (0.22%), Ergost-5-en-3β-ol (2.35%) and 24-Propylidenecholesterol (0.16%). The presence ofsaturated and unsaturated fatty acids in ethanolicextract justifies the use of this plant to treat many ailments in folk and traditional medicine. Ethanolic extract have shown significant antioxidant activity(IC 50 120.38±2.8 µg/ml). The presence of phenolic (Sesamol), lignin (Sesamin) compounds and unsaturated fatty acids are reported as possible contributor for antioxidantactivity of seed extract. © Georg Thieme Verlag KG Stuttgart · New York.

Resistance to Phomopsis Seed Decay in soybean

USDA-ARS?s Scientific Manuscript database

Phomopsis seed decay (PSD) of soybean is caused primarily by the fungal pathogen, Phomopsis longicolla T.W. Hobbs along with other Phomopsis and Diaporthe spp. This disease causes poor seed quality and suppresses yield in most soybean-growing countries. Infected soybean seeds can be symptomless, but...

Study of supercritical CO2 extraction of tamarillo (Cyphomandra Betacea) seed oil containing high added value compounds.

PubMed

Dorado Achicanoy, Daniela; Hurtado Benavides, Andrés; Martínez-Correa, Hugo A

2018-04-16

In the present investigation, the extraction of tamarillo seed oil was conducted using supercritical carbon dioxide (SC-CO2), under different conditions of pressure (20-38.1 MPa) and temperature (40-64°C). In order to determine the effect that these extraction parameters have over the yield and composition of the oil, a central composite design was used. The optimum yield was 21.07% obtained at 38.1 MPa and 64°C. The fatty acids of the tamarillo seed oil obtained with SC-CO2 were identified: linoleic (70.12%), oleic (16.18%), palmitic (9.68%), stearic (2.12%), linolenic (1.70%), and palmitoleic (0.23%). Other components, such as squalene (2.96-19.75 mg/mL), β-sitosterol (2.05-3.68 mg/mL), cycloartenol (1,23-2.81 mg/mL) dihydrolanosterol (0.28-0.70 mg/mL) sterols and γ-tocopherol (0.89-2.10 mg/mL) were also noted. The extraction kinetic was studied at 27.5 MPa -50°C and 38.1 MPa -64°C. The semi-empirical model of Sovová et al. [24] described 99.21% of the experimental behavior of extraction kinetics. High yields of tamarillo seed oil, as well as its unique composition of unsaturated fatty acids and minor components, show the potential for its application in the food, cosmetic, and pharmaceutical industries. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Differential seed handling by two African primates affects seed fate and establishment of large-seeded trees

NASA Astrophysics Data System (ADS)

Gross-Camp, Nicole D.; Kaplin, Beth A.

2011-11-01

We examined the influence of seed handling by two semi-terrestrial African forest primates, chimpanzees ( Pan troglodytes) and l'Hoest's monkeys ( Cercopithecus lhoesti), on the fate of large-seeded tree species in an afromontane forest. Chimpanzees and l'Hoest's monkeys dispersed eleven seed species over one year, with quantity and quality of dispersal varying through time. Primates differed in their seed handling behaviors with chimpanzees defecating large seeds (>0.5 cm) significantly more than l'Hoest's. Furthermore, they exhibited different oral-processing techniques with chimpanzees discarding wadges containing many seeds and l'Hoest's monkeys spitting single seeds. A PCA examined the relationship between microhabitat characteristics and the site where primates deposited seeds. The first two components explained almost half of the observed variation. Microhabitat characteristics associated with sites where seeds were defecated had little overlap with those characteristics describing where spit seeds arrived, suggesting that seed handling in part determines the location where seeds are deposited. We monitored a total of 552 seed depositions through time, recording seed persistence, germination, and establishment. Defecations were deposited significantly farther from an adult conspecific than orally-discarded seeds where they experienced the greatest persistence but poorest establishment. In contrast, spit seeds were deposited closest to an adult conspecific but experienced the highest seed establishment rates. We used experimental plots to examine the relationship between seed handling, deposition site, and seed fate. We found a significant difference in seed handling and fate, with undispersed seeds in whole fruits experiencing the lowest establishment rates. Seed germination differed by habitat type with open forest experiencing the highest rates of germination. Our results highlight the relationship between primate seed handling and deposition site and seed

Antioxidant and biocidal activities of Carum nigrum (seed) essential oil, oleoresin, and their selected components.

PubMed

Singh, Gurdip; Marimuthu, Palanisamy; de Heluani, Carola S; Catalan, Cesar A N

2006-01-11

In the present study, chemical constituents of the essential oil and oleoresin of the seed from Carum nigrum obtained by hydrodistillation and Soxhlet extraction using acetone, respectively, have been studied by GC and GC-MS techniques. The major component was dillapiole (29.9%) followed by germacrene B (21.4%), beta-caryophyllene (7.8%), beta-selinene (7.1%), and nothoapiole (5.8%) along with many other components in minor amounts. Seventeen components were identified in the oleoresin (Table 2) with dillapiole as a major component (30.7%). It also contains thymol (19.1%), nothoapiole (15.2.3%), and gamma-elemene (8.0%). The antioxidant activity of both the essential oil and oleoresin was evaluated in mustard oil by monitoring peroxide, thiobarbituric acid, and total carbonyl and p-anisidine values of the oil substrate. The results showed that both the essential oil and oleoresin were able to reduce the oxidation rate of the mustard oil in the accelerated condition at 60 degrees C in comparison with synthetic antioxidants such as butylated hydroxyanisole and butylated hydroxytoluene at 0.02%. In addition, individual antioxidant assays such as linoleic acid assay, DPPH scavenging activity, reducing power, hydroxyl radical scavenging, and chelating effects have been used. The C. nigrum seed essential oil exhibited complete inhibition against Bacillus cereus and Pseudomonas aeruginosa at 2000 and 3000 ppm, respectively, by agar well diffusion method. Antifungal activity was determined against a panel of foodborne fungi such as Aspergillus niger, Penicillium purpurogenum, Penicillium madriti, Acrophialophora fusispora, Penicillium viridicatum, and Aspergillus flavus. The fruit essential oil showed 100% mycelial zone inhibition against P. purpurogenum and A. fusispora at 3000 ppm in the poison food method. Hence, both oil and oleoresin could be used as an additive in food and pharmaceutical preparations after screening.

Genotypic Variation in Yield, Yield Components, Root Morphology and Architecture, in Soybean in Relation to Water and Phosphorus Supply

PubMed Central

He, Jin; Jin, Yi; Du, Yan-Lei; Wang, Tao; Turner, Neil C.; Yang, Ru-Ping; Siddique, Kadambot H. M.; Li, Feng-Min

2017-01-01

Water shortage and low phosphorus (P) availability limit yields in soybean. Roots play important roles in water-limited and P-deficient environment, but the underlying mechanisms are largely unknown. In this study we determined the responses of four soybean [Glycine max (L.) Merr.] genotypes [Huandsedadou (HD), Bailudou (BLD), Jindou 21 (J21), and Zhonghuang 30 (ZH)] to three P levels [applied 0 (P0), 60 (P60), and 120 (P120) mg P kg-1 dry soil to the upper 0.4 m of the soil profile] and two water treatment [well-watered (WW) and water-stressed (WS)] with special reference to root morphology and architecture, we compared yield and its components, root morphology and root architecture to find out which variety and/or what kind of root architecture had high grain yield under P and drought stress. The results showed that water stress and low P, respectively, significantly reduced grain yield by 60 and 40%, daily water use by 66 and 31%, P accumulation by 40 and 80%, and N accumulation by 39 and 65%. The cultivar ZH with the lowest daily water use had the highest grain yield at P60 and P120 under drought. Increased root length was positively associated with N and P accumulation in both the WW and WS treatments, but not with grain yield under water and P deficits. However, in the WS treatment, high adventitious and lateral root densities were associated with high N and P uptake per unit root length which in turn was significantly and positively associated with grain yield. Our results suggest that (1) genetic variation of grain yield, daily water use, P and N accumulation, and root morphology and architecture were observed among the soybean cultivars and ZH had the best yield performance under P and water limited conditions; (2) water has a major influence on nutrient uptake and grain yield, while additional P supply can modestly increase yields under drought in some soybean genotypes; (3) while conserved water use plays an important role in grain yield under drought

Genotypic Variation in Yield, Yield Components, Root Morphology and Architecture, in Soybean in Relation to Water and Phosphorus Supply.

PubMed

He, Jin; Jin, Yi; Du, Yan-Lei; Wang, Tao; Turner, Neil C; Yang, Ru-Ping; Siddique, Kadambot H M; Li, Feng-Min

2017-01-01

Water shortage and low phosphorus (P) availability limit yields in soybean. Roots play important roles in water-limited and P-deficient environment, but the underlying mechanisms are largely unknown. In this study we determined the responses of four soybean [ Glycine max (L.) Merr.] genotypes [Huandsedadou (HD), Bailudou (BLD), Jindou 21 (J21), and Zhonghuang 30 (ZH)] to three P levels [applied 0 (P0), 60 (P60), and 120 (P120) mg P kg -1 dry soil to the upper 0.4 m of the soil profile] and two water treatment [well-watered (WW) and water-stressed (WS)] with special reference to root morphology and architecture, we compared yield and its components, root morphology and root architecture to find out which variety and/or what kind of root architecture had high grain yield under P and drought stress. The results showed that water stress and low P, respectively, significantly reduced grain yield by 60 and 40%, daily water use by 66 and 31%, P accumulation by 40 and 80%, and N accumulation by 39 and 65%. The cultivar ZH with the lowest daily water use had the highest grain yield at P60 and P120 under drought. Increased root length was positively associated with N and P accumulation in both the WW and WS treatments, but not with grain yield under water and P deficits. However, in the WS treatment, high adventitious and lateral root densities were associated with high N and P uptake per unit root length which in turn was significantly and positively associated with grain yield. Our results suggest that (1) genetic variation of grain yield, daily water use, P and N accumulation, and root morphology and architecture were observed among the soybean cultivars and ZH had the best yield performance under P and water limited conditions; (2) water has a major influence on nutrient uptake and grain yield, while additional P supply can modestly increase yields under drought in some soybean genotypes; (3) while conserved water use plays an important role in grain yield under drought

Seed birth to death: dual functions of reactive oxygen species in seed physiology.

PubMed

Jeevan Kumar, S P; Rajendra Prasad, S; Banerjee, Rintu; Thammineni, Chakradhar

2015-09-01

Reactive oxygen species (ROS) are considered to be detrimental to seed viability. However, recent studies have demonstrated that ROS have key roles in seed germination particularly in the release of seed dormancy and embryogenesis, as well as in protection from pathogens. This review considers the functions of ROS in seed physiology. ROS are present in all cells and at all phases of the seed life cycle. ROS accumulation is important in breaking seed dormancy, and stimulating seed germination and protection from pathogens. However, excessive ROS accumulation can be detrimental. Therefore, knowledge of the mechanisms by which ROS influence seed physiology will provide insights that may not only allow the development of seed quality markers but also help us understand how dormancy can be broken in several recalcitrant species. Reactive oxygen species have a dual role in seed physiology. Understanding the relative importance of beneficial and detrimental effects of ROS provides great scope for the improvement and maintenance of seed vigour and quality, factors that may ultimately increase crop yields. © The Author 2015. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Waterlogging effects on growth and yield components in late-planted soybean.

PubMed

Linkemer, G; Board, J E; Musgrave, M E

1998-01-01

A major agronomic problem in the southeastern USA is low yield of late-planted soybean [Glycine max (L.) Merr.]. This problem is aggravated by the adverse effect of waterlogging on crop growth. Our objectives were to identify soybean growth stages sensitive to waterlogging; identify yield components and physiological parameters explaining yield losses induced by waterlogging; and determine the extent of yield losses induced by waterlogging under natural field conditions. Greenhouse and field studies were conducted during 1993 and 1994 near Baton Rouge, LA, (30 degrees N Lat) on a Commerce silt loam. Waterlogging tolerance was assessed in cultivar Centennial (Maturity Group VI) at three vegetative and five reproductive growth stages by maintaining the water level at the soil surface in a greenhouse study. Using the same cultivar, we evaluated the effect of drainage in the field for late-planted soybean. Rain episodes determined the timing of waterlogging; redox potential and oxygen concentration of the soil were used to quantify the intensity of waterlogging stress. Results of the greenhouse study indicated that the early vegetative period (V2) and the early reproductive stages (R1, R3, and R5) were most sensitive to waterlogging. Three to 5 cm of rain per day falling on poorly drained soil was sufficient to reduce crop growth rate, resulting in a yield decline from 2453 to 1550 kg ha-1. Yield loss in both field and greenhouse studies was induced primarily by decreased pod production resulting from fewer pods per reproductive node. In conclusion, waterlogging was determined to be an important stress for late-planted soybean in high rainfall areas such as the Gulf Coast Region.

Manipulation of Auxin Response Factor 19 affects seed size in the woody perennial Jatropha curcas

PubMed Central

Sun, Yanwei; Wang, Chunming; Wang, Ning; Jiang, Xiyuan; Mao, Huizhu; Zhu, Changxiang; Wen, Fujiang; Wang, Xianghua; Lu, Zhijun; Yue, Genhua; Xu, Zengfu; Ye, Jian

2017-01-01

Seed size is a major determinant of seed yield but few is known about the genetics controlling of seed size in plants. Phytohormones cytokinin and brassinosteroid were known to be involved in the regulation of herbaceous plant seed development. Here we identified a homolog of Auxin Response Factor 19 (JcARF19) from a woody plant Jatropha curcas and genetically demonstrated its functions in controlling seed size and seed yield. Through Virus Induced Gene Silencing (VIGS), we found that JcARF19 was a positive upstream modulator in auxin signaling and may control plant organ size in J. curcas. Importantly, transgenic overexpression of JcARF19 significantly increased seed size and seed yield in plants Arabidopsis thaliana and J. curcas, indicating the importance of auxin pathway in seed yield controlling in dicot plants. Transcripts analysis indicated that ectopic expression of JcARF19 in J. curcas upregulated auxin responsive genes encoding essential regulators in cell differentiation and cytoskeletal dynamics of seed development. Our data suggested the potential of improving seed traits by precisely engineering auxin signaling in woody perennial plants. PMID:28102350

Coagulation mechanism of salt solution-extracted active component in Moringa oleifera seeds.

PubMed

Okuda, T; Baes, A U; Nishijima, W; Okada, M

2001-03-01

This study focuses on the coagulation mechanism by the purified coagulant solution (MOC-SC-PC) with the coagulation active component extracted from M. oleifera seeds using salt solution. The addition of MOC-SC-PC tap water formed insoluble matters. This formation was responsible for kaolin coagulation. On the other hand, insoluble matters were not formed when the MOC-SC-PC was added into distilled water. The formation was affected by Ca2+ or other bivalent cations which may connect each molecule of the active coagulation component in MOC-SC-PC and form a net-like structure. The coagulation mechanism of MOC-SC-PC seemed to be an enmeshment of Kaolin by the insoluble matters with the net-like structure. In case of Ca2+ ion (bivalent cations), at least 0.2 mM was necessary for coagulation at 0.3 mgC l-1 dose of MOC-SC-PC. Other coagulation mechanisms like compression of double layer, interparticle bridging or charge neutralization were not responsible for the coagulation by MOC-SC-PC.

[Seed vigor evaluation based on adversity resistance index of wheat seed germination under stress conditions.

PubMed

Chen, Lei Tai; Sun, Ai Qing; Yang, Min; Chen, Lu Lu; Ma, Xue Li; Li, Mei Ling; Yin, Yan Ping

2016-09-01

A total of 16 wheat cultivars were selected to detect seed vigor of different genotypes using standard germination test, seed germination test under stress conditions and field emergence test. The adversity resistance indices of seed vigor indices and field emergence percentage under different germination conditions were used as the indices to evaluate adversity resistance. Principal component analysis and cluster analysis were used for the comprehensive evaluation of seed vigor. Results showed that drought stress, artificial aging and cold soaking treatments affected seed vigor to some extent. The adversity resistance indices of the artificial aging and cold soaking tests were significantly positively correlated with the field emergence percentage, while the adversity resistance index of drought stress test had no significant correlation with the field emergence percentage. 16 wheat cultivars were classified as three groups based on the principal component analysis and cluster analysis. Yunong 949, Yumai 49-198, Luyuan 502, Zhengyumai 9987, Shimai 21, Shannong 23, and Shixin 828 belonged to high vigor seeds. Xunong 5, Yunong 982, Tangmai 8, Jimai 20, Jimai 22, Jinan 17, and Shannong 20 belonged to medium vigor seeds. The other two cultivars, Chang 4738 and Lunxuan 061, belonged to low vigor seeds.

Image-Based Rapid Phenotyping Method of Chickpeas Seed Size Characterization

USDA-ARS?s Scientific Manuscript database

The value of a chickpea crop is influenced by both total seed yield and also by the size of the harvested seed. Larger seeds are used for canning, salads, and fresh markets and have a higher value than smaller seeds, which are typically processed into hummus. The standard method for determining seed...

Soil quality assessment in long-term direct seed

USDA-ARS?s Scientific Manuscript database

Producers in the Pacific Northwest are adopting direct seed farming to reduce soil erosion, improve soil quality and increase water infiltration. Some direct seed producers are concerned with reaching the yield and profit potential expected with long-term direct seed, and this may be due to soil st...

Relation between salt tolerance and biochemical changes in cumin (Cuminum cyminum L.) seeds.

PubMed

Bettaieb Rebey, Iness; Bourgou, Soumaya; Rahali, Fatma Zohra; Msaada, Kamel; Ksouri, Riadh; Marzouk, Brahim

2017-04-01

In this study, the effects of salinity on growth, fatty acid, essential oil, and phenolic composition of cumin (Cuminum cyminum L.) seeds as well as the antioxidant activities of their extracts were investigated. Plants were treated with different concentrations of NaCl treatment: 0, 50, 75, and 125 mmoL. Plant growth was significantly reduced with the severity of saline treatment. This also caused important reductions in the seed yield and yield components. Besides, NaCl treatments affected fatty acid composition. Petroselinic and linoleic acids proportions diminished consistently with the increase in NaCl concentration, whereas palmitic acid proportion increased. Furthermore, NaCl enhanced essential oil production in C. cyminum seeds and induced marked changes on the essential oil quality. Essential oil chemotype was modified from γ-terpinene/1-phenyl-1,2 ethanediol in control to γ-terpinene/β-pinene in salt stressed plants. Total polyphenol content was higher in treated seeds, and salinity improved the amount of individual phenolic compounds. Moreover, antioxidant activities of the extracts were determined by four different test systems, namely 2,2-diphenyl-1-picrylhydrazyl, β-carotene/linoleic acid chelating, and reducing power assays. The highest antioxidant activities were reveled in severe stressed plants. In this case, cumin seeds produced under saline conditions may function as a potential source of essential oil and antioxidant compounds, which could support the utilization of this plant in a large field of applications such as food industry. Copyright © 2016. Published by Elsevier B.V.

Seed predators exert selection on the subindividual variation of seed size.

PubMed

Sobral, M; Guitián, J; Guitián, P; Larrinaga, A R

2014-07-01

Subindividual variation among repeated organs in plants constitutes an overlooked level of variation in phenotypic selection studies, despite being a major component of phenotypic variation. Animals that interact with plants could be selective agents on subindividual variation. This study examines selective pressures exerted during post-dispersal seed predation and germination on the subindividual variation of seed size in hawthorn (Crataegus monogyna). With a seed offering experiment and a germination test, we estimated phenotypic selection differentials for average and subindividual variation of seed size due to seed predation and germination. Seed size affects germination, growth rate and the probability of an individual seed of escaping predation. Longer seeds showed higher germination rates, but this did not result in significant selection on phenotypes of the maternal trees. On the other hand, seed predators avoided wider seeds, and by doing so exerted phenotypic selection on adult average and subindividual variation of seed size. The detected selection on subindividual variation suggests that the levels of phenotypic variation within individual plants may be, at least partly, the adaptive consequence of animal-mediated selection. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2011 CFR

2011-04-01

... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2012 CFR

2012-04-01

... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2010 CFR

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2013 CFR

2013-04-01

... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

Seed potato production system in Japan, starting from foundation seed of potato

PubMed Central

Kawakami, Tsukasa; Oohori, Hidemiki; Tajima, Kazuyuki

2015-01-01

Potato is one of the staple crops cultivated in upland farming in Japan and is propagated vegetatively by means of tubers. However once infected with diseases, potato yield decreases significantly. And one seed potato can produce approximately only 10 potato tubers. To improve the production system of seed potatoes in Japan, Japanese government established a three-stage propagation system for the production and distribution of healthy and disease-free seed potatoes. The National Center for Seeds and Seedlings (NCSS) has a role for the production of foundation seed potatoes and strictly manages the production in isolated fields that are treated thoroughly to control pests and diseases. Recently though the distribution of foundation seed potatoes is decreasing, the number of varieties of foundation seed potatoes has increased steadily. And new varieties of potato adapted various requirements, including resistance of the golden potato cyst nematode, have been increasing. Therefore, NCSS is introducing a new method of producing minitubers (MnTs) by using hydroponic cultivation greenhouse to increase the efficiency of propagation and to rapidly disseminate these new potato varieties. In this review, we describe a seed potato production system in Japan and the production of foundation seed potatoes as an important role of NCSS. PMID:25931977

Stand-level growth and yield component models for red oak-sweetgum forests on Mid-South minor stream bottoms

Treesearch

Emily B. Schultz; J. Clint Iles; Thomas G. Matney; Andrew W. Ezell; James S. Meadows; Theodor D. Leininger; al. et.

2010-01-01

Greater emphasis is being placed on Southern bottomland hardwood management, but relatively few growth and yield prediction systems exist that are based on sufficient measurements. We present the aggregate stand-level expected yield and structural component equations for a red oak (Quercus section Lobatae)-sweetgum (Liquidambar styraciflua L.) growth and yield model....

Soil Texture and Cultivar Effects on Rice (Oryza sativa, L.) Grain Yield, Yield Components and Water Productivity in Three Water Regimes.

PubMed

Dou, Fugen; Soriano, Junel; Tabien, Rodante E; Chen, Kun

2016-01-01

The objective of this study was to determine the effects of water regime/soil condition (continuous flooding, saturated, and aerobic), cultivar ('Cocodrie' and 'Rondo'), and soil texture (clay and sandy loam) on rice grain yield, yield components and water productivity using a greenhouse trial. Rice grain yield was significantly affected by soil texture and the interaction between water regime and cultivar. Significantly higher yield was obtained in continuous flooding than in aerobic and saturated soil conditions but the latter treatments were comparable to each other. For Rondo, its grain yield has decreased with soil water regimes in the order of continuous flooding, saturated and aerobic treatments. The rice grain yield in clay soil was 46% higher than in sandy loam soil averaged across cultivar and water regime. Compared to aerobic condition, saturated and continuous flooding treatments had greater panicle numbers. In addition, panicle number in clay soil was 25% higher than in sandy loam soil. The spikelet number of Cocodrie was 29% greater than that of Rondo, indicating that rice cultivar had greater effect on spikelet number than soil type and water management. Water productivity was significantly affected by the interaction of water regime and cultivar. Compared to sandy loam soil, clay soil was 25% higher in water productivity. Our results indicated that cultivar selection and soil texture are important factors in deciding what water management option to practice.

Blackleg (Leptosphaeria maculans) Severity and Yield Loss in Canola in Alberta, Canada

PubMed Central

Hwang, Sheau-Fang; Strelkov, Stephen E.; Peng, Gary; Ahmed, Hafiz; Zhou, Qixing; Turnbull, George

2016-01-01

Blackleg, caused by Leptosphaeria maculans, is an important disease of oilseed rape (Brassica napus L.) in Canada and throughout the world. Severe epidemics of blackleg can result in significant yield losses. Understanding disease-yield relationships is a prerequisite for measuring the agronomic efficacy and economic benefits of control methods. Field experiments were conducted in 2013, 2014, and 2015 to determine the relationship between blackleg disease severity and yield in a susceptible cultivar and in moderately resistant to resistant canola hybrids. Disease severity was lower, and seed yield was 120%–128% greater, in the moderately resistant to resistant hybrids compared with the susceptible cultivar. Regression analysis showed that pod number and seed yield declined linearly as blackleg severity increased. Seed yield per plant decreased by 1.8 g for each unit increase in disease severity, corresponding to a decline in yield of 17.2% for each unit increase in disease severity. Pyraclostrobin fungicide reduced disease severity in all site-years and increased yield. These results show that the reduction of blackleg in canola crops substantially improves yields. PMID:27447676

Multigene Engineering of Triacylglycerol Metabolism Boosts Seed Oil Content in Arabidopsis1[W][OPEN

PubMed Central

van Erp, Harrie; Kelly, Amélie A.; Menard, Guillaume; Eastmond, Peter J.

2014-01-01

Increasing the yield of oilseed crops is an important objective for biotechnologists. A number of individual genes involved in triacylglycerol metabolism have previously been reported to enhance the oil content of seeds when their expression is altered. However, it has yet to be established whether specific combinations of these genes can be used to achieve an additive effect and whether this leads to enhanced yield. Using Arabidopsis (Arabidopsis thaliana) as an experimental system, we show that seed-specific overexpression of WRINKLED1 (a transcriptional regulator of glycolysis and fatty acid synthesis) and DIACYLGLYCEROL ACYLTRANSFERASE1 (a triacylglycerol biosynthetic enzyme) combined with suppression of the triacylglycerol lipase SUGAR-DEPENDENT1 results in a higher percentage seed oil content and greater seed mass than manipulation of each gene individually. Analysis of total seed yield per plant suggests that, despite a reduction in seed number, the total yield of oil is also increased. PMID:24696520

Modern Breeding and Biotechnological Approaches to Enhance Carotenoid Accumulation in Seeds.

PubMed

Federico, M L; Schmidt, M A

There is an increasing demand for carotenoids, which are fundamental components of the human diet, for example as precursors of vitamin A. Carotenoids are also potent antioxidants and their health benefits are becoming increasingly evident. Protective effects against prostate cancer and age-related macular degeneration have been proposed for lycopene and lutein/zeaxanthin, respectively. Additionally, β-carotene, astaxanthin and canthaxanthin are high-value carotenoids used by the food industry as feed supplements and colorants. The production and consumption of these carotenoids from natural sources, especially from seeds, constitutes an important step towards fortifying the diet of malnourished people in developing nations. Therefore, attempts to metabolically manipulate β-carotene production in plants have received global attention, especially after the generation of Golden Rice (Oryza sativa). The endosperms of Golden Rice seeds synthesize and accumulate large quantities of β-carotene (provitamin A), yielding a characteristic yellow color in the polished grains. Classical breeding efforts have also focused in the development of cultivars with elevated seed carotenoid content, with maize and other cereals leading the way. In this communication we will summarize transgenic efforts and modern breeding strategies to fortify various crop seeds with nutraceutical carotenoids.

Heterosis and correlation in interspecific and intraspecific hybrids of cotton.

PubMed

Munir, S; Hussain, S B; Manzoor, H; Quereshi, M K; Zubair, M; Nouman, W; Shehzad, A N; Rasul, S; Manzoor, S A

2016-06-24

Interspecific and intraspecific hybrids show varying degrees of heterosis for yield and yield components. Yield-component traits have complex genetic relationships with each other. To determine the relationship of yield-component traits and fiber traits with seed cotton yield, six lines (Bt. CIM-599, CIM-573, MNH-786, CIM-554, BH-167, and GIZA-7) and three test lines (MNH-886, V4, and CIM-557) were crossed in a line x tester mating design. Heterosis was observed for seed cotton yield, fiber traits, and for other yield-component traits. Heterosis in interspecific hybrids for seed cotton yield was more prominent than in intraspecific hybrids. The interspecific hybrid Giza-7 x MNH-886 had the highest heterosis (114.77), while among intraspecific hybrids, CIM-554 x CIM-557 had the highest heterosis (61.29) for seed cotton yield. A major trait contributing to seed cotton yield was bolls/plant followed by boll weight. Correlation studies revealed that bolls/plant, boll weight, lint weight/boll, lint index, seed index, lint/seed, staple length, and staple strength were significantly and positively associated with seed cotton yield. Selection based on boll weight, boll number, lint weight/boll, and lint index will be helpful for improving cotton seed yield.

The influence of purge times on the yields of essential oil components extracted from plants by pressurized liquid extraction.

PubMed

Wianowska, Dorota

2014-01-01

The influence of different purge times on the yield of the main essential oil constituents of rosemary (Rosmarinus officinalis L.), thyme (Thymus vulgaris L.), and chamomile (Chamomilla recutita L.) was investigated. The pressurized liquid extraction process was performed by applying different extraction temperatures and solvents. The results presented in the paper show that the estimated yield of essential oil components extracted from the plants in the pressurized liquid extraction process is purge time-dependent. The differences in the estimated yields are mainly connected with the evaporation of individual essential oil components and the applied solvent during the purge; the more volatile an essential oil constituent is, the greater is its loss during purge time, and the faster the evaporation of the solvent during the purge process is, the higher the concentration of less volatile essential oil components in the pressurized liquid extraction receptacle. The effect of purge time on the estimated yield of individual essential oil constituents is additionally differentiated by the extraction temperature and the extraction ability of the applied solvent.

Study of water stress effects in different growth stages on yield and yield components of different rice (Oryza sativa L.) cultivars.

PubMed

Sarvestani, Zinolabedin Tahmasebi; Pirdashti, Hemmatollah; Sanavy, Seyed Ali Mohammad Modarres; Balouchi, Hamidreza

2008-05-15

A field experiment was conducted during 2001-2003 to evaluate the effect of water stress on the yield and yield components of four rice cultivars commonly grown in Mazandaran province, Iran. In northern Iran irrigated lowland rice usually experiences water deficit during the growing season include of land preparation time, planting, tillering stage, flowering and grain filing period. Recently drought affected 20 of 28 provinces in Iran; with the southeastern, central and eastern parts of the country being most severely affected. The local and improved cultivars used were Tarom, Khazar, Fajr and Nemat. The different water stress conditions were water stress during vegetative, flowering and grain filling stages and well watered was the control. Water stress at vegetative stage significantly reduced plant height of all cultivars. Water stress at flowering stage had a greater grain yield reduction than water stress at other times. The reduction of grain yield largely resulted from the reduction in fertile panicle and filled grain percentage. Water deficit during vegetative, flowering and grain filling stages reduced mean grain yield by 21, 50 and 21% on average in comparison to control respectively. The yield advantage of two semidwarf varieties, Fajr and Nemat, were not maintained under drought stress. Total biomass, harvest index, plant height, filled grain, unfilled grain and 1000 grain weight were reduced under water stress in all cultivars. Water stress at vegetative stage effectively reduced total biomass due to decrease of photosynthesis rate and dry matter accumulation.

Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.).

PubMed

Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R

2016-03-01

Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).

Extraction optimization of mucilage from Basil (Ocimum basilicum L.) seeds using response surface methodology.

PubMed

Nazir, Sadaf; Wani, Idrees Ahmed; Masoodi, Farooq Ahmad

2017-05-01

Aqueous extraction of basil seed mucilage was optimized using response surface methodology. A Central Composite Rotatable Design (CCRD) for modeling of three independent variables: temperature (40-91 °C); extraction time (1.6-3.3 h) and water/seed ratio (18:1-77:1) was used to study the response for yield. Experimental values for extraction yield ranged from 7.86 to 20.5 g/100 g. Extraction yield was significantly ( P  < 0.05) affected by all the variables. Temperature and water/seed ratio were found to have pronounced effect while the extraction time was found to have minor possible effects. Graphical optimization determined the optimal conditions for the extraction of mucilage. The optimal condition predicted an extraction yield of 20.49 g/100 g at 56.7 °C, 1.6 h, and a water/seed ratio of 66.84:1. Optimal conditions were determined to obtain highest extraction yield. Results indicated that water/seed ratio was the most significant parameter, followed by temperature and time.

Spectral considerations for modeling yield of canola

USDA-ARS?s Scientific Manuscript database

Conspicuous yellow flowers that are present in a Brassica oilseed crop such as canola require careful consideration when selecting a spectral index for yield estimation. This study evaluated spectral indices for multispectral sensors that correlate with the seed yield of Brassica oilseed crops. A ...

Potential of multiseeded mutant (msd) to boost sorghum grain yield

USDA-ARS?s Scientific Manuscript database

Seed number per plant is an important determinant of the grain yield in cereal and other crops. We have isolated a class of multiseeded (msd) sorghum (Sorghum bicolor L. Moench) mutants that are capable of producing three times the seed number and twice the seed weight per panicle as compared with t...

Identification of heterotic loci associated with grain yield and its components using two CSSL test populations in maize

PubMed Central

Wang, Hongqiu; Zhang, Xiangge; Yang, Huili; Liu, Xiaoyang; Li, Huimin; Yuan, Liang; Li, Weihua; Fu, Zhiyuan; Tang, Jihua; Kang, Dingming

2016-01-01

Heterosis has widely been used to increase grain yield and quality. In this study, the genetic basis of heterosis on grain yield and its main components in maize were examined over 2 years in two locations in two test populations constructed from a set of 184 chromosome segment substitution lines (CSSLs) and two inbred lines (Zheng58 and Xun9058). Of the 169 heterotic loci (HL) associated with grain yield and its five components identified in CSSL × Zheng58 and CSSL × Xun9058 test populations, only 25 HL were detected in both populations. The comparison of quantitative trait loci (QTLs) detected in the CSSL population with HL detected in the two test populations revealed that only 15.46% and 17.35% of the HL in the given populations respectively, shared the same chromosomal regions as that of the corresponding QTLs and showed dominant effects as well as pleiotropism with additive and dominant effects. In addition, most of the HL (74.23% and 74.49%) had overdominant effects. These results suggest that overdominance is the main contributor to the effects of heterosis on grain yield and its components in maize, and different HL are associated with heterosis for different traits in different hybrids. PMID:27917917

Anatomy and cell wall polysaccharides of almond (Prunus dulcis D. A. Webb) seeds.

PubMed

Dourado, Fernando; Barros, António; Mota, Manuel; Coimbra, Manuel A; Gama, Francisco M

2004-03-10

The anatomy of Prunus dulcis was analyzed by applying several differential staining techniques and light microscopy. Prunus dulcis seed has a thin and structurally complex seed coat, with lignified cellulosic tissue. The embryo has two voluminous cotyledons. Cotyledon cells have a high number of protein and lipid bodies, some of which have phytin. The provascular tissue, located in the cotyledons, is oriented in small bundles perpendicular to the transverse embryonic axis. Prunus dulcis cell wall material is very rich in arabinose (45 mol %). Glucose (23%), uronic acids (12%), and xylose (12%) are also major sugar components. The polymers obtained from the imidazole and Na(2)CO(3) extracts contain mainly pectic substances rich in arabinose, but the sugar content of these extracts was very low. The majority of the pectic substances (also rich in arabinose) was recovered with the KOH extracts. These extracts, with high sugar content, yielded also xyloglucans and acidic xylans. The 4 M KOH + H(3)BO(3) extracts yielded polysaccharides rich in uronic acids and xylose and very rich in arabinose, accounting for 27% of the cell wall material.

Comparison of oilseed yields: a preliminary review

DOE Office of Scientific and Technical Information (OSTI.GOV)

Duke, J.A.; Bagby, M.O.

It was assumed that for most oilseed crops, 90% of the oil yield might be considered as profit. To compare oil seeds, pertinent portions of the yield and energy paragraphs from a summary published by Dr. Duke for DOE Grant No. 59-2246-1-6-054-0 with Dr. Bagby as ADODR were reproduced. The seed yields ranged from 200 to 14,000 kg/ha, the low one too low to consider and the high one suspiciously high. The yield of 14,000 kg oil per hectare is equivalent to more than 30 barrels of oil per hectare. The energy species included ambrette, tung-oil tree, cashew, wood-oil tree,more » mu-oil tree, peanut, mustard greens; rape, colza; black mustard, turnip, safflower, colocynth, coconut, crambe, African oil palm, soybean, cotton, sunflower, Eastern black walnut, Engligh walnut, meadow foam, flax, macadamia nuts, opium poppy, perilla, almond, castorbean, Chinese tallow tree, sesame, jojoba, yellow mustard, stokes' aster, and Zanzibar oilvine. 1 table. (DP)« less

Value of Neonicotinoid Insecticide Seed Treatments in Mid-South Corn (Zea mays) Production Systems.

PubMed

North, J H; Gore, J; Catchot, A L; Stewart, S D; Lorenz, G M; Musser, F R; Cook, D R; Kerns, D L; Leonard, B R; Dodds, D M

2018-02-09

Neonicotinoid seed treatments are one of several effective control options used in corn, Zea mays L., production in the Mid-South for early season insect pests. An analysis was performed on 91 insecticide seed treatment trials from Arkansas, Louisiana, Mississippi, and Tennessee to determine the value of neonicotinoids in corn production systems. The analysis compared neonicotinoid insecticide treated seed plus a fungicide to seed only with the same fungicide. When analyzed by state, corn yields were significantly higher when neonicotinoid seed treatments were used compared to fungicide only treated seed in Louisiana and Mississippi. Corn seed treated with neonicotinoid seed treatments yielded 111, 1,093, 416, and 140 kg/ha, higher than fungicide only treatments for Arkansas, Louisiana, Mississippi, and Tennessee, respectively. Across all states, neonicotinoid seed treatments resulted in a 700 kg/ha advantage compared to fungicide only treated corn seed. Net returns for corn treated with neonicotinoid seed treatment were $1,446/ha compared with $1,390/ha for fungicide only treated corn seed across the Mid-South. Economic returns for neonicotinoid seed treated corn were significantly greater than fungicide-only-treated corn seed in 8 out of 14 yr. When analyzed by state, economic returns for neonicotinoid seed treatments were significantly greater than fungicide-only-treated seed in Louisiana. In some areas, dependent on year, neonicotinoid seed treatments provide significant yield and economic benefits in Mid-South corn. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Preparation and mechanism analysis of an environment-friendly maize seed coating agent.

PubMed

Zeng, Defang; Fan, Zhao; Tian, Xu; Wang, Wenjin; Zhou, Mingchun; Li, Haochuan

2018-06-01

Traditional seed coating agents often contain toxic ingredients, which contaminate the environment and threaten human health. This paper expounds a method of preparing a novel environment-friendly seed coating agent for maize and researches its mechanism of action. The natural polysaccharide polymer, which is the main active ingredient of this environment-friendly seed coating agent, has the characteristics of innocuity and harmlessness, and it can replace the toxic ingredients used in traditional seed coating agents. This environment-friendly seed coating agent for maize was mainly made up of the natural polysaccharide polymer and other additives. The field trials results showed that the control efficacy of Helminthosporium maydis came to 93.72%, the anti-feeding rate of cutworms came to 81.29%, and the maize yield was increased by 17.75%. Besides, the LD 50 value (half the lethal dose in rats) of this seed coating agent was 10 times higher than that of the traditional seed coating agents. This seed coating agent could improve the activity of plant protective enzymes (peroxidase, catalase and superoxidase dismutase) and increase the chlorophyll content. This seed coating agent has four characteristics of disease prevention, desinsectization, increasing yield and safety. Results of mechanism analyses showed that this seed coating agent could enhance disease control effectiveness by improving plant protective enzymes activity and increase maize yield by improving chlorophyll content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

TaCYP78A5 regulates seed size in wheat (Triticum aestivum).

PubMed

Ma, Meng; Zhao, Huixian; Li, Zhaojie; Hu, Shengwu; Song, Weining; Liu, Xiangli

2016-03-01

Seed size is an important agronomic trait and a major component of seed yield in wheat. However, little is known about the genes and mechanisms that determine the final seed size in wheat. Here, we isolated TaCYP78A5, the orthologous gene of Arabidopsis CYP78A5/KLUH in wheat, from wheat cv. Shaan 512 and demonstrated that the expression of TaCYP78A5 affects seed size. TaCYP78A5 encodes the cytochrome P450 (CYP) 78A5 protein in wheat and rescued the phenotype of the Arabidopsis deletion mutant cyp78a5. By affecting the extent of integument cell proliferation in the developing ovule and seed, TaCYP78A5 influenced the growth of the seed coat, which appears to limit seed growth. TaCYP78A5 silencing caused a 10% reduction in cell numbers in the seed coat, resulting in a 10% reduction in seed size in wheat cv. Shaan 512. By contrast, the overexpression of TaCYP78A5 increased the number of cells in the seed coat, resulting in seed enlargement of ~11-35% in Arabidopsis. TaCYP78A5 activity was positively correlated with the final seed size. However, TaCYP78A5 overexpression significantly reduced seed set in Arabidopsis, possibly due to an ovule development defect. TaCYP78A5 also influenced embryo development by promoting embryo integument cell proliferation during seed development. Accordingly, a working model of the influence of TaCYP7A5 on seed size was proposed. This study provides direct evidence that TaCYP78A5 affects seed size and is a potential target for crop improvement. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Development of a Rapid Point-of-Use DNA Test for the Screening of Genuity® Roundup Ready 2 Yield® Soybean in Seed Samples

PubMed Central

Chandu, Dilip; Paul, Sudakshina; Parker, Mathew; Dudin, Yelena; King-Sitzes, Jennifer; Perez, Tim; Mittanck, Don W.; Shah, Manali; Glenn, Kevin C.; Piepenburg, Olaf

2016-01-01

Testing for the presence of genetically modified material in seed samples is of critical importance for all stakeholders in the agricultural industry, including growers, seed manufacturers, and regulatory bodies. While rapid antibody-based testing for the transgenic protein has fulfilled this need in the past, the introduction of new variants of a given transgene demands new diagnostic regimen that allows distinguishing different traits at the nucleic acid level. Although such molecular tests can be performed by PCR in the laboratory, their requirement for expensive equipment and sophisticated operation have prevented its uptake in point-of-use applications. A recently developed isothermal DNA amplification technique, recombinase polymerase amplification (RPA), combines simple sample preparation and amplification work-flow procedures with the use of minimal detection equipment in real time. Here, we report the development of a highly sensitive and specific RPA-based detection system for Genuity Roundup Ready 2 Yield (RR2Y) material in soybean (Glycine max) seed samples and present the results of studies applying the method in both laboratory and field-type settings. PMID:27314015

Development of a Rapid Point-of-Use DNA Test for the Screening of Genuity® Roundup Ready 2 Yield® Soybean in Seed Samples.

PubMed

Chandu, Dilip; Paul, Sudakshina; Parker, Mathew; Dudin, Yelena; King-Sitzes, Jennifer; Perez, Tim; Mittanck, Don W; Shah, Manali; Glenn, Kevin C; Piepenburg, Olaf

2016-01-01

Testing for the presence of genetically modified material in seed samples is of critical importance for all stakeholders in the agricultural industry, including growers, seed manufacturers, and regulatory bodies. While rapid antibody-based testing for the transgenic protein has fulfilled this need in the past, the introduction of new variants of a given transgene demands new diagnostic regimen that allows distinguishing different traits at the nucleic acid level. Although such molecular tests can be performed by PCR in the laboratory, their requirement for expensive equipment and sophisticated operation have prevented its uptake in point-of-use applications. A recently developed isothermal DNA amplification technique, recombinase polymerase amplification (RPA), combines simple sample preparation and amplification work-flow procedures with the use of minimal detection equipment in real time. Here, we report the development of a highly sensitive and specific RPA-based detection system for Genuity Roundup Ready 2 Yield (RR2Y) material in soybean (Glycine max) seed samples and present the results of studies applying the method in both laboratory and field-type settings.

Diverse regulatory factors associate with flowering time and yield responses in winter-type Brassica napus.

PubMed

Schiessl, Sarah; Iniguez-Luy, Federico; Qian, Wei; Snowdon, Rod J

2015-09-29

Flowering time, plant height and seed yield are strongly influenced by climatic and day-length adaptation in crop plants. To investigate these traits under highly diverse field conditions in the important oilseed crop Brassica napus, we performed a genome-wide association study using data from diverse agroecological environments spanning three continents. A total of 158 European winter-type B.napus inbred lines were genotyped with 21,623 unique, single-locus single-nucleotide polymorphism (SNP) markers using the Brassica 60 K-SNP Illumina® Infinium consortium array. Phenotypic associations were calculated in the panel over the years 2010-2012 for flowering time, plant height and seed yield in 5 highly diverse locations in Germany, China and Chile, adding up to 11 diverse environments in total. We identified 101 genome regions associating with the onset of flowering, 69 with plant height, 36 with seed yield and 68 cross-trait regions with potential adaptive value. Within these regions, B.napus orthologs for a number of candidate adaptation genes were detected, including central circadian clock components like CIRCADIAN CLOCK- ASSOCIATED 1 (Bna.CCA1) and the important flowering-time regulators FLOWERING LOCUS T (Bna.FT) and FRUITFUL (Bna.FUL). Gene ontology (GO) enrichment analysis of candidate regions suggested that selection of genes involved in post-transcriptional and epigenetic regulation of flowering time may play a potential role in adaptation of B. napus to highly divergent environments. The classical flowering time regulators Bna.FLC and Bna.CO were not found among the candidate regions, although both show functional variation. Allelic effects were additive for plant height and yield, but not for flowering time. The scarcity of positive minor alleles for yield in this breeding pool points to a lack of diversity for adaptation that could restrict yield gain in the face of environmental change. Our study provides a valuable framework to further improve the

Value of neonicotinoid seed treatments to US soybean farmers.

PubMed

Hurley, Terrance; Mitchell, Paul

2017-01-01

The benefits of neonicotinoid seed treatment to soybean farmers have received increased scrutiny. Rather than use data from small-plot experiments, this research uses survey data from 500 US farmers to estimate the benefit of neonicotinoid seed treatments to them. As seed treatment users, farmers are familiar with their benefits in the field and have economic incentives to only use them if they provide value. Of the surveyed farmers, 51% used insecticide seed treatments, averaging 87% of their soybean area. Farmers indicated that human and environmental safety is an important consideration affecting their pest management decisions and reported aphids as the most managed and important soybean pest. Asking farmers who used seed treatments to state how much value they provided gives an estimate of $US 28.04 ha -1 treated in 2013, net of seed treatment costs. Farmer-reported average yields provided an estimated average yield gain of 128.0 kg ha -1 treated in 2013, or about $US 42.20 ha -1 treated, net of seed treatment costs. These estimates using different data and methods are consistent and suggest the value of insecticide seed treatments to the US soybean farmers who used them in 2013 was around $US 28-42 ha -1 treated, net of seed treatment costs. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

PubMed

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

Changes in the germination process and growth of pea in effect of laser seed irradiation

NASA Astrophysics Data System (ADS)

Podleśna, Anna; Gładyszewska, Bożena; Podleśny, Janusz; Zgrajka, Wojciech

2015-10-01

The aim of this study was to determine the effect of pre-sowing helium-neon (He-Ne) laser irradiation of pea seeds on changes in seed biochemical processes, germination rate, seedling emergence, growth rate, and yield. The first experimental factor was exposure to laser radiation: D0 - no irradiation, D3 - three exposures, D5 - five exposures, and the harvest dates were the second factor. Pre-sowing treatment of pea seeds with He-Ne laser light increased the concentrations of amylolytic enzymes and the content of indole-3-acetic acid (IAA) in pea seeds and seedlings. The exposure of seeds to He-Ne laser light improved the germination rate and uniformity and modified growth stages, which caused acceleration of flowering and ripening of pea plants. Laser light stimulation improved the morphological characteristics of plants by increasing plant height and leaf surface area. Irradiation improved the yield of vegetative and reproductive organs of pea, although the effects varied at the different growth stages. The increase in the seed yield resulted from a higher number of pods and seeds per plant, whereas no significant changes were observed in the number of seeds per pod. Both radiation doses exerted similarly stimulating effects on pea growth, development, and yield.

OsCNGC13 promotes seed-setting rate by facilitating pollen tube growth in stylar tissues.

PubMed

Xu, Yang; Yang, Jie; Wang, Yihua; Wang, Jiachang; Yu, Yang; Long, Yu; Wang, Yunlong; Zhang, Huan; Ren, Yulong; Chen, Jun; Wang, Ying; Zhang, Xin; Guo, Xiuping; Wu, Fuqing; Zhu, Shanshan; Lin, Qibing; Jiang, Ling; Wu, Chuanyin; Wang, Haiyang; Wan, Jianmin

2017-07-01

Seed-setting rate is a critical determinant of grain yield in rice (Oryza sativa L.). Rapid and healthy pollen tube growth in the style is required for high seed-setting rate. The molecular mechanisms governing this process remain largely unknown. In this study, we isolate a dominant low seed-setting rate rice mutant, sss1-D. Cellular examination results show that pollen tube growth is blocked in about half of the mutant styles. Molecular cloning and functional assays reveals that SSS1-D encodes OsCNGC13, a member of the cyclic nucleotide-gated channel family. OsCNGC13 is preferentially expressed in the pistils and its expression is dramatically reduced in the heterozygous plant, suggesting a haploinsufficiency nature for the dominant mutant phenotype. We show that OsCNGC13 is permeable to Ca2+. Consistent with this, accumulation of cytoplasmic calcium concentration ([Ca2+]cyt) is defective in the sss1-D mutant style after pollination. Further, the sss1-D mutant has altered extracellular matrix (ECM) components and delayed cell death in the style transmission tract (STT). Based on these results, we propose that OsCNGC13 acts as a novel maternal sporophytic factor required for stylar [Ca2+]cyt accumulation, ECM components modification and STT cell death, thus facilitating the penetration of pollen tube in the style for successful double fertilization and seed-setting in rice.

Onion Hybrid Seed Production: Relation with Nectar Composition and Flower Traits.

PubMed

Soto, Veronica C; Caselles, Cristian A; Silva, Maria F; Galmarini, Claudio R

2018-05-28

Onion (Allium cepa L.) is one of the main vegetable crops. Pollinators are required for onion seed production, being honeybees the most used. Around the world, two types of onion varieties are grown: open pollinated (OP) and hybrids. Hybrids offer numerous advantages to growers, but usually have lower seed yields than OP cultivars, which in many cases compromise the success of new hybrids. As pollination is critical for seed set, understanding the role of floral rewards and attractants to pollinator species is the key to improve crop seed yield. In this study, the correlation of nectar-analyzed compounds, floral traits, and seed yield under open field conditions in two experimental sites was determined. Nectar composition was described through the analysis of sugars, phenol, and alkaloid compounds. Length and width of the style and tepals of the flowers were measured to describe floral traits. Floral and nectar traits showed differences among the studied lines. For nectar traits, we found a significant influence of the environment where plants were cultivated. Nonetheless, flower traits were not influenced by the experimental sites. The OP and the male-sterile lines (MSLs) showed differences in nectar chemical composition and floral traits. In addition, there were differences between and within MSLs, some of which were correlated with seed yield, bringing the opportunity to select the most productive MSL, using simple determinations of morphological characters like the length of the style or tepals size.

Assessing the impacts of current and future concentrations of surface ozone on crop yield with meta-analysis

NASA Astrophysics Data System (ADS)

Feng, Zhaozhong; Kobayashi, Kazuhiko

Meta-analysis was conducted to quantitatively assess the effects of rising ozone concentrations ([O 3]) on yield and yield components of major food crops: potato, barley, wheat, rice, bean and soybean in 406 experimental observations. Yield loss of the crops under current and future [O 3] was expressed relative to the yield under base [O 3] (≤26 ppb). With potato, current [O 3] (31-50 ppb) reduced the yield by 5.3%, and it reduced the yield of barley, wheat and rice by 8.9%, 9.7% and 17.5%, respectively. In bean and soybean, the yield losses were 19.0% and 7.7%, respectively. Compared with yield loss at current [O 3], future [O 3] (51-75 ppb) drove a further 10% loss in yield of soybean, wheat and rice, and 20% loss in bean. Mass of individual grain, seed, or tuber was often the major cause of the yield loss at current and future [O 3], whereas other yield components also contributed to the yield loss in some cases. No significant difference was found between the responses in crops grown in pots and those in the ground for any yield parameters. The ameliorating effect of elevated [CO 2] was significant in the yields of wheat and potato, and the individual grain weight in wheat exposed to future [O 3]. These findings confirm the rising [O 3] as a threat to food security for the growing global population in this century.

Seed weight - seedling size correlation in coastal Douglas-fir: genetic and environmental components.

Treesearch

Frank C. Sorensen; Robert K. Campbell

1992-01-01

The effect of seed weight on nursery seedling height was analyzed in two experiments. In expt. 1, 16 seeds per family from 111 families were individually weighed and sown in autumn. In expt. 2, a second group of 16 seeds were individually weighed and stratified and sown in spring. Four-tree noncontiguous family plots were randomly assigned to two densities in two...

Sicklepod (Senna obtusifolia) seed processing and potential utilization.

PubMed

Harry-O'kuru, Rogers E; Wu, Y Victor; Evangelista, Roque; Vaughn, Steven F; Rayford, Warren; Wilson, Richard F

2005-06-15

Sicklepod (Senna obtusifolia) is a leguminous plant that infests soybean fields in the southeastern United States. Its seeds contain a variety of toxic, highly colored compounds, mainly anthraquinones together with a small amount of fat. These compounds contaminate and lower the quality of soybean oil when inadequately cleaned soybean seed from this area is processed. The sorting of sicklepod seed from a soybean harvest is an additional economic burden on the farmer beyond the cost of proper disposal of the weed seed to avoid worsening field infestation. Fortunately, sicklepod seed also contains substantial amounts of carbohydrates and proteins. These edible components when freed from anthraquinones have a market in pet food as well as potential in human foods because of the high galactomannan ratio of the polysaccharides. Sicklepod seed was dehulled, and the ground endosperm was defatted, followed by sequential solvent extraction of the defatted seed meal to isolate the anthraquinones, carbohydrates, and protein components into their respective classes. Each class of isolate was spectroscopically identified.

Dynamic changes of genome-wide DNA methylation during soybean seed development

USDA-ARS?s Scientific Manuscript database

Seed development is programmed by expression of many genes in plants. Seed maturation is an important developmental process to soybean seed quality and yield. DNA methylation is a major epigenetic modification regulating gene expression. However, little is known about the dynamic nature of DNA me...

Novel Insights into the Influence of Seed Sarcotesta Photosynthesis on Accumulation of Seed Dry Matter and Oil Content in Torreya grandis cv. “Merrillii”

PubMed Central

Hu, Yuanyuan; Zhang, Yongling; Yu, Weiwu; Hänninen, Heikki; Song, Lili; Du, Xuhua; Zhang, Rui; Wu, Jiasheng

2018-01-01

Seed oil content is an important trait of nut seeds, and it is affected by the import of carbon from photosynthetic sources. Although green leaves are the main photosynthetic organs, seed sarcotesta photosynthesis also supplies assimilates to seed development. Understanding the relationship between seed photosynthesis and seed development has theoretical and practical significance in the cultivation of Torreya grandis cv. “Merrillii.” To assess the role of seed sarcotesta photosynthesis on the seed development, anatomical and physiological traits of sarcotesta were measured during two growing seasons in the field. Compared with the attached current-year leaves, the sarcotesta had higher gross photosynthetic rate at the first stage of seed development. At the late second stage of seed development, sarcotesta showed down-regulation of PSII activity, as indicated by significant decrease in the following chlorophyll fluorescence parameters: the maximum PSII efficiency (Fv/Fm), the PSII quantum yield (ΦPSII), and the photosynthetic quenching coefficient (qP). The ribulose 1, 5—bisphosphate carboxylase (Rubisco) activity, the total chlorophyll content (Chl(a+b)) and nitrogen content in the sarcotesta were also significantly decreased during that period. Treatment with DCMU [3-(3,4-dichlorophenyl)-1,1-dimethylurea] preventing seed photosynthesis decreased the seed dry weight and the oil content by 25.4 and 25.5%, respectively. We conclude that seed photosynthesis plays an important role in the dry matter accumulation at the first growth stage. Our results also suggest that down-regulation of seed photosynthesis is a plant response to re-balance the source-sink ratio at the second growth stage. These results suggest that seed photosynthesis is important for biomass accumulation and oil synthesis of the Torreya seeds. The results will facilitate achieving higher yields and oil contents in nut trees by selection for higher seed photosynthesis cultivars. PMID:29375592

Assessing the Potential Oleoresin Yields of Slash Pine Progenies at Juvenile Ages

Treesearch

A.E. Squillace; Charles R. Gansel

1968-01-01

The potential oleoresin yields of slash pine progenies can be assessed at juvenile ages, 7 to 8 years earlier than with previous methods. Seeds are sown in peat pots, outplanted shortly after germination at a spacing of 14 by 3 feet, and given intensive cultural treatment. At 26 years from seed, when the trees average about 9 feet tall, their potential yields are...

Validation of Helicopter Gear Condition Indicators Using Seeded Fault Tests

NASA Technical Reports Server (NTRS)

Dempsey, Paula; Brandon, E. Bruce

2013-01-01

A "seeded fault test" in support of a rotorcraft condition based maintenance program (CBM), is an experiment in which a component is tested with a known fault while health monitoring data is collected. These tests are performed at operating conditions comparable to operating conditions the component would be exposed to while installed on the aircraft. Performance of seeded fault tests is one method used to provide evidence that a Health Usage Monitoring System (HUMS) can replace current maintenance practices required for aircraft airworthiness. Actual in-service experience of the HUMS detecting a component fault is another validation method. This paper will discuss a hybrid validation approach that combines in service-data with seeded fault tests. For this approach, existing in-service HUMS flight data from a naturally occurring component fault will be used to define a component seeded fault test. An example, using spiral bevel gears as the targeted component, will be presented. Since the U.S. Army has begun to develop standards for using seeded fault tests for HUMS validation, the hybrid approach will be mapped to the steps defined within their Aeronautical Design Standard Handbook for CBM. This paper will step through their defined processes, and identify additional steps that may be required when using component test rig fault tests to demonstrate helicopter CI performance. The discussion within this paper will provide the reader with a better appreciation for the challenges faced when defining a seeded fault test for HUMS validation.

Past crops yield dynamics reconstruction from tree-ring chronologies in the forest-steppe zone based on low- and high-frequency components

NASA Astrophysics Data System (ADS)

Babushkina, Elena A.; Belokopytova, Liliana V.; Shah, Santosh K.; Zhirnova, Dina F.

2018-05-01

Interrelations of the yield variability of the main crops (wheat, barley, and oats) with hydrothermal regime and growth of conifer trees ( Pinus sylvestris and Larix sibirica) in forest-steppes were investigated in Khakassia, South Siberia. An attempt has been made to understand the role and mechanisms of climatic impact on plants productivity. It was found that amongst variables describing moisture supply, wetness index had maximum impact. Strength of climatic response and correlations with tree growth are different for rain-fed and irrigated crops yield. Separated high-frequency variability components of yield and tree-ring width have more pronounced relationships between each other and with climatic variables than their chronologies per se. Corresponding low-frequency variability components are strongly correlated with maxima observed after 1- to 5-year time shift of tree-ring width. Results of analysis allowed us to develop original approach of crops yield dynamics reconstruction on the base of high-frequency variability component of the growth of pine and low-frequency one of larch.

Very high CO2 reduces photosynthesis, dark respiration and yield in wheat

NASA Technical Reports Server (NTRS)

Reuveni, J.; Bugbee, B.

1997-01-01

Although terrestrial CO2 concentrations, [CO2] are not expected to reach 1000 micromoles mol-1 for many decades, CO2 levels in closed systems such as growth chambers and glasshouses, can easily exceed this concentration. CO2 levels in life support systems in space can exceed 10000 micromoles mol-1 (1%). Here we studied the effect of six CO2 concentrations, from ambient up to 10000 micromoles mol-1, on seed yield, growth and gas exchange of two wheat cultivars (USU-Apogee and Veery-l0). Elevating [CO2] from 350 to 1000 micromoles mol-1 increased seed yield (by 33%), vegetative biomass (by 25%) and number of heads m-2 (by 34%) of wheat plants. Elevation of [CO2] from 1000 to 10000 micromoles mol-1 decreased seed yield (by 37%), harvest index (by 14%), mass per seed (by 9%) and number of seeds per head (by 29%). This very high [CO2] had a negligible, non-significant effect on vegetative biomass, number of heads m-2 and seed mass per head. A sharp decrease in seed yield, harvest index and seeds per head occurred by elevating [CO2] from 1000 to 2600 micromoles mol-1. Further elevation of [CO2] from 2600 to 10000 micromoles mol-1 caused a further but smaller decrease. The effect of CO2 on both wheat cultivars was similar for all growth parameters. Similarly there were no differences in the response to high [CO2] between wheat grown hydroponically in growth chambers under fluorescent lights and those grown in soilless media in a glasshouse under sunlight and high pressure sodium lamps. There was no correlation between high [CO2] and ethylene production by flag leaves or by wheat heads. Therefore, the reduction in seed set in wheat plants is not mediated by ethylene. The photosynthetic rate of whole wheat plants was 8% lower and dark respiration of the wheat heads 25% lower when exposed to 2600 micromoles mol-1 CO2 compared to ambient [CO2]. It is concluded that the reduction in the seed set can be mainly explained by the reduction in the dark respiration in wheat heads

Predicted global warming scenarios impact on the mother plant to alter seed dormancy and germination behaviour in Arabidopsis.

PubMed

Huang, Z; Footitt, S; Tang, A; Finch-Savage, W E

2018-01-01

Seed characteristics are key components of plant fitness that are influenced by temperature in their maternal environment, and temperature will change with global warming. To study the effect of such temperature changes, Arabidopsis thaliana plants were grown to produce seeds along a uniquely designed polyethylene tunnel having a thermal gradient reflecting local global warming predictions. Plants therefore experienced the same variations in temperature and light conditions but different mean temperatures. A range of seed-related plant fitness estimates were measured. There were dramatic non-linear temperature effects on the germination behaviour in two contrasting ecotypes. Maternal temperatures lower than 15-16 °C resulted in significantly greater primary dormancy. In addition, the impact of nitrate in the growing media on dormancy was shown only by seeds produced below 15-16 °C. However, there were no consistent effects on seed yield, number, or size. Effects on germination behaviour were shown to be a species characteristic responding to temperature and not time of year. Elevating temperature above this critical value during seed development has the potential to dramatically alter the timing of subsequent seed germination and the proportion entering the soil seed bank. This has potential consequences for the whole plant life cycle and species fitness. © 2017 John Wiley & Sons Ltd.

Pepper seed variety identification based on visible/near-infrared spectral technology

NASA Astrophysics Data System (ADS)

Li, Cuiling; Wang, Xiu; Meng, Zhijun; Fan, Pengfei; Cai, Jichen

2016-11-01

Pepper is a kind of important fruit vegetable, with the expansion of pepper hybrid planting area, detection of pepper seed purity is especially important. This research used visible/near infrared (VIS/NIR) spectral technology to detect the variety of single pepper seed, and chose hybrid pepper seeds "Zhuo Jiao NO.3", "Zhuo Jiao NO.4" and "Zhuo Jiao NO.5" as research sample. VIS/NIR spectral data of 80 "Zhuo Jiao NO.3", 80 "Zhuo Jiao NO.4" and 80 "Zhuo Jiao NO.5" pepper seeds were collected, and the original spectral data was pretreated with standard normal variable (SNV) transform, first derivative (FD), and Savitzky-Golay (SG) convolution smoothing methods. Principal component analysis (PCA) method was adopted to reduce the dimension of the spectral data and extract principal components, according to the distribution of the first principal component (PC1) along with the second principal component(PC2) in the twodimensional plane, similarly, the distribution of PC1 coupled with the third principal component(PC3), and the distribution of PC2 combined with PC3, distribution areas of three varieties of pepper seeds were divided in each twodimensional plane, and the discriminant accuracy of PCA was tested through observing the distribution area of samples' principal components in validation set. This study combined PCA and linear discriminant analysis (LDA) to identify single pepper seed varieties, results showed that with the FD preprocessing method, the discriminant accuracy of pepper seed varieties was 98% for validation set, it concludes that using VIS/NIR spectral technology is feasible for identification of single pepper seed varieties.

Strategies for Seed Propagation of Native Forbs

Treesearch

Susan E. Meyer

2006-01-01

Native forbs are an increasingly important component of container production for many public and private nurseries. Propagators are often called upon to grow species with unknown requirements. A systematic approach is required to obtain plants from seeds of these species, beginning with determining what is a propagule and evaluating seed quality. Next, seed dormancy...

Tomato seeds as a novel by-product feed for lactating dairy cows.

PubMed

Cassinerio, C A; Fadel, J G; Asmus, J; Heguy, J M; Taylor, S J; DePeters, E J

2015-07-01

Whole tomato seeds, a novel by-product feedstuff, were fed to lactating Holstein cows to determine the nutritive value of whole tomato seeds by replacing whole cottonseed in the total mixed ration. Four primiparous and 4 multiparous Holstein cows were used in a 4×4 Latin square design and fed 1 of 4 total mixed rations. Whole tomato seeds replaced whole cottonseed on a weight-to-weight basis for lipid. The proportion of whole tomato seeds to whole cottonseed in the diets were 100:0, 50:50, 25:75, and 0:100 on a lipid basis. Thus, tomato seeds were 4.0, 2.4, 1.1, and 0% of the ration dry matter, respectively. Milk yield and the concentrations and yields of protein, lactose, and solids-not-fat did not differ for the effect of diet. However, milk fat concentration decreased and milk fat yield tended to decrease as whole tomato seeds replaced whole cottonseed. Intakes of dry matter, lipid, and crude protein did not differ. Whole-tract apparent digestibility of dry matter and ash-free neutral detergent fiber did not differ, but digestibility of total fatty acids and crude protein decreased with increasing proportion of whole tomato seeds. Urea concentration in milk and plasma both decreased with increasing whole tomato seeds. Fecal concentration of linoleic and α-linolenic acids increased with increasing whole tomato seeds, suggesting that seeds were passing out of the digestive tract undigested. The concentrations of C18:2n-6 and C18:3n-3 in milk fat had small increases, but their yields were not different, suggesting that only a small amount of whole-tomato-seed lipid might have been digested postruminally. Amounts of trans C18:1 fatty acids in milk fat were higher with increasing whole cottonseed, which might suggest a shift in rumen biohydrogenation pathways. At the level of feeding used in the current study, whole tomato seeds replaced whole cottonseed in the diet of lactating dairy cows without a change in production. Copyright © 2015 American Dairy Science

Reintroduction of rare arable plants by seed transfer. What are the optimal sowing rates?

PubMed

Lang, Marion; Prestele, Julia; Fischer, Christina; Kollmann, Johannes; Albrecht, Harald

2016-08-01

During the past decades, agro-biodiversity has markedly declined and some species are close to extinction in large parts of Europe. Reintroduction of rare arable plant species in suitable habitats could counteract this negative trend. The study investigates optimal sowing rates of three endangered species (Legousia speculum-veneris (L.) Chaix, Consolida regalis Gray, and Lithospermum arvense L.), in terms of establishment success, seed production, and crop yield losses.A field experiment with partial additive design was performed in an organically managed winter rye stand with study species added in ten sowing rates of 5-10,000 seeds m(-2). They were sown as a single species or as a three-species mixture (pure vs. mixed sowing) and with vs. without removal of spontaneous weeds. Winter rye was sown at a fixed rate of 350 grains m(-2). Performance of the study species was assessed as plant establishment and seed production. Crop response was determined as grain yield.Plant numbers and seed production were significantly affected by the sowing rate, but not by sowing type (pure vs. mixed sowing of the three study species), and weed removal. All rare arable plant species established and reproduced at sowing rates >25 seeds m(-2), with best performance of L. speculum-veneris. Negative density effects occurred to some extent for plant establishment and more markedly for seed production.The impact of the three study species on crop yield followed sigmoidal functions. Depending on the species, a yield loss of 10% occurred at >100 seeds m(-2). Synthesis and applications: The study shows that reintroduction of rare arable plants by seed transfer is a suitable method to establish them on extensively managed fields, for example, in organic farms with low nutrient level and without mechanical weed control. Sowing rates of 100 seeds m(-2) for C. regalis and L. arvense, and 50 seeds m(-2) for L. speculum-veneris are recommended, to achieve successful establishment

Physical Methods for Seed Invigoration: Advantages and Challenges in Seed Technology

PubMed Central

Araújo, Susana de Sousa; Paparella, Stefania; Dondi, Daniele; Bentivoglio, Antonio; Carbonera, Daniela; Balestrazzi, Alma

2016-01-01

In the context of seed technology, the use of physical methods for increasing plant production offers advantages over conventional treatments based on chemical substances. The effects of physical invigoration treatments in seeds can be now addressed at multiple levels, ranging from morpho-structural aspects to changes in gene expression and protein or metabolite accumulation. Among the physical methods available, “magneto-priming” and irradiation with microwaves (MWs) or ionizing radiations (IRs) are the most promising pre-sowing seed treatments. “Magneto-priming” is based on the application of magnetic fields and described as an eco-friendly, cheap, non-invasive technique with proved beneficial effects on seed germination, vigor and crop yield. IRs, as γ-rays and X-rays, have been widely regarded as a powerful tool in agricultural sciences and food technology. Gamma-rays delivered at low dose have showed to enhance germination percentage and seedling establishment, acting as an actual ‘priming’ treatment. Different biological effects have been observed in seeds subjected to MWs and X-rays but knowledge about their impact as seed invigoration agent or stimulatory effects on germination need to be further extended. Ultraviolet (UV) radiations, namely UV-A and UV-C have shown to stimulate positive impacts on seed health, germination, and seedling vigor. For all mentioned physical treatments, extensive fundamental and applied research is still needed to define the optimal dose, exposition time, genotype- and environment-dependent irradiation conditions. Electron paramagnetic resonance has an enormous potential in seed technology not fully explored to monitor seed invigoration treatments and/or identifying the best suitable irradiation dose or time-point to stop the treatment. The present manuscript describes the use of physical methods for seed invigoration, while providing a critical discussion on the constraints and advantages. The future perspectives

Cytokinin Regulates the Activity of Reproductive Meristems, Flower Organ Size, Ovule Formation, and Thus Seed Yield in Arabidopsis thaliana[C][W][OA

PubMed Central

Bartrina, Isabel; Otto, Elisabeth; Strnad, Miroslav; Werner, Tomáš; Schmülling, Thomas

2011-01-01

The size and activity of the shoot apical meristem is regulated by transcription factors and low molecular mass signals, including the plant hormone cytokinin. The cytokinin status of the meristem depends on different factors, including metabolic degradation of the hormone, which is catalyzed by cytokinin oxidase/dehydrogenase (CKX) enzymes. Here, we show that CKX3 and CKX5 regulate the activity of the reproductive meristems of Arabidopsis thaliana. CKX3 is expressed in the central WUSCHEL (WUS) domain, while CKX5 shows a broader meristematic expression. ckx3 ckx5 double mutants form larger inflorescence and floral meristems. An increased size of the WUS domain and enhanced primordia formation indicate a dual function for cytokinin in defining the stem cell niche and delaying cellular differentiation. Consistent with this, mutation of a negative regulator gene of cytokinin signaling, ARABIDOPSIS HISTIDINE PHOSPHOTRANSFER PROTEIN 6, which is expressed at the meristem flanks, caused a further delay of differentiation. Terminal cellular differentiation was also retarded in ckx3 ckx5 flowers, which formed more cells and became larger, corroborating the role of cytokinin in regulating flower organ size. Furthermore, higher activity of the ckx3 ckx5 placenta tissue established supernumerary ovules leading to an increased seed set per silique. Together, the results underpin the important role of cytokinin in reproductive development. The increased cytokinin content caused an ~55% increase in seed yield, highlighting the relevance of sink strength as a yield factor. PMID:21224426

Generalized provisional seed zones for native plants

Treesearch

Andrew D. Bower; J. Bradley St.Clair; Vicky Erickson

2014-01-01

Deploying well-adapted and ecologically appropriate plant materials is a core component of successful restoration projects. We have developed generalized provisional seed zones that can be applied to any plant species in the United States to help guide seed movement. These seed zones are based on the intersection of high-resolution climatic data for winter minimum...

Laccase-13 Regulates Seed Setting Rate by Affecting Hydrogen Peroxide Dynamics and Mitochondrial Integrity in Rice.

PubMed

Yu, Yang; Li, Quan-Feng; Zhang, Jin-Ping; Zhang, Fan; Zhou, Yan-Fei; Feng, Yan-Zhao; Chen, Yue-Qin; Zhang, Yu-Chan

2017-01-01

Seed setting rate is one of the most important components of rice grain yield. To date, only several genes regulating setting rate have been identified in plant. In this study, we showed that laccase-13 ( OsLAC13 ), a member of laccase family genes which are known for their roles in modulating phenylpropanoid pathway and secondary lignification in cell wall, exerts a regulatory function in rice seed setting rate. OsLAC13 expressed in anthers and promotes hydrogen peroxide production both in vitro and in the filaments and anther connectives. Knock-out of OsLAC13 showed significantly increased seed setting rate, while overexpression of this gene exhibited induced mitochondrial damage and suppressed sugar transportation in anthers, which in turn affected seed setting rate. OsLAC13 also induced H 2 O 2 production and mitochondrial damage in the root tip cells which caused the lethal phenotype. We also showed that high abundant of OsmiR397, the suppressor of OsLAC13 mRNA, increased the seed setting rate of rice plants, and restrains H 2 O 2 accumulation in roots during oxidative stress. Our results suggested a novel regulatory role of OsLAC13 gene in regulating seed setting rate by affecting H 2 O 2 dynamics and mitochondrial integrity in rice.

Effect of enhanced UV-B radiation on pollen quantity, quality, and seed yield in Brassica rapa (Brassicaceae)

DOE Office of Scientific and Technical Information (OSTI.GOV)

Demchik, S.M.; Day, T.A.

Three experiments examined the influence of ultraviolet-B radiation (UV-B; 280-320 nm) exposure on reproduction in Brassica rapa (Brassicacaeae). Plants were grown in a greenhouse under three biologically effective UV-B levels that stimulated either an ambient stratospheric ozone level (control), 16% ({open_quotes}low enhanced{close_quotes}), or 32% ({open_quotes}high enhanced{close_quotes}) ozone depletion levels at Morgantown, WV, USA in mid-March. In the first experiment,pollen production and viability per flower were reduced by {approx}50% under both enhanced UV-B levels relative to ambient controls. While plants under high-enhanced UV-B produced over 40% more flowers than plants under the two lower UV-B treatments, whole-plant production of viable pollenmore » was reduced under low-enhanced UV-B to 34% of ambient controls. In the second experiment, the influence of source-plant UV-B exposure on in vitro pollen from plants was examined and whether source-plant UV-B exposure influenced in vitro pollen germination and viability. Pollen from plants under both enhanced-UV-B was reduced from 65 to 18%. Viability of the pollen from plants grown under both enhanced UV-B treatments was reduced to a much lesser extent: only from {approx}43 to 22%. Thus, ambient source-plant pollen was more sensitive to enhanced UV-B levels to fertilize plants growing under ambient-UV-B levels, and assessed subsequent seed production and germination. Seed abortion rates were higher in plants pollinated with pollen from the enhanced UV-B treatments, than from ambient UV-B. Despite this, seed yield (number and mass) per plant was similar, regardless of the UV-B exposure of their pollen source. Our findings demonstrate that enhanced UV-B levels associated with springtime ozone depletion events have the capacity to substantially reduce viable pollen production, and could ultimately reduce reproductive success of B. rapa. 37 refs., 4 figs., 2 tabs.« less

``From seed-to-seed'' experiment with wheat plants under space-flight conditions

NASA Astrophysics Data System (ADS)

Mashinsky, A.; Ivanova, I.; Derendyaeva, T.; Nechitailo, G.; Salisbury, F.

1994-11-01

An important goal with plant experiments in microgravity is to achieve a complete life cycle, the ``seed-to-seed experiment''. Some Soviet attempts to reach this goal are described, notably an experiment with the tiny mustard, Arabidopsis thaliana, in the Phyton 3 device on Salyut 7. Normal seeds were produced although yields were reduced and development was delayed. Several other experiments have shown abnormalities in plants grown in space. In recent work, plants of wheat (Triticum aestivum) were studied on the ground and then in a preliminary experiment in space. Biometric indices of vegetative space plants were 2 to 2.5 times lower than those of controls, levels of chlorophyll a and b were reduced (no change in the ratio of the two pigments), carotenoids were reduced, there was a serious imbalance in major minerals, and membrane lipids were reduced (no obvious change in lipid patterns). Following the preliminary studies, an attempt was made with the Svetoblock-M growth unit to grow a super-dwarf wheat cultivar through a life cycle. The experiment lasted 167 d on Mir. Growth halted from about day 40 to day 100, when new shoots appeared. Three heads had appeared in the boot (surrounded by leaves) when plants were returned to earth. One head was sterile, but 28 seeds matured on earth, and most of these have since produced normal plants and seeds. In principle, a seed-to-seed experiment with wheat should be successful in microgravity.

[Analytic methods for seed models with genotype x environment interactions].

PubMed

Zhu, J

1996-01-01

Genetic models with genotype effect (G) and genotype x environment interaction effect (GE) are proposed for analyzing generation means of seed quantitative traits in crops. The total genetic effect (G) is partitioned into seed direct genetic effect (G0), cytoplasm genetic of effect (C), and maternal plant genetic effect (Gm). Seed direct genetic effect (G0) can be further partitioned into direct additive (A) and direct dominance (D) genetic components. Maternal genetic effect (Gm) can also be partitioned into maternal additive (Am) and maternal dominance (Dm) genetic components. The total genotype x environment interaction effect (GE) can also be partitioned into direct genetic by environment interaction effect (G0E), cytoplasm genetic by environment interaction effect (CE), and maternal genetic by environment interaction effect (GmE). G0E can be partitioned into direct additive by environment interaction (AE) and direct dominance by environment interaction (DE) genetic components. GmE can also be partitioned into maternal additive by environment interaction (AmE) and maternal dominance by environment interaction (DmE) genetic components. Partitions of genetic components are listed for parent, F1, F2 and backcrosses. A set of parents, their reciprocal F1 and F2 seeds is applicable for efficient analysis of seed quantitative traits. MINQUE(0/1) method can be used for estimating variance and covariance components. Unbiased estimation for covariance components between two traits can also be obtained by the MINQUE(0/1) method. Random genetic effects in seed models are predictable by the Adjusted Unbiased Prediction (AUP) approach with MINQUE(0/1) method. The jackknife procedure is suggested for estimation of sampling variances of estimated variance and covariance components and of predicted genetic effects, which can be further used in a t-test for parameter. Unbiasedness and efficiency for estimating variance components and predicting genetic effects are tested by

[Seed geography: its concept and basic scientific issues].

PubMed

Yu, Shun-Li; Wang, Zong-Shuai; Zeren, Wangmu

2010-01-01

In this paper, a new concept 'seed geography' was provided, and its definition, research contents, and scientific issues were put forward. Seed geography is a newly developed interdisciplinary science from plant geography, seed ecology, and phytosociology, which studies the geographic variation patterns of seed biological traits as well as their relationships with environmental factors from macroscopic to microscopic, and the seed formation, development, and change trends. The main research contents would include geography of seed mass, geography of seed chemical components, geography of seed morphology, geography of seed cell biological characteristics, geography of seed physiological characteristics, geography of seed genetic characteristics, and geography of flower and fruit. To explore the scientific issues in seed geography would help us to better understand the long-term adaptation and evolution of seed characteristics to natural environments.

Seed wasp invasions promoted by unregulated seed trade affect vegetal and animal biodiversity.

PubMed

Auger-Rozenberg, Marie-Anne; Roques, Alain

2012-09-01

Cone and seed insects are considered the most important predators of tree seeds during the pre-dispersal phase of development. Among them, exotic seed chalcids in the genus Megastigmus invaded Europe as a result of the rapidly-increasing and mostly unregulated seed trade for afforestation and ornamental plantations. Unlike their economic impact in seed orchards, until recently, little attention was paid to the ecological impact of these insects. In the present study, selected case studies of alien Megastigmus spp. were considered to assess their specific impact on the potential of natural regeneration of native woody plants and on the native entomofauna competing for seed resource. We re-analyzed data from former studies that did not focus on these ecological interactions and, here, present previously unpublished results. Seeds of Douglas-fir, true cedars, true firs and wild roses were sampled all over Europe, and the relative importance of the native and invasive chalcid species was assessed as well as their specific impact on seed yield. In most cases, the recent arrival of alien chalcids resulted in a significant decrease in the regeneration potential of the host trees. In the absence of competitors, alien chalcids occupied the entire seed niche in Douglas-fir, but their impact tended to decrease after the arrival of invasive seed bugs. In firs, alien chalcids tended to displace the native chalcids, but not in wild roses and cedars, where their damage was increasing. Different biological traits that might explain invasive success of alien chalcids are discussed. However, no general invasive patterns seem to exist. © 2012 Wiley Publishing Asia Pty Ltd, ISZS and IOZ/CAS.

Hydrodistillation time affects dill seed essential oil yield, composition, and bioactivity

USDA-ARS?s Scientific Manuscript database

Dill (Anethum graveolens L.) essential oil is widely used by the food and pharmaceutical industries. We hypothesized that the chemical constituents of dill seed essential oil are eluted at different times during the hydrodistillation process, resulting in oils with different composition and bioactiv...

Mapping quantitative trait loci for yield, yield components and morphological traits in an advanced backcross population between Oryza rufipogon and the Oryza sativa cultivar Jefferson.

PubMed

Thomson, M J; Tai, T H; McClung, A M; Lai, X-H; Hinga, M E; Lobos, K B; Xu, Y; Martinez, C P; McCouch, S R

2003-08-01

An advanced backcross population between an accession of Oryza rufipogon (IRGC 105491) and the U.S. cultivar Jefferson (Oryza sativa ssp. japonica) was developed to identify quantitative trait loci (QTLs) for yield, yield components and morphological traits. The genetic linkage map generated for this population consisted of 153 SSR and RFLP markers with an average interval size of 10.3 cM. Thirteen traits were examined, nine of which were measured in multiple environments. Seventy-six QTLs above an experiment-wise significance threshold of P<0.01 (corresponding to an interval mapping LOD>3.6 or a composite interval mapping LOD>3.9) were identified. For the traits measured in multiple environments, 47% of the QTLs were detected in at least two environments. The O. rufipogon allele was favorable for 53% of the yield and yield component QTLs, including loci for yield, grains per panicle, panicle length, and grain weight. Morphological traits related to the domestication process and/or weedy characteristics, including plant height, shattering, tiller type and awns, were found clustered on chromosomes 1 and 4. Comparisons to previous studies involving wild x cultivated crosses revealed O. rufipogon alleles with stable effects in multiple genetic backgrounds and environments, several of which have not been detected in studies between Oryza sativa cultivars, indicating potentially novel alleles from O. rufipogon. Some O. rufipogon-derived QTLs, however, were in similar regions as previously reported QTLs from Oryza sativa cultivars, providing evidence for conservation of these QTLs across the Oryza genus. In addition, several QTLs for grain weight, plant height, and flowering time were localized to putative homeologous regions in maize where QTLs for these traits have been previously reported, supporting the hypothesis of functional conservation of QTLs across the grasses.

Dual-component video image analysis system (VIASCAN) as a predictor of beef carcass red meat yield percentage and for augmenting application of USDA yield grades.

PubMed

Cannell, R C; Tatum, J D; Belk, K E; Wise, J W; Clayton, R P; Smith, G C

1999-11-01

An improved ability to quantify differences in the fabrication yields of beef carcasses would facilitate the application of value-based marketing. This study was conducted to evaluate the ability of the Dual-Component Australian VIASCAN to 1) predict fabricated beef subprimal yields as a percentage of carcass weight at each of three fat-trim levels and 2) augment USDA yield grading, thereby improving accuracy of grade placement. Steer and heifer carcasses (n = 240) were evaluated using VIASCAN, as well as by USDA expert and online graders, before fabrication of carcasses to each of three fat-trim levels. Expert yield grade (YG), online YG, VIASCAN estimates, and VIASCAN estimated ribeye area used to augment actual and expert grader estimates of the remaining YG factors (adjusted fat thickness, percentage of kidney-pelvic-heart fat, and hot carcass weight), respectively, 1) accounted for 51, 37, 46, and 55% of the variation in fabricated yields of commodity-trimmed subprimals, 2) accounted for 74, 54, 66, and 75% of the variation in fabricated yields of closely trimmed subprimals, and 3) accounted for 74, 54, 71, and 75% of the variation in fabricated yields of very closely trimmed subprimals. The VIASCAN system predicted fabrication yields more accurately than current online yield grading and, when certain VIASCAN-measured traits were combined with some USDA yield grade factors in an augmentation system, the accuracy of cutability prediction was improved, at packing plant line speeds, to a level matching that of expert graders applying grades at a comfortable rate.

Multi-walled carbon nanotubes applied through seed-priming influence early germination, root hair, growth and yield of bread wheat (Triticum aestivum L.).

PubMed

Joshi, Anjali; Kaur, Simranjeet; Dharamvir, Keya; Nayyar, Harsh; Verma, Gaurav

2018-06-01

Reports of multi-walled carbon nanotubes (MWCNTs) incorporated into plants have indicated better yield and productivity, yet the phenomena need in-depth understanding especially when agricultural crops are tested. We primed wheat seeds with MWCNTs to understand the effects on germination, growth, anatomy, physiology and yield. This study, carried out in field conditions, is a step forward over the previous reports. Early germination, excessive root hair, denser stomata and larger root length result in faster growth and higher yield of wheat plants. Denser root hair facilitated the uptake of both water and essential minerals such as phosphorus (P) and potassium (K), which boosted the crop yield by significantly improving grain yield per plant from 1.53 to 2.5 g, a 63% increase. Increase in cell elongation by 80% was recorded, while xylem and phloem sizes dilated to almost 83% and 85% of control, thus enhancing their capacity to conduct water and nutrients. Augmented growth of MWCNT-primed wheat, enhancement in grain number, biomass, stomatal density, xylem-phloem size, epidermal cells, and water uptake is observed while finding no DNA damage. This opens up an entirely new aspect to using cost-effective nanomaterials (the MWCNTs were produced in-house) for enhancing the performance of crop plants. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Seed-specific RNAi in safflower generates a superhigh oleic oil with extended oxidative stability.

PubMed

Wood, Craig C; Okada, Shoko; Taylor, Matthew C; Menon, Amratha; Mathew, Anu; Cullerne, Darren; Stephen, Stuart J; Allen, Robert S; Zhou, Xue-Rong; Liu, Qing; Oakeshott, John G; Singh, Surinder P; Green, Allan G

2018-03-06

Vegetable oils extracted from oilseeds are an important component of foods, but are also used in a range of high value oleochemical applications. Despite being biodegradable, nontoxic and renewable current plant oils suffer from the presence of residual polyunsaturated fatty acids that are prone to free radical formation that limit their oxidative stability, and consequently shelf life and functionality. Many decades of plant breeding have been successful in raising the oleic content to ~90%, but have come at the expense of overall field performance, including poor yields. Here, we engineer superhigh oleic (SHO) safflower producing a seed oil with 93% oleic generated from seed produced in multisite field trials spanning five generations. SHO safflower oil is the result of seed-specific hairpin-based RNA interference of two safflower lipid biosynthetic genes, FAD2.2 and FATB, producing seed oil containing less than 1.5% polyunsaturates and only 4% saturates but with no impact on lipid profiles of leaves and roots. Transgenic SHO events were compared to non-GM safflower in multisite trial plots with a wide range of growing season conditions, which showed no evidence of impact on seed yield. The oxidative stability of the field-grown SHO oil produced from various sites was 50 h at 110°C compared to 13 h for conventional ~80% oleic safflower oils. SHO safflower produces a uniquely stable vegetable oil across different field conditions that can provide the scale of production that is required for meeting the global demands for high stability oils in food and the oleochemical industry. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Quality of Lupinus albus L. (white lupin) seed: extent of genotypic and environmental effects.

PubMed

Annicchiarico, Paolo; Manunza, Patrizia; Arnoldi, Anna; Boschin, Giovanna

2014-07-16

White lupin seed can be used for traditional and functional foods or as animal feed. This study aimed to support lupin breeders and production stakeholders by assessing the extent of genotypic, environmental, and genotype × environment (GE) interaction effects on seed contents of oil, tocopherols (TOC), and quinolizidine alkaloids (QA), grain yield, and seed weight of eight elite genotypes grown in two climatically contrasting Italian locations for two cropping years. On average, plants in the subcontinental climate site exhibited higher grain yield and seed size, about 8% lower oil content, and almost 85% higher QA content than those in the Mediterranean climate site. The range of genotype means was 2.97-5.14 t/ha for yield, 92-110 mg/g for oil, and 0.121-0.133 mg/g for TOC. TOC amount was largely unpredictable and featured large GE interactions that hinder its genetic improvement. Oil and alkaloid contents and seed size are more predictable and offer potential for selection.

Ascribing soil erosion of hillslope components to river sediment yield.

PubMed

Nosrati, Kazem

2017-06-01

In recent decades, soil erosion has increased in catchments of Iran. It is, therefore, necessary to understand soil erosion processes and sources in order to mitigate this problem. Geomorphic landforms play an important role in influencing water erosion. Therefore, ascribing hillslope components soil erosion to river sediment yield could be useful for soil and sediment management in order to decrease the off-site effects related to downstream sedimentation areas. The main objectives of this study were to apply radionuclide tracers and soil organic carbon to determine relative contributions of hillslope component sediment sources in two land use types (forest and crop field) by using a Bayesian-mixing model, as well as to estimate the uncertainty in sediment fingerprinting in a mountainous catchment of western Iran. In this analysis, 137 Cs, 40 K, 238 U, 226 Ra, 232 Th and soil organic carbon tracers were measured in 32 different sampling sites from four hillslope component sediment sources (summit, shoulder, backslope, and toeslope) in forested and crop fields along with six bed sediment samples at the downstream reach of the catchment. To quantify the sediment source proportions, the Bayesian mixing model was based on (1) primary sediment sources and (2) combined primary and secondary sediment sources. The results of both approaches indicated that erosion from crop field shoulder dominated the sources of river sediments. The estimated contribution of crop field shoulder for all river samples was 63.7% (32.4-79.8%) for primary sediment sources approach, and 67% (15.3%-81.7%) for the combined primary and secondary sources approach. The Bayesian mixing model, based on an optimum set of tracers, estimated that the highest contribution of soil erosion in crop field land use and shoulder-component landforms constituted the most important land-use factor. This technique could, therefore, be a useful tool for soil and sediment control management strategies. Copyright �

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2014 CFR

2014-04-01

... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing, manufacturing, packing, processing, preparing, treating...

Seed deposition patterns and the survival of seeds and seedlings of the palm Euterpe edulis

NASA Astrophysics Data System (ADS)

Pizo, Marco A.; Simão, Isaac

2001-08-01

The seed deposition pattern created by a seed disperser is one of the components of the efficiency of a species as seed disperser, and ultimately may influence the recruitment of a plant species. In this study, we used the seeds of a bird-dispersed forest palm, Euterpe edulis, to investigate the effects of two distinct seed deposition patterns created by birds that defecate (clumped pattern) and regurgitate seeds (loose-clumped pattern) on the survival of seeds experimentally set in an E. edulis-rich site, and of seedlings grown under shade-house conditions. The study was conducted in the lowland forest of Parque Estadual Intervales, SE Brazil. Clumped and loose-clumped seeds were equally preyed upon by rodents and insects. Although clumped and isolated seedlings had the same root weight after 1 year, the isolated seedlings survived better and presented more developed shoots, suggesting intraspecific competition among clumped seedlings. Our results indicate that animals that deposit E. edulis seeds in faecal clumps (e.g. cracids, tapirs) are less efficient seed dispersers than those that regurgitate seeds individually (e.g. trogons, toucans). Intraspecific competition among seedlings growing from faecal clumps is a likely process preventing the occurrence of clumps of adult palms.

Phenotypic and Transcriptional Analysis of Divergently Selected Maize Populations Reveals the Role of Developmental Timing in Seed Size Determination1[W][OPEN

PubMed Central

Sekhon, Rajandeep S.; Hirsch, Candice N.; Childs, Kevin L.; Breitzman, Matthew W.; Kell, Paul; Duvick, Susan; Spalding, Edgar P.; Buell, C. Robin; de Leon, Natalia; Kaeppler, Shawn M.

2014-01-01

Seed size is a component of grain yield and an important trait in crop domestication. To understand the mechanisms governing seed size in maize (Zea mays), we examined transcriptional and developmental changes during seed development in populations divergently selected for large and small seed size from Krug, a yellow dent maize cultivar. After 30 cycles of selection, seeds of the large seed population (KLS30) have a 4.7-fold greater weight and a 2.6-fold larger size compared with the small seed population (KSS30). Patterns of seed weight accumulation from the time of pollination through 30 d of grain filling showed an earlier onset, slower rate, and earlier termination of grain filling in KSS30 relative to KLS30. This was further supported by transcriptome patterns in seeds from the populations and derived inbreds. Although the onset of key genes was earlier in small seeds, similar maximum transcription levels were observed in large seeds at later stages, suggesting that functionally weaker alleles, rather than transcript abundance, may be the basis of the slow rate of seed filling in KSS30. Gene coexpression networks identified several known genes controlling cellularization and proliferation as well as novel genes that will be useful candidates for biotechnological approaches aimed at altering seed size in maize and other cereals. PMID:24710068

Seed source, seed traits, and frugivore habits: Implications for dispersal quality of two sympatric primates.

PubMed

Benítez-Malvido, Julieta; González-Di Pierro, Ana Ma; Lombera, Rafael; Guillén, Susana; Estrada, Alejandro

2014-06-01

• Premise of the study: Frugivore selection of fruits and treatment of seeds together with seed deposition site are crucial for the population dynamics of vertebrate-dispersed plants. However, frugivore species may influence dispersal quality differently even when feeding on the same fruit species and, while animals disperse some seeds, others simply fall beneath the parent plant.• Methods: In southern Mexico, we investigated to see if within-species seed traits (i.e., length, width, weight, and volume) and germination success differed according to seed source. For five tropical tree species we obtained ingested seeds from two sources, howler monkey (Alouatta pigra) and spider monkey (Ateles geoffroyi) feces; and noningested seeds from two sources, the ground and tree crowns (with predispersed seeds used as control).• Key results: A principal components' analysis showed that traits of seeds ingested by howler monkeys differed from other sources while seeds ingested by spider monkeys were similar to noningested seeds. Howlers consumed on average the larger seeds in Ampelocera hottlei, Brosimum lactescens, and Dialium guianense. Both primate species consumed the smaller seeds in Spondias mombin, while no seed trait differences among seed sources were found in Spondias radlkoferi. For all five tree species, germination rate was greatest for seeds ingested by howler monkeys.• Conclusions: For the studied plant species, seed ingestion by howler monkeys confers higher dispersal quality than ingestion by spider monkeys or nondispersal. Dispersal services of both primate species, however, are not redundant and may contribute to germination heterogeneity within plant populations in tropical forests. © 2014 Botanical Society of America, Inc.

Bio-ecological consequences of crop seeds treatment with metal nano-powders

NASA Astrophysics Data System (ADS)

Churilov, G.

2015-11-01

As a result of our investigations we have determined the optimal concentrations of ferrum, cobalt and cuprum nano-powders recommended to be used as micro-fertilizers increasing the yield and feed value of crops at the expense of accumulating biologically active combinations by 25-35%. In unfavorable climate conditions, for example in a case of excess moisture or heat and drought, the plants development and ripening suffer. Our investigations have shown that the stimulating effect of nano-powders has lowered the effect of stress situations on plants development and simultaneously increased the rape seeds yield and quality. Treating the seeds with the drugs being studied has provided the high crop protection. If consider that the maximum efficiency of protectants Chinuk, SK (20 kg/t of seeds) and Cruiser, KS (10 kg/t of seeds) then for the same effect one needs nano-powders 0.1 g per hectare norm of seeds planting.

Comparison of secondary organic aerosol formed with an aerosol flow reactor and environmental reaction chambers: effect of oxidant concentration, exposure time and seed particles on chemical composition and yield

NASA Astrophysics Data System (ADS)

Lambe, A. T.; Chhabra, P. S.; Onasch, T. B.; Brune, W. H.; Hunter, J. F.; Kroll, J. H.; Cummings, M. J.; Brogan, J. F.; Parmar, Y.; Worsnop, D. R.; Kolb, C. E.; Davidovits, P.

2014-12-01

We performed a systematic intercomparison study of the chemistry and yields of SOA generated from OH oxidation of a common set of gas-phase precursors in a Potential Aerosol Mass (PAM) continuous flow reactor and several environmental chambers. In the flow reactor, SOA precursors were oxidized using OH concentrations ranging from 2.0×108 to 2.2×1010 molec cm-3 over exposure times of 100 s. In the environmental chambers, precursors were oxidized using OH concentrations ranging from 2×106 to 2×107 molec cm-3 over exposure times of several hours. The OH concentration in the chamber experiments is close to that found in the atmosphere, but the integrated OH exposure in the flow reactor can simulate atmospheric exposure times of multiple days compared to chamber exposure times of only a day or so. A linear correlation analysis of the mass spectra (m=0.91-0.92, r2=0.93-0.94) and carbon oxidation state (m=1.1, r2=0.58) of SOA produced in the flow reactor and environmental chambers for OH exposures of approximately 1011 molec cm-3 s suggests that the composition of SOA produced in the flow reactor and chambers is the same within experimental accuracy as measured with an aerosol mass spectrometer. This similarity in turn suggests that both in the flow reactor and in chambers, SOA chemical composition at low OH exposure is governed primarily by gas-phase OH oxidation of the precursors, rather than heterogeneous oxidation of the condensed particles. In general, SOA yields measured in the flow reactor are lower than measured in chambers for the range of equivalent OH exposures that can be measured in both the flow reactor and chambers. The influence of sulfate seed particles on isoprene SOA yield measurements was examined in the flow reactor. The studies show that seed particles increase the yield of SOA produced in flow reactors by a factor of 3 to 5 and may also account in part for higher SOA yields obtained in the chambers, where seed particles are routinely used.

Efficacy of Rice Insecticide Seed Treatments at Selected Nitrogen Rates for Control of the Rice Water Weevil (Coleoptera: Curculionidae).

PubMed

Everett, Mallory; Lorenz, Gus; Slaton, Nathan; Hardke, Jarrod

2015-08-01

Seed-applied insecticides are the standard control method used in the United States to minimize rice water weevil (Lissorhoptrus oryzophilus Kuschel) injury to rice (Oryza sativa L.) roots, and often results in greater yields than rice that receives no seed-applied insecticide. Yield increases from seed-applied insecticides often occur even when insect pressure is low and should not cause yield loss. The research objective was to evaluate the effect of urea-nitrogen rate and seed-applied insecticide on number of rice water weevil larvae, nitrogen uptake, and rice grain yield. Six trials were conducted at the Pine Tree Research Station (PTRS) and the Rice Research Extension Center (RREC) to examine the response of rice plants receiving different insecticide-seed treatments and urea-nitrogen rate combinations. Insecticide-seed treatments included label rates of clothianidin, thiamethoxam, and a no-insecticide (fungicide only) control, in combination with season-total nitrogen rates of 0, 50, 100, 150, and 200 kg urea-nitrogen/ha. Rice seed that was treated with clothianidin or thiamethoxam generally had equal numbers of rice water weevil larvae, which were significantly fewer compared with rice that received no insecticide with an equivalent urea-nitrogen rate. Nitrogen uptake at panicle differentiation was not affected by insecticide-seed treatments at four of six sites and usually increased positively and linearly as urea-nitrogen rate increased. As urea-nitrogen rate increased, grain yield increased either linearly or nonlinearly. Averaged across urea-nitrogen rates, both insecticide seed treatments had similar yields that were 4 to 7% greater than the grain yields of rice that received no insecticide at four of the five harvested sites. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Isolation of Salmonella from alfalfa seed and demonstration of impaired growth of heat-injured cells in seed homogenates.

PubMed

Liao, Ching-Hsing; Fett, William F

2003-05-15

Three major foodborne outbreaks of salmonellosis in 1998 and 1999 were linked to the consumption of raw alfalfa sprouts. In this report, an improved method is described for isolation of Salmonella from alfalfa seed lots, which had been implicated in these outbreaks. From each seed lot, eight samples each containing 25 g of seed were tested for the presence of Salmonella by the US FDA Bacteriological Analytical Manual (BAM) procedure and by a modified method applying two successive pre-enrichment steps. Depending on the seed lot, one to four out of eight samples tested positive for Salmonella by the standard procedure and two to seven out of eight samples tested positive by the modified method. Thus, the use of two consecutive pre-enrichment steps led to a higher detection rate than a single pre-enrichment step. This result indirectly suggested that Salmonella cells on contaminated seeds might be injured and failed to fully resuscitate in pre-enrichment broth containing seed components during the first 24 h of incubation. Responses of heat-injured Salmonella cells grown in buffered peptone water (BPW) and in three alfalfa seed homogenates were investigated. For preparation of seed homogenates, 25 g of seeds were homogenized in 200 ml of BPW using a laboratory Stomacher and subsequently held at 37 degrees C for 24 h prior to centrifugation and filtration. While untreated cells grew at about the same rate in BPW and in seed homogenates, heat-injured cells (52 degrees C, 10 min) required approximately 0.5 to 4.0 h longer to resuscitate in seed homogenates than in BPW. This result suggests that the alfalfa seed components or fermented metabolites from native bacteria hinder the repair and growth of heat-injured cells. This study also shows that an additional pre-enrichment step increases the frequency of isolation of Salmonella from naturally contaminated seeds, possibly by alleviating the toxic effect of seed homogenates on repair or growth of injured cells.

Seed-Specific Overexpression of the Pyruvate Transporter BASS2 Increases Oil Content in Arabidopsis Seeds

PubMed Central

Lee, Eun-Jung; Oh, Minwoo; Hwang, Jae-Ung; Li-Beisson, Yonghua; Nishida, Ikuo; Lee, Youngsook

2017-01-01

Seed oil is important not only for human and animal nutrition, but also for various industrial applications. Numerous genetic engineering strategies have been attempted to increase the oil content per seed, but few of these strategies have involved manipulating the transporters. Pyruvate is a major source of carbon for de novo fatty acid biosynthesis in plastids, and the embryo's demand for pyruvate is reported to increase during active oil accumulation. In this study, we tested our hypothesis that oil biosynthesis could be boosted by increasing pyruvate flux into plastids. We expressed the known plastid-localized pyruvate transporter BILE ACID:SODIUM SYMPORTER FAMILY PROTEIN 2 (BASS2) under the control of a seed-specific soybean (Glycine max) glycinin-1 promoter in Arabidopsis thaliana. The resultant transgenic Arabidopsis plants (OEs), which expressed high levels of BASS2, produced seeds that were larger and heavier and contained 10–37% more oil than those of the wild type (WT), but were comparable to the WT seeds in terms of protein and carbohydrate contents. The total seed number did not differ significantly between the WT and OEs. Therefore, oil yield per plant was increased by 24–43% in the OE lines compared to WT. Taken together, our results demonstrate that seed-specific overexpression of the pyruvate transporter BASS2 promotes oil production in Arabidopsis seeds. Thus, manipulating the level of specific transporters is a feasible approach for increasing the seed oil content. PMID:28265278

Deficit irrigation effects on yield and yield components of grain sorghum

USDA-ARS?s Scientific Manuscript database

Development of sustainable and efficient irrigation strategies is a priority for producers faced with water shortages. A promising management strategy for improving water use efficiency (WUE) is managed deficit irrigation (MDI), which attempts to optimize yield and WUE by synchronizing crop water u...

Effects of pH on protein components of extracted oil bodies from diverse plant seeds and endogenous protease-induced oleosin hydrolysis.

PubMed

Zhao, Luping; Chen, Yeming; Chen, Yajing; Kong, Xiangzhen; Hua, Yufei

2016-06-01

Plant seeds are used to extract oil bodies for diverse applications, but oil bodies extracted at different pH values exhibit different properties. Jicama, sunflower, peanut, castor bean, rapeseed, and sesame were selected to examine the effects of pH (6.5-11.0) on the protein components of oil bodies and the oleosin hydrolysis in pH 6.5-extracted oil bodies. In addition to oleosins, many extrinsic proteins (globulins, 2S albumin, and enzymes) were present in pH 6.5-extracted oil bodies. Globulins were mostly removed at pH 8.0, whereas 2S albumins were removed at pH 11.0. At pH 11.0, highly purified oil bodies were obtained from jicama, sunflower, peanut, and sesame, whereas lipase remained in the castor bean oil bodies and many enzymes in the rapeseed oil bodies. Endogenous protease-induced hydrolysis of oleosins occurred in all selected plant seeds. Oleosins with larger sizes were hydrolysed more quickly than oleosins with smaller sizes in each plant seed. Copyright © 2016 Elsevier Ltd. All rights reserved.

[Effects of flower bud removal and artificial pollination on growth and yield of Tulipa edulis].

PubMed

Miao, Yuan-Yuan; Zhu, Zai-Biao; Guo, Qiao-Sheng; Ma, Hong-Liang; Yang, Ying; Zhu, Li-Fang

2014-06-01

The study was conducted to explore the response of growth and yield of Tulipa edulis to flower bud removal and artificial pollination. And flower bud removal and artificial pollination were carried out in the squaring period and bloom stage respectively. The morphological index and biomass indicators were determined and the yield was counted in harvest time. Result showed that flower bud removal was beneficial to the growth of T. edulis, resulting in increasing growth index, biomass as well as the yield of bulb. The diameter and dry weight of T. edulis fruit by artificial pollination were increased significantly compared with the control. Seed setting percentage increased to 100%, and the number of seed as well as the single grain weight increased by 69.03% and 16.48%, respectively, which did not significantly affect the bulb production. In conclusion, Flower bud removal treatment accelerates bulb biomass increase, so as to improve its yield. Artificial pollination raised significantly seed setting percentage, seed number as well as the single grain weight.

Interrelationship and path coefficient analysis of yield components in F4 progenies of tef (Eragrostis tef).

PubMed

Debebe, Abel; Singh, Harijat; Tefera, Hailu

2014-01-01

This experiment was conducted at Debre Zeit and Akaki during 2004-2005 cropping season on F2-derived F4 bulk families of three crosses, viz, DZ-01-974 x DZ-01-2786, DZ-01-974 x DZ-Cr-37 and Alba x Kaye Murri. To estimate the correlations and path coefficients between yield and yield components, 63 F4 families were taken randomly from each of the three crosses. The 189 F4 families, five parents and two checks were space planted following in 14 x 14 simple lattice design. Study of associations among traits indicated that yield was positively associated with shoot biomass, harvest index, lodging index and panicle kernel weight at phenotypic level at Debre Zeit. At Akaki, yield had significant positive correlation with shoot biomass, harvest index, plant height, panicle length and panicle weight. At genotypic level, grain yield per plot exhibited positive association with harvest index, shoot biomass, lodging index and panicle kernel weight at Debre Zeit. By contrast, days to heading, days to maturity, plant height and panicle length showed negative association with yield. At Akaki, kernel yield per plot was positively correlated at genotypic level with all the traits considered where lodging index had the highest correlation followed by shoot biomass, panicle kernel weight and harvest index. Path coefficient analysis at both phenotypic and genotypic levels for both the locations suggested those shoot biomass and harvest indexes are the two important yield determining traits. These two traits might be useful in indirect selection for yield improvement in the material generated from the three crosses under consideration.

Ultrahigh-yield growth of GaN via halogen-free vapor-phase epitaxy

NASA Astrophysics Data System (ADS)

Nakamura, Daisuke; Kimura, Taishi

2018-06-01

The material yield of Ga during GaN growth via halogen-free vapor-phase epitaxy (HF-VPE) was systematically investigated and found to be much higher than that obtained using conventional hydride VPE. This is attributed to the much lower process pressure and shorter seed-to-source distance, owing to the inherent chemical reactions and corresponding reactor design used for HF-VPE growth. Ultrahigh-yield GaN growth was demonstrated on a 4-in.-diameter sapphire seed substrate.

Increased Activity of the Vacuolar Monosaccharide Transporter TMT1 Alters Cellular Sugar Partitioning, Sugar Signaling, and Seed Yield in Arabidopsis1[OA

PubMed Central

Wingenter, Karina; Schulz, Alexander; Wormit, Alexandra; Wic, Stefan; Trentmann, Oliver; Hoermiller, Imke I.; Heyer, Arnd G.; Marten, Irene; Hedrich, Rainer; Neuhaus, H. Ekkehard

2010-01-01

The extent to which vacuolar sugar transport activity affects molecular, cellular, and developmental processes in Arabidopsis (Arabidopsis thaliana) is unknown. Electrophysiological analysis revealed that overexpression of the tonoplast monosaccharide transporter TMT1 in a tmt1-2::tDNA mutant led to increased proton-coupled monosaccharide import into isolated mesophyll vacuoles in comparison with wild-type vacuoles. TMT1 overexpressor mutants grew faster than wild-type plants on soil and in high-glucose (Glc)-containing liquid medium. These effects were correlated with increased vacuolar monosaccharide compartmentation, as revealed by nonaqueous fractionation and by chlorophyllab-binding protein1 and nitrate reductase1 gene expression studies. Soil-grown TMT1 overexpressor plants respired less Glc than wild-type plants and only about half the amount of Glc respired by tmt1-2::tDNA mutants. In sum, these data show that TMT activity in wild-type plants limits vacuolar monosaccharide loading. Remarkably, TMT1 overexpressor mutants produced larger seeds and greater total seed yield, which was associated with increased lipid and protein content. These changes in seed properties were correlated with slightly decreased nocturnal CO2 release and increased sugar export rates from detached source leaves. The SUC2 gene, which codes for a sucrose transporter that may be critical for phloem loading in leaves, has been identified as Glc repressed. Thus, the observation that SUC2 mRNA increased slightly in TMT1 overexpressor leaves, characterized by lowered cytosolic Glc levels than wild-type leaves, provided further evidence of a stimulated source capacity. In summary, increased TMT activity in Arabidopsis induced modified subcellular sugar compartmentation, altered cellular sugar sensing, affected assimilate allocation, increased the biomass of Arabidopsis seeds, and accelerated early plant development. PMID:20709831

Growth and Yield Responses of Cowpea to Inoculation and Phosphorus Fertilization in Different Environments

PubMed Central

Kyei-Boahen, Stephen; Savala, Canon E. N.; Chikoye, David; Abaidoo, Robert

2017-01-01

Cowpea (Vigna unguiculata) is a major source of dietary protein and essential component of the cropping systems in semi-arid regions of Sub-Saharan Africa. However, yields are very low due to lack of improved cultivars, poor management practices, and limited inputs use. The objectives of this study were to assess the effects of rhizobia inoculant and P on nodulation, N accumulation and yield of two cowpea cultivars in Mozambique. Field study was conducted in three contrasting environments during the 2013/2014 and 2014/2015 seasons using randomized complete block design with four replications and four treatments. Treatments consisted of seed inoculation, application of 40 kg P2O5 ha-1, inoculation + P, and a non-inoculated control. The most probable number (MPN) technique was used to estimate the indigenous bradyrhizobia populations at the experimental sites. The rhizobia numbers at the sites varied from 5.27 × 102 to 1.07 × 103 cells g-1 soil. Inoculation increased nodule number by 34–76% and doubled nodule dry weight (78 to 160 mg plant-1). P application improved nodulation and interacted positively with the inoculant. Inoculation, P, and inoculant + P increased shoot dry weight, and shoot and grain N content across locations but increases in number of pods plant-1, seeds pod-1, and 100-seed weight were not consistent among treatments across locations. Shoot N content was consistently high for the inoculated plants and also for the inoculated + P fertilized plants, whereas the non-inoculated control plants had the lowest tissue N content. P uptake in shoot ranged from 1.72 to 3.77 g kg-1 and was higher for plants that received P fertilizer alone. Inoculation and P either alone or in combination consistently increased cowpea grain yield across locations with yields ranging from 1097 kg ha-1 for the non-inoculated control to 1674 kg ha-1 for the inoculant + P treatment. Grain protein concentration followed a similar trend as grain yield and ranged from 223 to

Effect of seed age on gold nanorod formation. A microfluidic, real-time investigation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Watt, John; Hance, Bradley G.; Anderson, Rachel S.

We report a real time investigation into the effect of seed age on the growth of gold nanorods using a microfluidic reaction apparatus. Through small-angle X-ray scattering (SAXS) and ultraviolet–visible spectroscopy (UV–vis) analysis, we observe the seeds aging in accordance with Ostwald ripening. A seed solution is then aged in situ and continuously injected into a microfluidic chip to initiate rod growth. We track nanorod formation in real time using in-line ultraviolet–visible and near-infrared (UV–vis–NIR) monitoring and observe a dramatic decrease in yield with increasing seed age. We then demonstrate that, by diluting the gold seed solution immediately following synthesis,more » the rate of aging can be reduced and nanorods synthesized continuously, in good yield. As a result, these findings suggest ultrasmall, catalytically active seeds, which are rapidly lost due to ripening and are critical for the formation of gold nanorods.« less

Effect of seed age on gold nanorod formation. A microfluidic, real-time investigation

DOE PAGES

Watt, John; Hance, Bradley G.; Anderson, Rachel S.; ...

2015-09-02

We report a real time investigation into the effect of seed age on the growth of gold nanorods using a microfluidic reaction apparatus. Through small-angle X-ray scattering (SAXS) and ultraviolet–visible spectroscopy (UV–vis) analysis, we observe the seeds aging in accordance with Ostwald ripening. A seed solution is then aged in situ and continuously injected into a microfluidic chip to initiate rod growth. We track nanorod formation in real time using in-line ultraviolet–visible and near-infrared (UV–vis–NIR) monitoring and observe a dramatic decrease in yield with increasing seed age. We then demonstrate that, by diluting the gold seed solution immediately following synthesis,more » the rate of aging can be reduced and nanorods synthesized continuously, in good yield. As a result, these findings suggest ultrasmall, catalytically active seeds, which are rapidly lost due to ripening and are critical for the formation of gold nanorods.« less

Analysis of Peanut Seed Oil by NIR

USDA-ARS?s Scientific Manuscript database

Near infrared reflectance spectra (NIRS) were collected from Arachis hypogaea seed samples and used in predictive models to rapidly identify varieties with high oleic acid. The method was developed for shelled peanut seeds with intact testa. Spectra were evaluated initially by principal component an...

Contribution of insect pollinators to crop yield and quality varies with agricultural intensification

PubMed Central

Potts, Simon G.; Steffan-Dewenter, Ingolf; Vaissière, Bernard E.; Woyciechowski, Michal; Krewenka, Kristin M.; Tscheulin, Thomas; Roberts, Stuart P.M.; Szentgyörgyi, Hajnalka; Westphal, Catrin; Bommarco, Riccardo

2014-01-01

Background. Up to 75% of crop species benefit at least to some degree from animal pollination for fruit or seed set and yield. However, basic information on the level of pollinator dependence and pollinator contribution to yield is lacking for many crops. Even less is known about how insect pollination affects crop quality. Given that habitat loss and agricultural intensification are known to decrease pollinator richness and abundance, there is a need to assess the consequences for different components of crop production. Methods. We used pollination exclusion on flowers or inflorescences on a whole plant basis to assess the contribution of insect pollination to crop yield and quality in four flowering crops (spring oilseed rape, field bean, strawberry, and buckwheat) located in four regions of Europe. For each crop, we recorded abundance and species richness of flower visiting insects in ten fields located along a gradient from simple to heterogeneous landscapes. Results. Insect pollination enhanced average crop yield between 18 and 71% depending on the crop. Yield quality was also enhanced in most crops. For instance, oilseed rape had higher oil and lower chlorophyll contents when adequately pollinated, the proportion of empty seeds decreased in buckwheat, and strawberries’ commercial grade improved; however, we did not find higher nitrogen content in open pollinated field beans. Complex landscapes had a higher overall species richness of wild pollinators across crops, but visitation rates were only higher in complex landscapes for some crops. On the contrary, the overall yield was consistently enhanced by higher visitation rates, but not by higher pollinator richness. Discussion. For the four crops in this study, there is clear benefit delivered by pollinators on yield quantity and/or quality, but it is not maximized under current agricultural intensification. Honeybees, the most abundant pollinator, might partially compensate the loss of wild pollinators in

Contribution of insect pollinators to crop yield and quality varies with agricultural intensification.

PubMed

Bartomeus, Ignasi; Potts, Simon G; Steffan-Dewenter, Ingolf; Vaissière, Bernard E; Woyciechowski, Michal; Krewenka, Kristin M; Tscheulin, Thomas; Roberts, Stuart P M; Szentgyörgyi, Hajnalka; Westphal, Catrin; Bommarco, Riccardo

2014-01-01

Background. Up to 75% of crop species benefit at least to some degree from animal pollination for fruit or seed set and yield. However, basic information on the level of pollinator dependence and pollinator contribution to yield is lacking for many crops. Even less is known about how insect pollination affects crop quality. Given that habitat loss and agricultural intensification are known to decrease pollinator richness and abundance, there is a need to assess the consequences for different components of crop production. Methods. We used pollination exclusion on flowers or inflorescences on a whole plant basis to assess the contribution of insect pollination to crop yield and quality in four flowering crops (spring oilseed rape, field bean, strawberry, and buckwheat) located in four regions of Europe. For each crop, we recorded abundance and species richness of flower visiting insects in ten fields located along a gradient from simple to heterogeneous landscapes. Results. Insect pollination enhanced average crop yield between 18 and 71% depending on the crop. Yield quality was also enhanced in most crops. For instance, oilseed rape had higher oil and lower chlorophyll contents when adequately pollinated, the proportion of empty seeds decreased in buckwheat, and strawberries' commercial grade improved; however, we did not find higher nitrogen content in open pollinated field beans. Complex landscapes had a higher overall species richness of wild pollinators across crops, but visitation rates were only higher in complex landscapes for some crops. On the contrary, the overall yield was consistently enhanced by higher visitation rates, but not by higher pollinator richness. Discussion. For the four crops in this study, there is clear benefit delivered by pollinators on yield quantity and/or quality, but it is not maximized under current agricultural intensification. Honeybees, the most abundant pollinator, might partially compensate the loss of wild pollinators in

Soybean grown under elevated CO2 benefits more under low temperature than high temperature stress: Varying response of photosynthetic limitations, leaf metabolites, growth, and seed yield.

PubMed

Xu, Guangli; Singh, Shardendu K; Reddy, Vangimalla R; Barnaby, Jinyoung Y; Sicher, Richard C; Li, Tian

2016-10-20

To evaluate the combined effect of temperature and CO 2 on photosynthetic processes, leaf metabolites and growth, soybean was grown under a controlled environment at low (22/18°C, LT), optimum (28/24°C, OT) and high (36/32°C HT) temperatures under ambient (400μmolmol -1 ; aCO 2 ) or elevated (800μmolmol -1 ; eCO 2 ) CO 2 concentrations during the reproductive stage. In general, the rate of photosynthesis (A), stomatal (g s ) and mesophyll (g m ) conductance, quantum yield of photosystem II, rates of maximum carboxylation (V Cmax ), and electron transport (J) increased with temperature across CO 2 levels. However, compared with OT, the percentage increases in these parameters at HT were lower than the observed decline at LT. The photosynthetic limitation at LT and OT was primarily caused by photo-biochemical processes (49-58%, L b ) followed by stomatal (27-32%, L s ) and mesophyll (15-19%, L m ) limitations. However, at HT, it was primarily caused by L s (41%) followed by L b (33%) and L m (26%). The dominance of L b at LT and OT was associated with the accumulation of non-structural carbohydrates (e.g., starch) and several organic acids, whereas this accumulation did not occur at HT, indicating increased metabolic activities. Compared with OT, biomass and seed yield declined more at HT than at LT. The eCO 2 treatment compensated for the temperature-stress effects on biomass but only partially compensated for the effects on seed yield, especially at HT. Photosynthetic downregulation at eCO 2 was possibly due to the accumulation of non-structural carbohydrates and the decrease in g s and A std (standard A measured at 400μmolmol -1 sub-stomatal CO 2 concentration), as well as the lack of CO 2 effect on g m , V Cmax , and J, and photosynthetic limitation. Thus, the photosynthetic limitation was temperature-dependent and was primarily influenced by the alteration in photo-biochemical processes and metabolic activities. Despite the inconsistent response of

Bioinoculants: A sustainable approach to maximize the yield of Ethiopian mustard (Brassica carinata L.) under low input of chemical fertilizers.

PubMed

Nosheen, Asia; Bano, Asghari; Ullah, Faizan

2016-02-01

This study aimed to find out the effect of plant growth-promoting rhizobacteria (PGPR; Azospirillum brasilense and Azotobacter vinelandii) either alone or in combination with different doses of nitrogen and phosphate fertilizers on growth, seed yield, and oil quality of Brassica carinata (L.) cv. Peela Raya. PGPR were applied as seed inoculation at 10(6) cells/mL(-1) so that the number of bacterial cells per seed was 2.6 × 10(5) cells/seed. The chemical fertilizers, namely, urea and diammonium phosphate (DAP) were applied in different doses (full dose (urea 160 kg ha(-1) + DAP 180 kg ha(-1)), half dose (urea 80 kg ha(-1) + DAP 90 kg ha(-1)), and quarter dose (urea 40 kg ha(-1) + DAP 45 kg ha(-1)). The chemical fertilizers at full and half dose significantly increased the chlorophyll, carotenoids, and protein content of leaves and the seed yield (in kilogram per hectare) but had no effect on the oil content of seed. The erucic acid (C22:1) content present in the seed was increased. Azospirillum performed better than Azotobacter and its effect was at par with full dose of chemical fertilizers (CFF) for pigments and protein content of leaves when inoculated in the presence of half dose of chemical fertilizers (SPH). The seed yield and seed size were greater. Supplementing Azospirillum with SPH assisted Azospirillum to augment the growth and yield, reduced the erucic acid (C22:1) and glucosinolates contents, and increased the unsaturation in seed oil. It is inferred that A. brasilense could be applied as an efficient bioinoculant for enhancing the growth, seed yield, and oil quality of Ethiopian mustard at low fertilizer costs and sustainable ways. © The Author(s) 2013.

Genome-Wide Analysis of the Complex Transcriptional Networks of Rice Developing Seeds

PubMed Central

Xue, Liang-Jiao; Zhang, Jing-Jing; Xue, Hong-Wei

2012-01-01

Background The development of rice (Oryza sativa) seed is closely associated with assimilates storage and plant yield, and is fine controlled by complex regulatory networks. Exhaustive transcriptome analysis of developing rice embryo and endosperm will help to characterize the genes possibly involved in the regulation of seed development and provide clues of yield and quality improvement. Principal Findings Our analysis showed that genes involved in metabolism regulation, hormone response and cellular organization processes are predominantly expressed during rice development. Interestingly, 191 transcription factor (TF)-encoding genes are predominantly expressed in seed and 59 TFs are regulated during seed development, some of which are homologs of seed-specific TFs or regulators of Arabidopsis seed development. Gene co-expression network analysis showed these TFs associated with multiple cellular and metabolism pathways, indicating a complex regulation of rice seed development. Further, by employing a cold-resistant cultivar Hanfeng (HF), genome-wide analyses of seed transcriptome at normal and low temperature reveal that rice seed is sensitive to low temperature at early stage and many genes associated with seed development are down-regulated by low temperature, indicating that the delayed development of rice seed by low temperature is mainly caused by the inhibition of the development-related genes. The transcriptional response of seed and seedling to low temperature is different, and the differential expressions of genes in signaling and metabolism pathways may contribute to the chilling tolerance of HF during seed development. Conclusions These results provide informative clues and will significantly improve the understanding of rice seed development regulation and the mechanism of cold response in rice seed. PMID:22363552

Impact of low concentration factor microfiltration on milk component recovery and Cheddar cheese yield.

PubMed

Neocleous, M; Barbano, D M; Rudan, M A

2002-10-01

The effect of microfiltration (MF) on the composition of Cheddar cheese, fat, crude protein (CP), calcium, total solids recovery, and Cheddar cheese yield efficiency (i.e., composition adjusted yield divided by theoretical yield) was determined. Raw skim milk was microfiltered twofold using a 0.1-microm ceramic membrane at 50 degrees C. Four vats of cheese were made in one day using milk at lx, 1.26x, 1.51x, and 1.82x concentration factor (CF). An appropriate amount of cream was added to achieve a constant casein (CN)-to-fat ratio across treatments. Cheese manufacture was repeated on four different days using a randomized complete block design. The composition of the cheese was affected by MF. Moisture content of the cheese decreased with increasing MF CF. Standardization of milk to a constant CN-to-fat ratio did not eliminate the effect of MF on cheese moisture content. Fat recovery in cheese was not changed by MF. Separation of cream prior to MF, followed by the recombination of skim or MF retentate with cream resulted in lower fat recovery in cheese for control and all treatments and higher fat loss in whey when compared to previous yield experiments, when control Cheddar cheese was made from unseparated milk. Crude protein, calcium, and total solids recovery in cheese increased with increasing MF CF, due to partial removal of these components prior to cheese making. Calcium and calcium as a percentage of protein increased in the cheese, suggesting an increase in calcium retention in the cheese with increasing CF. While the actual and composition adjusted cheese yields increased with increasing MF CF, as expected, there was no effect of MF CF on cheese yield efficiency.

Role of Soybean mosaic virus-encoded proteins in seed and aphid transmission in soybean

USDA-ARS?s Scientific Manuscript database

Soybean mosaic virus (SMV) is seed and aphid transmitted and can cause significant reductions in yield and seed quality in soybean, Glycine max. The roles in seed and aphid transmission of selected SMV-encoded proteins were investigated by constructing chimeric recombinants between SMV 413 (efficien...

Seed mycoflora of Ephedra aphylla and amino acid profile of seed-borne Aspergillus flavus.

PubMed

Al-Qarawi, Abdulaziz A; Hashem, Abeer; Abd-Allah, Elsayed F

2012-09-01

Twenty-seven seed samples of Ephedra aphylla were collected from different rangelands in Riyadh region, Saudi Arabia during seed production season of 2010. They were assessed to determine the incidence of seedborne fungal flora using both agar plate and blotter paper methods. The investigation of the seeds yielded thirty four fungal species belonging to twelve genera, which are new record to seed-brone mycoflora of E. aphylla in Saudi Arabia. The agar plate method was found superior over blotter methods. The genus Aspergillus was the most prevalent one followed by Fusarium, Penicillium, Alternaria, and Chaetomium. Only eighteen isolates of A. flavus (∼ 28.6% of total isolates) were able to produce aflatoxins. Mycelial amino acids profile of selected aflatoxigenic isolates of A. flavus was investigated and five amino acids, namely cystein, lysine, praline, tryptophan and valine were common in mycelia and all of them were aflatoxins producers. Based on the dissimilarity coefficient between the isolates and their amino acids patterns, high diversity among the population of A. flavus has been recorded.

Are seed and cone pathogens causing significant losses in Pacific Northwest seed orchards?

Treesearch

E.E. Nelson; W.G. Thies; C.Y. Li

1986-01-01

Cones systematically collected in 1983 from eight Douglas-fir seed orchards in western Washington and Oregon yielded large numbers of common molds. Fungi isolated from apparently healthy, developing cones were similar to those from necrotic cones. Necrosis in cones aborted in early stages of development was apparently not associated with pathogenic fungi or bacteria....

Experimental study of bioethanol production using mixed cassava and durian seed

NASA Astrophysics Data System (ADS)

Seer, Q. H.; Nandong, J.; Shanon, T.

2017-06-01

The production of biofuels using conventional fermentation feedstocks, such as sugar-and starch-based agricultural crops will in the long-term lead to a serious competition with human-animal food consumption. To avoid this competition, it is important to explore various alternative feedstocks especially those from inedible waste materials. Potentially, fruit wastes such as damaged fruits, peels and seeds represent alternative cheap feedstocks for biofuel production. In this work, an experimental study was conducted on ethanol production using mixed cassava and durian seeds through fermentation by Saccharomyces cerevisiae yeast. The effects of pH, temperature and ratio of hydrolyzed cassava to durian seeds on the ethanol yield, substrate consumption and product formation rates were analyzed in the study. In flask-scale fermentation using the mixed cassava-durian seeds, it was found that the highest ethanol yield of 45.9 and a final ethanol concentration of 24.92 g/L were achieved at pH 5.0, temperature 35°C and 50:50 volume ratio of hydrolyzed cassava to durian seeds for a batch period of 48 hours. Additionally, the ethanol, glucose and biomass concentration profiles in a lab-scale bioreactor were examined for the fermentation using the proposed materials under the flask-scale optimum conditions. The ethanol yield of 35.7 and a final ethanol concentration of 14.61 g/L were obtained over a period of 46 hours where the glucose was almost fully consumed. It is worth noting that both pH and temperature have significant impacts on the fermentation process using the mixed cassava-durian seeds.

Screening soybean germplasm and commerical varieties for resistance to Phomopsis seed decay: results from 2012 trials

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) causes poor seed quality and suppresses yield in most soybean production areas of the United States. In 2009, PSD caused a yield loss of over 12 million bushels in 16 southern states. The disease is primarily caused by Phomopsis longicolla along with other Phomopsi...

Structural mechanics of seed deterioration: Standing the test of time

USDA-ARS?s Scientific Manuscript database

Seeds die unexpectedly during storage and current understanding of seed quality and storage conditions does not allow reliable means to predict or prevent this critical problem. Chemical degradation of seed components likely occurs through oxidative damage, but the rate of these reactions is domina...

7 CFR 457.112 - Hybrid sorghum seed crop insurance provisions.

Code of Federal Regulations, 2011 CFR

2011-01-01

... seed test. Insurable interest. Your share of the financial loss that occurs in the event seed... by the price election you select and subtracting any minimum guaranteed payment, not to exceed the... value to dollars by multiplying it by the price election you selected. Approved yield. In lieu of the...

Extraction of methylxanthines from guaraná seeds, maté leaves, and cocoa beans using supercritical carbon dioxide and ethanol.

PubMed

Saldaña, Marleny D A; Zetzl, Carsten; Mohamed, Rahoma S; Brunner, G

2002-08-14

New experimental data on the extraction of caffeine from guaraná seeds and maté tea leaves, and theobromine from cocoa beans, with supercritical CO2 were obtained using a high-pressure extraction apparatus. The effect of the addition of ethanol to carbon dioxide on the extraction efficiency was also investigated. Caffeine extraction yields of 98% of the initial caffeine content in both wet ground guaraná seeds and maté tea leaves were obtained. Extractions of caffeine from guaraná seeds and maté tea leaves also exhibited a retrograde behavior for the two temperatures considered in this work. In the removal of theobromine from cocoa beans, a much smaller extraction yield was obtained with longer extraction periods and consequently larger solvent requirements. The results of this study confirm the higher selectivity of CO2 for caffeine in comparison with that for theobromine, and also the influence of other components in each particular natural product on the extraction of methylxanthines. The effect of the addition of ethanol to carbon dioxide on the extraction of methylxanthines was significant, particularly in the extraction of theobromine from cocoa beans. In general, the use of ethanol results in lower solvent and energy requirements and thereby improved extraction efficiency.

Characterisation of fatty acid, carotenoid, tocopherol/tocotrienol compositions and antioxidant activities in seeds of three Chenopodium quinoa Willd. genotypes.

PubMed

Tang, Yao; Li, Xihong; Chen, Peter X; Zhang, Bing; Hernandez, Marta; Zhang, Hua; Marcone, Massimo F; Liu, Ronghua; Tsao, Rong

2015-05-01

Composition of fatty acids, tocopherols, tocotrienols, and carotenoids, and their contribution to antioxidant activities were investigated in seeds of three coloured quinoa cultivars (white, red and black). The major components and individual compounds were significantly different, and their concentrations were higher in darker seeds (p < 0.05). The oil yield was 6.58-7.17% which contained predominantly unsaturated fatty acids (89.42%). The ratio of omega-6/omega-3 fatty acid was ca. 6/1. The total tocopherol content ranged from 37.49 to 59.82 μg/g and mainly consisted of γ-tocopherol. Trace amount of α- and β-tocotrienols was also found. Black quinoa had the highest vitamin E followed by red and white quinoas. Carotenoids, mainly trans-lutein (84.7-85.6%) and zeaxanthin were confirmed for the first time in quinoa seeds, and the concentration was also the highest in black seeds. The antioxidant activities of lipophilic extracts were positively correlated with polyunsaturated fatty acids, total carotenoids and total tocopherols. Copyright © 2014. Published by Elsevier Ltd.

Interactive effect of supplemental ultraviolet B and elevated ozone on seed yield and oil quality of two cultivars of linseed (Linum usitatissimum L.) carried out in open top chambers.

PubMed

Tripathi, Ruchika; Agrawal, Shashi B

2013-03-30

Current scenarios of global climate change predict a significant increase in ultraviolet B (UV-B) and tropospheric ozone (O₃) in the near future. Both UV-B and O₃ can have detrimental effects on the productivity and yield quality of important agricultural crops. The present study was conducted to investigate the individual and interactive effects of supplemental UV-B (sUV-B) (ambient + 7.2 kJ m⁻² day⁻¹) and O₃ (ambient + 10 ppb) on the yield and oil quality of two cultivars of linseed (Linum usitatissimum L.). The mean monthly ambient O₃ concentration varied from 27.7 to 59.0 ppb during the experimental period. O₃ affected fruit formation, while sUV-B was mainly responsible for ovule abortion. Seed sugar and protein contents showed maximum reduction in O₃-treated plants, while mineral nutrient levels were most affected by sUV-B + O₃ treatment. Rancid oil of low nutritional quality and containing long-chain fatty acids was favoured along with a decrease in oil content. sUV-B and O₃ individually as well as in combination caused deterioration of the yield and quality of oil and seeds of linseed. However, the individual effect of O₃ was more damaging than the effect of sUV-B or sUV-B + O₃, and cultivar T-397 performed better than Padmini. © 2012 Society of Chemical Industry.

CT, MR, and ultrasound image artifacts from prostate brachytherapy seed implants: The impact of seed size

DOE Office of Scientific and Technical Information (OSTI.GOV)

Robertson, Andrew K. H.; Basran, Parminder S.; Thomas, Steven D.

.5 manual corrections in seed positions for the thin seed scans and 3.0 {+-} 1.2 manual corrections in seed positions for the standard seed scans. The average error in seed placement was 1.2 mm for both seed types and the maximum error in seed placement was 2.1 mm for the thin seed scans and 1.8 mm for the standard seed scans. Conclusions: The 9011 thin seeds yielded significantly improved image quality for CT and US images but no significant differences in MR image quality.« less

Tomato seeds maturity detection system based on chlorophyll fluorescence

NASA Astrophysics Data System (ADS)

Li, Cuiling; Wang, Xiu; Meng, Zhijun

2016-10-01

Chlorophyll fluorescence intensity can be used as seed maturity and quality evaluation indicator. Chlorophyll fluorescence intensity of seed coats is tested to judge the level of chlorophyll content in seeds, and further to judge the maturity and quality of seeds. This research developed a detection system of tomato seeds maturity based on chlorophyll fluorescence spectrum technology, the system included an excitation light source unit, a fluorescent signal acquisition unit and a data processing unit. The excitation light source unit consisted of two high power LEDs, two radiators and two constant current power supplies, and it was designed to excite chlorophyll fluorescence of tomato seeds. The fluorescent signal acquisition unit was made up of a fluorescence spectrometer, an optical fiber, an optical fiber scaffolds and a narrowband filter. The data processing unit mainly included a computer. Tomato fruits of green ripe stage, discoloration stage, firm ripe stage and full ripe stage were harvested, and their seeds were collected directly. In this research, the developed tomato seeds maturity testing system was used to collect fluorescence spectrums of tomato seeds of different maturities. Principal component analysis (PCA) method was utilized to reduce the dimension of spectral data and extract principal components, and PCA was combined with linear discriminant analysis (LDA) to establish discriminant model of tomato seeds maturity, the discriminant accuracy was greater than 90%. Research results show that using chlorophyll fluorescence spectrum technology is feasible for seeds maturity detection, and the developed tomato seeds maturity testing system has high detection accuracy.

The Impact of Insects on Second-Year Cone Crops in Red Pine Seed-Production Areas

Treesearch

William J. Mattson

1968-01-01

Second-year cone crops in red pine seed-production areas have been severely damaged by five species of insects. Control of the two most destructive pests could increase present seed yields in most areas by at least 50 percent. Some seed-production areas may not produce harvestable seed crops until cone-insect populations are suppressed.

Control of early seed development.

PubMed

Chaudhury, A M; Koltunow, A; Payne, T; Luo, M; Tucker, M R; Dennis, E S; Peacock, W J

2001-01-01

Seed development requires coordinated expression of embryo and endosperm and has contributions from both sporophytic and male and female gametophytic genes. Genetic and molecular analyses in recent years have started to illuminate how products of these multiple genes interact to initiate seed development. Imprinting or differential expression of paternal and maternal genes seems to be involved in controlling seed development, presumably by controlling gene expression in developing endosperm. Epigenetic processes such as chromatin remodeling and DNA methylation affect imprinting of key seed-specific genes; however, the identity of many of these genes remains unknown. The discovery of FIS genes has illuminated control of autonomous endosperm development, a component of apomixis, which is an important developmental and agronomic trait. FIS genes are targets of imprinting, and the genes they control in developing endosperm are also regulated by DNA methylation and chromatin remodeling genes. These results define some exciting future areas of research in seed development.

The Importance of Seed Characteristics in the Dispersal of Splash-Cup Plants

NASA Astrophysics Data System (ADS)

Eklof, Joel; Pepper, Rachel Pepper; Echternach, Juliana

2016-11-01

Splash-cup plants disperse their seeds by exploiting the kinetic energy of raindrops. When raindrops impact the splash-cup, a 3-5 mm vessel that holds seeds, the seeds are projected up to 1 m away from the parent plant. It has been established, using 3D printed models, that a 40°cone angle maximizes dispersal distance when seeds are not present in the cup. We therefore use 40°cups with the addition of different types of seeds to determine the effect that seeds of varying characteristics have on the dispersal and splash dynamics of splash-cup plants. Splash characteristics and dispersal distances of seeds with differing characteristics such as size, shape, texture, density, and hydrophobicity were compared to one another, as well as to the case of having no seeds present. We found that the presence of seeds dramatically decreased dispersal distance and changed splash characteristics (are measured by the angle and velocity of the resulting splash). In addition, different types of seeds yielded splashes with differing dispersal distance and splash characteristics. Splash characteristics and dispersal distances of glass beads of differing hydrophobicity were compared to determine the effect hydrophobicity has on dispersal and splash dynamics. These beads yielded some differences in dispersal distance, but no notable difference in splash dynamics. Models of the conical fruit bodies of the splash-cups were 3D printed and high-speed video was used to find splash characteristics, and dispersal distance was calculated by measuring the distance from the model to the final resting position of the seeds and droplets.

Modeling the effects of ozone on soybean growth and yield.

PubMed

Kobayashi, K; Miller, J E; Flagler, R B; Heck, W W

1990-01-01

A simple mechanistic model was developed based on an existing growth model in order to address the mechanisms of the effects of ozone on growth and yield of soybean [Glycine max. (L.) Merr. 'Davis'] and interacting effects of other environmental stresses. The model simulates daily growth of soybean plants using environmental data including shortwave radiation, temperature, precipitation, irrigation and ozone concentration. Leaf growth, dry matter accumulation, water budget, nitrogen input and seed growth linked to senescence and abscission of leaves are described in the model. The effects of ozone are modeled as reduced photosynthate production and accelerated senescence. The model was applied to the open-top chamber experiments in which soybean plants were exposed to ozone under two levels of soil moisture regimes. After calibrating the model to the growth data and seed yield, goodness-of-fit of the model was tested. The model fitted well for top dry weight in the vegetative growth phase and also at maturity. The effect of ozone on seen yield was also described satisfactorily by the model. The simulation showed apparent interaction between the effect of ozone and soil moisture stress on the seed yield. The model revealed that further work is needed concerning the effect of ozone on the senescence process and the consequences of alteration of canopy microclimate by the open-top chambers.

β-Sitosterol: Supercritical Carbon Dioxide Extraction from Sea Buckthorn (Hippophae rhamnoides L.) Seeds

PubMed Central

Sajfrtová, Marie; Ličková, Ivana; Wimmerová, Martina; Sovová, Helena; Wimmer, Zdeněk

2010-01-01

Supercritical fluid extraction represents an efficient and environmentally friendly technique for isolation of phytosterols from different plant sources. Sea buckthorn (Hippophae rhamnoides L.) seeds were extracted with supercritical carbon dioxide at pressures ranging from 15–60 MPa and temperatures of 40–80 °C. Oil and β-sitosterol yields were measured in the extraction course and compared with Soxhlet extraction with hexane. The average yield of β-sitosterol was 0.31 mg/g of seeds. The maximum concentration of β-sitosterol in the extract, 0.5% w/w, was achieved at 15 MPa, 40 °C, and a carbon dioxide consumption of 50 g/g of seeds. The extraction rate was maximal at 60 MPa and 40 °C. Both β-sitosterol yield and its concentration in the extract obtained with hexane were lower than with carbon dioxide. PMID:20480045

β-Sitosterol: supercritical carbon dioxide extraction from sea buckthorn (Hippophae rhamnoides L.) seeds.

PubMed

Sajfrtová, Marie; Licková, Ivana; Wimmerová, Martina; Sovová, Helena; Wimmer, Zdenek

2010-04-22

Supercritical fluid extraction represents an efficient and environmentally friendly technique for isolation of phytosterols from different plant sources. Sea buckthorn (Hippophae rhamnoides L.) seeds were extracted with supercritical carbon dioxide at pressures ranging from 15-60 MPa and temperatures of 40-80 degrees C. Oil and β-sitosterol yields were measured in the extraction course and compared with Soxhlet extraction with hexane. The average yield of β-sitosterol was 0.31 mg/g of seeds. The maximum concentration of β-sitosterol in the extract, 0.5% w/w, was achieved at 15 MPa, 40 degrees C, and a carbon dioxide consumption of 50 g/g of seeds. The extraction rate was maximal at 60 MPa and 40 degrees C. Both β-sitosterol yield and its concentration in the extract obtained with hexane were lower than with carbon dioxide.

[Study on High-yield Cultivation Measures for Arctii Fructus].

PubMed

Liu, Shi-yong; Jiang, Xiao-bo; Wang, Tao; Sun, Ji-ye; Hu, Shang-qin; Zhang, Li

2015-02-01

To find out the high yield cultivation measures for Arctii Fructus. Completely randomized block experiment design method was used in the field planting, to analyze the effect of different cultivation way on agronomic characters, phenological phase,quality and quantity of Arctii Fructus. Arctium lappa planted on August 28 had the best results of plant height, thousand seeds weight and yield. The highest yield of Arctii Fructus was got at the density of 1,482 plants/667 m2. Arctiin content was in an increase trend with the planting time delay and planting density increasing. The plant height, thousand seeds weight, yield and arctiin content by split application of fertilizer were significantly higher than that by one-time fertilization. Compared with open field Arctium lappa, plant height, yield, arctiin content and relative water content of plastic film mulching Arctium lappa was higher by 7.74%, 10.87%, 6.38% and 24.20%, respectively. In the topping Arctium lappa, the yield was increased by 11.09%, with 39. 89% less branching number. Early planting time and topping shortened the growth cycle of Arctium lappa plant. The high-yield cultivation measures of Arctii Fructus are: around August 28 to sowing, planting density of 1 482 plants/667 m2, split application of fertilizer for four times, covering film on surface of the soil and topping in bolting.

Static magnetic field treatment of seeds improves carbon and nitrogen metabolism under salinity stress in soybean.

PubMed

Baghel, Lokesh; Kataria, Sunita; Guruprasad, Kadur Narayan

2016-10-01

The effectiveness of magnetopriming was assessed for alleviation of salt-induced adverse effects on soybean growth. Soybean seeds were pre-treated with static magnetic field (SMF) of 200 mT for 1 h to evaluate the effect of magnetopriming on growth, carbon and nitrogen metabolism, and yield of soybean plants under different salinity levels (0, 25, and 50 mM NaCl). The adverse effect of NaCl-induced salt stress was found on growth, yield, and various physiological attributes of soybeans. Results indicate that SMF pre-treatment significantly increased plant growth attributes, number of root nodules, nodules, fresh weight, biomass accumulation, and photosynthetic performance under both non-saline and saline conditions as compared to untreated seeds. Polyphasic chlorophyll a fluorescence (OJIP) transients from magnetically treated plants gave a higher fluorescence yield at J-I-P phase. Nitrate reductase activity, PIABS , photosynthetic pigments, and net rate of photosynthesis were also higher in plants that emerged from SMF pre-treated seeds as compared to untreated seeds. Leghemoglobin content and hemechrome content in root nodules were also increased by SMF pre-treatment. Thus pre-sowing exposure of seeds to SMF enhanced carbon and nitrogen metabolism and improved the yield of soybeans in terms of number of pods, number of seeds, and seed weight under saline as well as non-saline conditions. Consequently, SMF pre-treatment effectively mitigated adverse effects of NaCl on soybeans. It indicates that magnetopriming of dry soybean seeds can be effectively used as a pre-sowing treatment for alleviating salinity stress. Bioelectromagnetics. 37:455-470, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Study of optimal extraction conditions for achieving high yield and antioxidant activity of tomato seed oil

USDA-ARS?s Scientific Manuscript database

Tomato seeds resulting from tomato processing by-product have not been effectively utilized as value-added products. This study investigated the kinetics of oil extraction from tomato seeds and sought to optimize the oil extraction conditions. The oil was extracted by using hexane as solvent for 0 t...

Stabilized diode seed laser for flight and space-based remote lidar sensing applications

NASA Astrophysics Data System (ADS)

McNeil, Shirley; Pandit, Pushkar; Battle, Philip; Rudd, Joe; Hovis, Floyd

2017-08-01

AdvR, through support of the NASA SBIR program, has developed fiber-based components and sub-systems that are routinely used on NASA's airborne missions, and is now developing an environmentally hardened, diode-based, locked wavelength, seed laser for future space-based high spectral resolution lidar applications. The seed laser source utilizes a fiber-coupled diode laser, a fiber-coupled, calibrated iodine reference module to provide an absolute wavelength reference, and an integrated, dual-element, nonlinear optical waveguide component for second harmonic generation, spectral formatting and wavelength locking. The diode laser operates over a range close to 1064.5 nm, provides for stabilization of the seed to the desired iodine transition and allows for a highly-efficient, fully-integrated seed source that is well-suited for use in airborne and space-based environments. A summary of component level environmental testing and spectral purity measurements with a seeded Nd:YAG laser will be presented. A direct-diode, wavelength-locked seed laser will reduce the overall size weight and power (SWaP) requirements of the laser transmitter, thus directly addressing the need for developing compact, efficient, lidar component technologies for use in airborne and space-based environments.

Identification of soybean accessions with resistance to Phomopsis seed decay: joint effort from USDA and university scientists

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) is primarily caused by Phomopsis longicolla along with other Phomopsis and Diaporthe spp. This disease causes poor seed quality and suppresses yield in most soybean-growing states in the United States. In 2009, PSD caused yield loss of over 12 million bushels in 16...

Reaction of maturity group V soybean lines to purple seed stains in Mississippi 2010

USDA-ARS?s Scientific Manuscript database

In 2009, soybean purple seed stain (PSS) caused 6.4 million bushels of yield losses in 16 southern states. This disease severely reduces seed market grade and affects seed germination and vigor. PSS is caused by Cercospora kikuchii and is an economy important disease. To identify new sources of resi...

Modeling homeorhetic trajectories of milk component yields, body composition and dry-matter intake in dairy cows: Influence of parity, milk production potential and breed.

PubMed

Daniel, J B; Friggens, N C; van Laar, H; Ingvartsen, K L; Sauvant, D

2018-06-01

The control of nutrient partitioning is complex and affected by many factors, among them physiological state and production potential. Therefore, the current model aims to provide for dairy cows a dynamic framework to predict a consistent set of reference performance patterns (milk component yields, body composition change, dry-matter intake) sensitive to physiological status across a range of milk production potentials (within and between breeds). Flows and partition of net energy toward maintenance, growth, gestation, body reserves and milk components are described in the model. The structure of the model is characterized by two sub-models, a regulating sub-model of homeorhetic control which sets dynamic partitioning rules along the lactation, and an operating sub-model that translates this into animal performance. The regulating sub-model describes lactation as the result of three driving forces: (1) use of previously acquired resources through mobilization, (2) acquisition of new resources with a priority of partition towards milk and (3) subsequent use of resources towards body reserves gain. The dynamics of these three driving forces were adjusted separately for fat (milk and body), protein (milk and body) and lactose (milk). Milk yield is predicted from lactose and protein yields with an empirical equation developed from literature data. The model predicts desired dry-matter intake as an outcome of net energy requirements for a given dietary net energy content. The parameters controlling milk component yields and body composition changes were calibrated using two data sets in which the diet was the same for all animals. Weekly data from Holstein dairy cows was used to calibrate the model within-breed across milk production potentials. A second data set was used to evaluate the model and to calibrate it for breed differences (Holstein, Danish Red and Jersey) on the mobilization/reconstitution of body composition and on the yield of individual milk components

Changes in seed water status as characterized by NMR in developing soybean seed grown under moisture stress conditions

DOE Office of Scientific and Technical Information (OSTI.GOV)

Krishnan, P., E-mail: pkrishnan@iari.res.in; Singh, Ravender; Verma, A.P.S.

Highlights: • In developing soybean seeds, moisture stress resulted in more proportion of water to bound state. • These changes are further corroborated by concomitant changes in seed metabolites. • Thus there exists a moisture stress and development stage dependence of seed tissue water status. - Abstract: Changes in water status of developing seeds of Soybean (Glycine max L. Merrill.) grown under different moisture stress conditions were characterized by proton nuclear magnetic resonance (NMR)- spin–spin relaxation time (T{sub 2}). A comparison of the seed development characteristics, composition and physical properties indicated that, characteristics like seed weight, seed number/ear, rate ofmore » seed filling increased with development stages but decreased with moisture stress conditions. The NMR- spin–spin relaxation (T{sub 2}) component like bound water increased with seed maturation (40–50%) but decreased with moisture stress conditions (30–40%). The changes in seed water status to increasing levels of moisture stress and seed maturity indicates that moisture stress resulted in more proportion of water to bound state and intermediate state and less proportion of water in free-state. These changes are further corroborated by significant changes in protein and starch contents in seeds under high moisture stress treatments. Thus seed water status during its development is not only affected by development processes but also by moisture stress conditions. This study strongly indicated a clear moisture stress and development stage dependence of seed tissue water status in developing soybean seeds.« less

Optimization of mucilage extraction from chia seeds (Salvia hispanica L.) using response surface methodology.

PubMed

Orifici, Stefania C; Capitani, Marianela I; Tomás, Mabel C; Nolasco, Susana M

2018-02-25

Chia mucilage has potential application as a functional ingredient; advances on maximizing its extraction yield could represent a significant technological and economic impact for the food industry. Thus, first, the effect of mechanical agitation time (1-3 h) on the exudation of chia mucilage was analyzed. Then, response surface methodology was used to determine the optimal combination of the independent variables temperature (15-85 °C) and seed: water ratio (1: 12-1: 40.8 w/v) for the 2 h exudation that give maximum chia mucilage yield. Experiments were designed according to central composite rotatable design. A second-order polynomial model predicted the variation in extraction mucilage yield with the variables temperature and seed: water ratio. The optimal operating conditions were found to be temperature 85 °C and a seed: water ratio of 1: 31 (w/v), reaching an experimental extraction yield of 116 ± 0.21 g kg -1 (dry basis). The mucilage obtained exhibited good functional properties, mainly in terms of water-holding capacity, emulsifying activity, and emulsion stability. The results obtained show that temperature, seed: water ratio, and exudation time are important variables of the process that affect the extraction yield and the quality of the chia mucilage, determined according to its physicochemical and functional properties. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

Comparison of gamma and electron beam irradiation in reducing populations of E. coli artificially inoculated on Mung Bean, clover and Fenugreek Seeds, and affecting germination and growth of seeds

USDA-ARS?s Scientific Manuscript database

Sprouts have frequently been implicated in outbreaks of foodborne illnesses, mostly due to contaminated seeds. Intervention technologies to decontaminate seeds without affecting sprout yield are needed. In the present study, we compared gamma rays with electron beam in inactivating E. coli artifici...

The slow and fast pyrolysis of cherry seed.

PubMed

Duman, Gozde; Okutucu, Cagdas; Ucar, Suat; Stahl, Ralph; Yanik, Jale

2011-01-01

The slow and fast pyrolysis of cherry seeds (CWS) and cherry seeds shells (CSS) was studied in fixed-bed and fluidized bed reactors at different pyrolysis temperatures. The effects of reactor type and temperature on the yields and composition of products were investigated. In the case of fast pyrolysis, the maximum bio-oil yield was found to be about 44 wt% at pyrolysis temperature of 500 °C for both CWS and CSS, whereas the bio yields were of 21 and 15 wt% obtained at 500 °C from slow pyrolysis of CWS and CSS, respectively. Both temperature and reactor type affected the composition of bio-oils. The results showed that bio-oils obtained from slow pyrolysis of CWS and CSS can be used as a fuel for combustion systems in industry and the bio-oil produced from fast pyrolysis can be evaluated as a chemical feedstock. Copyright © 2010 Elsevier Ltd. All rights reserved.

Reaction of maturity group V soybean plant introductions to Phomopsis Seed Decay in Arkansas Mississippi and Missouri 2009

USDA-ARS?s Scientific Manuscript database

In 2009, Soybean Phomopsis seed decay (PSD) caused over 12 million bushels of yield loss in 16 southern states. This disease severely affects soybean seed quality due to the reduction of seed viability, oil content, and alteration of seed composition, and it may also increase moldy and/or split seed...

Sci-Sat AM(2): Brachy-07: Tomosynthesis-based seed reconstruction in LDR prostate brachytherapy: A clinical study.

PubMed

Brunet-Benkhoucha, M; Verhaegen, F; Lassalle, S; Béliveau-Nadeau, D; Reniers, B; Donath, D; Taussky, D; Carrier, J-F

2008-07-01

To develop a tomosynthesis-based dose assessment procedure that can be performed after an I-125 prostate seed implantation, while the patient is still under anaesthesia on the treatment table. Our seed detection procedure involves the reconstruction of a volume of interest based on the backprojection of 7 seed-only binary images acquired over an angle of 60° with an isocentric imaging system. A binary seed-only volume is generated by a simple thresholding of the volume of interest. Seeds positions are extracted from this volume with a 3D connected component analysis and a statistical classifier that determines the number of seeds in each cluster of connected voxels. A graphical user interface (GUI) allows to visualize the result and to introduce corrections, if needed. A phantom and a clinical study (24 patients) were carried out to validate the technique. A phantom study demonstrated a very good localization accuracy of (0.4+/-0.4) mm when compared to CT-based reconstruction. This leads to dosimetric error on D90 and V100 of respectively 0.5% and 0.1%. In a patient study with an average of 56 seeds per implant, the automatic tomosynthesis-based reconstruction yields a detection rate of 96% of the seeds and less than 1.5% of false-positives. With the help of the GUI, the user can achieve a 100% detection rate in an average of 3 minutes. This technique would allow to identify possible underdosage and to correct it by potentially reimplanting additional seeds. A more uniform dose coverage could then be achieved in LDR prostate brachytherapy. © 2008 American Association of Physicists in Medicine.

Bioethanol produced from Moringa oleifera seeds husk

NASA Astrophysics Data System (ADS)

Ali, E. N.; Kemat, S. Z.

2017-06-01

This paper presents the potential of bioethanol production from Moringa oleifera seeds husk which contains lignocellulosic through Simultaneous Saccharification and Fermentation (SSF) process by using Saccharomyces cerevisiae. This paper investigates the parameters which produce optimum bioethanol yield. The husk was hydrolyzed using NaOH and fermented using Saccharomyces cerevisiae yeast. Batch fermentation was performed with different yeast dosage of 1, 3, and 5 g/L, pH value was 4.5, 5.0 and 5.5, and fermentation time of 3, 6, 9 and 12 hours. The temperature of fermentation process in incubator shaker is kept constant at 32ºC. The samples are then filtered using a 0.20 μm nylon filter syringe. The yield of bioethanol produced was analysed using High Performance Liquid Chromatography (HPLC). The results showed that the highest yield of 29.69 g/L was obtained at 3 hours of fermentation time at pH of 4.5 and using 1g/L yeast. This research work showed that Moringa oleifera seeds husk can be considered to produce bioethanol.

Effects of foliar boron application on seed composition, cell wall boron, and seed delta 15N and delta 13C isotopes in soybean are influenced by water stress

USDA-ARS?s Scientific Manuscript database

Although the effect of foliar boron (B) application on yield and quality is well established for crops, limited information and controversial results still exist on the effects of foliar B application on soybean seed composition (seed protein, oil, fatty acids, and sugars). The objective of this res...

The Seeding and Cultivation of a Tropical Species of Filamentous Ulva for Algal Biomass Production

PubMed Central

Carl, Christina; de Nys, Rocky; Paul, Nicholas A.

2014-01-01

Filamentous species of Ulva are ideal for cultivation because they are robust with high growth rates and maintained across a broad range of environments. Temperate species of filamentous Ulva are commercially cultivated on nets which can be artificially ‘seeded’ under controlled conditions allowing for a high level of control over seeding density and consequently biomass production. This study quantified for the first time the seeding and culture cycle of a tropical species of filamentous Ulva (Ulva sp. 3) and identified seeding density and nursery period as key factors affecting growth and biomass yield. A seeding density of 621,000 swarmers m-1 rope in combination with a nursery period of five days resulted in the highest growth rate and correspondingly the highest biomass yield. A nursery period of five days was optimal with up to six times the biomass yield compared to ropes under either shorter or longer nursery periods. These combined parameters of seeding density and nursery period resulted in a specific growth rate of more than 65% day−1 between 7 and 10 days of outdoor cultivation post-nursery. This was followed by a decrease in growth through to 25 days. This study also demonstrated that the timing of harvest is critical as the maximum biomass yield of 23.0±8.8 g dry weight m−1 (228.7±115.4 g fresh weight m−1) was achieved after 13 days of outdoor cultivation whereas biomass degraded to 15.5±7.3 g dry weight m−1 (120.2±71.8 g fresh weight m−1) over a longer outdoor cultivation period of 25 days. Artificially seeded ropes of Ulva with high biomass yields over short culture cycles may therefore be an alternative to unattached cultivation in integrated pond-based aquaculture systems. PMID:24897115

Biodiesel production methods of rubber seed oil: a review

NASA Astrophysics Data System (ADS)

Ulfah, M.; Mulyazmi; Burmawi; Praputri, E.; Sundari, E.; Firdaus

2018-03-01

The utilization of rubber seed as raw material of biodiesel production is seen highly potential in Indonesia. The availability of rubber seeds in Indonesia is estimated about 5 million tons per annum, which can yield rubber seed oil about 2 million tons per year. Due to the demand of edible oils as a food source is tremendous and the edible oil feedstock costs are far expensive to be used as fuel, production of biodiesel from non-edible oils such as rubber seed is an effective way to overcome all the associated problems with edible oils. Various methods for producing biodiesel from rubber seed oil have been reported. This paper introduces an optimum condition of biodiesel production methods from rubber seed oil. This article was written to be a reference in the selection of methods and the further development of biodiesel production from rubber seed oil. Biodiesel production methods for rubber seed oils has been developed by means of homogeneous catalysts, heterogeneous catalysts, supercritical method, ultrasound, in-situ and enzymatic processes. Production of biodiesel from rubber seed oil using clinker loaded sodium methoxide as catalyst is very interesting to be studied and developed further.

Seed-to-seed growth of superdwarf wheat and arabidopsis using red light-emitting diodes (LED's): A report on baseline tests conducted for NASA's proposed Plant Research Unit (PRU)

NASA Technical Reports Server (NTRS)

Goins, G. D.; Yorio, N. C.; Sanwo, M. M.; Brown, C. S.

1996-01-01

To determine the influence of narrow-spectrum red light-emitting diodes (LED's) on plant growth and seed production, wheat (Triticum aestivum L.cv Superdwarf) and Arabidopsis (Arabidopsis thaliana (L.) Heynh, race Columbia) plants were grown under red LED's (peak emission 660 nm) and compared to plants grown under daylight fluorescent (white) light and red LED's supplemented with either 1 percent or 10 percent blue fluorescent (BF) light. Wheat growth under red LED's alone appeared normal, whereas Arabidopsis under red LED's alone developed curled leaf margins and a spiraling growth pattern. Both wheat and Arabidopsis under red LED's alone or red LED's + 1 percent BF light had significantly lower seed yield than plants grown under white light. However, the addition of 10 percent BF light to red LED's partially alleviated the adverse effect of red LED's on yield. Irrespective of the light treatment, viable seeds were produced by wheat(75-92 percent germination rate) and Arabidopsis (85-100 percent germination rate). These results indicate that wheat, and to a lesser extent Arabidopsis, can be successfully grown under red LED's alone, but supplemental blue light is required with red LED's to sufficiently match the growth characteristics and seed yield associated with plants grown under white light.

The Effect of Seed-borne Mycoflora from Sorghum and Foxtail Millet Seeds on Germination and Disease Transmission.

PubMed

Yago, Jonar I; Roh, Jae-Hwan; Bae, Soon-do; Yoon, Young-Nam; Kim, Hyun-Ju; Nam, Min-Hee

2011-09-01

The seed-borne mycoflora of sorghum and foxtail millet collected from different growing areas in South Korea were isolated and taxonomically identified using dry inspection, standard blotter and the agar plate method. We investigated the in vitro and in vivo germination rates of disinfected and non-disinfected seeds of sorghum and foxtail millet using sterilized and unsterilized soil. The percent recovery of seed-borne mycoflora from the seed components of sorghum and foxtail millet seeds was determined and an infection experiment using the dominant species was evaluated for seedling emergence and mortality. A higher number of seed-borne fungi was observed in sorghum compared to that of foxtail millet. Eighteen fungal genera with 34 fungal species were identified from the seeds of sorghum and 13 genera with 22 species were identified from the seeds of foxtail millet. Five dominant species such as Alternaria alternata, Aspergillus flavus, Curvularia lunata, Fusarium moniliforme and Phoma sp. were recorded as seed-borne mycoflora in sorghum and 4 dominant species (Alternaria alternata, Aspergillus flavus, Curvularia lunata, Fusarium moniliforme) were observed in foxtail millet. The in vitro and in vivo germination rates were higher using disinfected seeds and sterilized soil. More seed-borne fungi were recovered from the pericarp compared to the endosperm and seed embryo. The percent recovery of seed-borne fungi ranged from 2.22% to 60.0%, and Alternaria alternata, Curvularia lunata and 4 species of Fusarium were isolated from the endosperm and embryo of sorghum and foxtail millet. Inoculation of the dominant seed-borne fungi showed considerable mortality of seedlings. All the transmitted seed-borne fungi might well be a primary source of infection of sorghum and foxtail millet crops.

High environmental stress yields greater tocotrienol content while changing vitamin e profiles of wild emmer wheat seeds.

PubMed

Watts, Emily J; Shen, Yu; Lansky, Ephraim P; Nevo, Eviatar; Bobe, Gerd; Traber, Maret G

2015-02-01

Vitamin E is an essential human nutrient that was first isolated from wheat. Emmer wheat, the cereal of Old World agriculture and a precursor to durum wheat, grows wild in the Fertile Crescent. Evolution Canyon, Israel, provides a microsite that models effects of contrasting environments. The north-facing and south-facing slopes exhibit low and high stress environments, respectively. Wild emmer wheat seeds were collected from both slopes and seed tocochromanol contents measured to test the hypothesis that high stress alters emmer wheat seed tocol-omics. Seeds from high stress areas contained more total vitamin E (108±15 nmol/g) than seeds from low stress environments (80±17 nmol/g, P=.0004). Vitamin E profiles within samples from these different environments revealed significant differences in isoform concentrations. Within each region, β- plus γ-tocotrienols represented the highest concentration of wheat tocotrienols (high stress, P<.0001; low stress, P<.0001), while α-tocopherol represented the highest concentration of the tocopherols (high stress, P=.0002; low stress, P<.0001). Percentages of both δ-tocotrienol and δ-tocopherol increased in high stress conditions. Changes under higher stress apparently are due to increased pathway flux toward more tocotrienol production. The production of more δ-isoforms suggests increased flow through a divergent path controlled by the VTE1 gene. Hence, stress conditions alter plant responses such that vitamin E profiles are changed, likely an attempt to provide additional antioxidant activity to promote seed viability and longevity.

Seed priming and transgenerational drought memory improves tolerance against salt stress in bread wheat.

PubMed

Tabassum, Tahira; Farooq, Muhammad; Ahmad, Riaz; Zohaib, Ali; Wahid, Abdul

2017-09-01

This study was conducted to evaluate the potential of seed priming following terminal drought on tolerance against salt stress in bread wheat. Drought was imposed in field sown wheat at reproductive stage (BBCH growth stage 49) and was maintained till physiological maturity (BBCH growth stage 83). Seeds of bread wheat, collected from crop raised under terminal drought and/or well-watered conditions, were subjected to hydropriming and osmopriming (with 1.5% CaCl 2 ) and were sown in soil-filled pots. After stand establishment, salt stress treatments viz. 10 mM NaCl (control) and 100 mM NaCl were imposed. Seed from terminal drought stressed source had less fat (5%), and more fibers (11%), proteins (22%) and total soluble phenolics (514%) than well-watered seed source. Salt stress reduced the plant growth, perturbed water relations and decreased yield. However, an increase in osmolytes accumulation (4-18%), malondialdehyde (MDA) (27-35%) and tissue Na + contents (149-332%) was observed under salt stress. The seeds collected from drought stressed crop had better tolerance against salt stress as indicated by better yield (28%), improved water relations (3-18%), osmolytes accumulation (21-33%), and less MDA (8%) and Na contents (35%) than progeny of well-watered crop. Seed priming, osmopriming in particular, further improved the tolerance against salt stress through improvement in leaf area, water relations, leaf proline, glycine betaine and grain yield while lowering MDA and Na + contents. In conclusion, changed seed composition during terminal drought and seed priming improved the salt tolerance in wheat by modulating the water relations, osmolytes accumulation and lipid peroxidation. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

An Economic Analysis of Pigeonpea Seed Production Technology and Its Adoption Behavior: Indian Context.

PubMed

Pal, Govind; Channanamchery, Radhika; Singh, R K; Kethineni, Udaya Bhaskar; Ram, H; Prasad, S Rajendra

2016-01-01

The present study was based on primary data collected from 100 farmers in Gulbarga district of Karnataka, India, during the agricultural year 2013-2014. Study shows that average land holding size of pigeonpea seed farmers was higher in comparison to grain farmers and district average. The study illustrates a ratio of 32 : 68 towards fixed and variable costs in pigeonpea certified seed production with a total cost of ₹ 39436 and the gross and net returns were ₹ 73300 and ₹ 33864 per hectare, respectively. The total cost of cultivation, gross return, and net return in pigeonpea seed production were higher by around 23, 32, and 44 percent than grain production, respectively. Hence, production of certified seed has resulted in a win-win situation for the farmers with higher yield and increased returns. The decision of the farmer on adoption of seed production technology was positively influenced by his education, age, land holding, irrigated land, number of crops grown, and extension contacts while family size was influencing negatively. Higher yield and profitability associated with seed production can be effectively popularized among farmers, resulting in increased certified seed production.

Brachypodium seed - a potential model for studying grain development of cereal crops

USDA-ARS?s Scientific Manuscript database

Seeds of small grains are important resources for human and animal food. The understanding of seed biology is essential for crop improvement by increasing grain yields and nutritional value. In the last decade, Brachypodium distachyon has been developed as a model plant for temperate cereal grasses...

Reaction of maturity group IV soybean plant introductions to Phomopsis Seed Decay in Arkansas Mississippi and Missouri 2009

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) causes poor seed quality and suppresses yield in most of soybean-growing states in United States. In 2009, PSD caused over 12 million bushel yield loss in 16 southern states. The disease is primarily caused by Phomopsis longicolla along with other Phomopsis and Dia...

Traits Explaining Durum Wheat (Triticum turgidum L. spp. Durum) Yield in Dry Chilean Mediterranean Environments

PubMed Central

González-Ribot, Gerlitt; Opazo, Marcela; Silva, Paola; Acevedo, Edmundo

2017-01-01

Yield under water stress (YS) is used as the main criterion in the selection of wheat varieties for dry Mediterranean environments. It has been proposed that selection of genotypes using YS assisted by morphological and physiological traits associated with YS is more efficient in selecting high yielding genotypes for dry environments. A study was carried out at the Antumapu Experiment Station of the University of Chile, located in Santiago, Chile (33° 40′S and 70° 38′ W). The objective was to evaluate the extent to which morpho physiological traits could explain YS. For this purpose, grain yield and yield components of 185 durum wheat genotypes from ICARDA (International Center for Agricultural Research in the Dry Areas) and INIA (Chilean National Institute for Agricultural Research) were evaluated along with seed size and weight, days to heading (DH), glaucousness (GLAU), plant height (PH) and 13C discrimination (Δ). The design was an α-lattice with two replications, the genotypes were grown in two different water conditions (high and low irrigation) during two seasons (2011-2012/2012-2013). Grain weight (GW) was the only yield component with high H associated with YS, but it was not associated with yield under high irrigation (YI). The combination of YI with DH+GLAU+PH+Δ+GW obtained in LI environments explained a greater fraction of YS (38%) across years; these traits had lower genotype x environment interaction than YS, they also explained a higher proportion of yield under drought than YI. None of the traits studied could replace YS in selections for grain yield. It is concluded that these traits could aid in the selection of durum wheat subject to water stress, particularly in early generations. PMID:29104578

End product yields from the extraruminal fermentation of various polysaccharide, protein and nucleic acid components of biofuels feedstocks.

PubMed

Weimer, Paul J

2011-02-01

"Extraruminal" fermentations employing in vitro incubation of mixed ruminal bacterial consortia, are capable of converting a complex array of biomass materials to mixtures of volatile fatty acids (VFA), methane, and carbon dioxide. Most of the potential energy in the biomass feedstock is retained in the VFA products, which are potential reactants for electrochemical conversion to hydrocarbon fuels. Quantitative data on VFA yields and proportions from biomass components are necessary for determining industrial feasibility, but such measurements have not been systematically reported. VFA yields and proportions were determined for a variety of carbohydrates, proteins and nucleic acids. Carbohydrates yielded primarily acetic and propionic acids, while proteins also yielded a more favorable product mix (longer average chain length and branched chain VFAs). Addition of certain co-substrates (e.g., glycerol) favorably improved the VFA product mix. The results have implications for hydrocarbon fuel generation from biomass materials by hybrid fermentation/chemical processes. Published by Elsevier Ltd.

Insecticide use in hybrid onion seed production affects pre- and postpollination processes.

PubMed

Gillespie, Sandra; Long, Rachael; Seitz, Nicola; Williams, Neal

2014-02-01

Research on threats to pollination service in agro-ecosystems has focused primarily on the negative impacts of land use change and agricultural practices such as insecticide use on pollinator populations. Insecticide use could also affect the pollination process, through nonlethal impacts on pollinator attraction and postpollination processes such as pollen viability or pollen tube growth. Hybrid onion seed (Allium cepa L., Alliaceae) is an important pollinator-dependent crop that has suffered yield declines in California, concurrent with increased insecticide use. Field studies suggest that insecticide use reduces pollination service in this system. We conducted a field experiment manipulating insecticide use to examine the impacts of insecticides on 1) pollinator attraction, 2) pollen/stigma interactions, and 3) seed set and seed quality. Select insecticides had negative impacts on pollinator attraction and pollen/stigma interactions, with certain products dramatically reducing pollen germination and pollen tube growth. Decreased pollen germination was not associated with reduced seed set; however, reduced pollinator attraction was associated with lower seed set and seed quality, for one of the two female lines examined. Our results highlight the importance of pesticide effects on the pollination process. Overuse may lead to yield reductions through impacts on pollinator behavior and postpollination processes. Overall, in hybrid onion seed production, moderation in insecticide use is advised when controlling onion thrips, Thrips tabaci, on commercial fields.

Gender inequality in predispersal seed predation contributes to female seed set advantage in a gynodioecious species.

PubMed

Clarke, Gretel L; Brody, Alison K

2015-05-01

Most flowering plants are hermaphrodites. However, in gynodioecious species, some members of the population are male-sterile and reproduce only by setting seed, while others gain fitness through both male and female function. How females compensate for the loss of male function remains unresolved for most gynodioecious species. Here, as with many plants, fitness differences may be influenced by interactions with multiple species. However, whether multiple species interactions result in gender-specific fitness differences remains unknown. Using observational data from 2009-2010, we quantified seed set of the two sex morphs of Polemonium foliosissimu and asked how it is affected by pollination, and seed predation from a dipteran predispersal seed predator (Anthomyiidae: Hylemya sp.). We assessed seed production and losses to predation in 27 populations for one year and in six populations for a second year. Females set significantly more seed than did hermaphrodites in both years. Of the fitness components we assessed, including the number of flowers per plant, fruit set, seeds/fruit, and proportion of fruits destroyed by Hylemya, only fruit destruction differed significantly between the sexes. In one year, seeds/fruit and predation had a stronger effect on seed set for hermaphrodites than for females. Because predispersal seed predators do not pollinate flowers, their effects may depend on successful pollination of flowers on which they oviposit. To examine if genders differed in pollen limitation and seed predation and/or their interactive effects, in 2011 we hand-pollinated flowers and removed seed predator eggs in a fully factorial design. Both sexes were pollen limited, but their degree of pollen limitation did not differ. However, predation reduced.seed set more for hermaphrodites than for females. We found no significant interaction between hand pollen and seed predation, and no interaction between hand pollination and gender. Our results suggest that while

Effects of boron nutrition and water stress on nitrogen fixation, seed d15N and d13C daynamics, and seed composition in soybean cultivars differing in maturities

USDA-ARS?s Scientific Manuscript database

Water stress is a major abiotic stress factor, resulting in a major yield loss and poor seed quality. Little information is available on the effects of B nutrition on seed composition under water stress. Therefore, the objective of the current research was to investigate the effects of foliar B nutr...

Cultivation and irrigation of fernleaf biscuitroot (Lomatium dissectum) for seed production

Treesearch

Myrtle P. Shock; Clinton C. Shock; Erik G. B. Feibert; Nancy L. Shaw; Lamont D. Saunders; Ram K. Sampangi

2012-01-01

Native grass, forb, and shrub seed is needed to restore rangelands of the U.S. Intermountain West. Fernleaf biscuitroot [Lomatium dissectum (Nutt.) Mathias & Constance] is a desirable component of rangelands. Commercial seed production is necessary to provide the quantity and quality of seed needed for rangeland restoration and reclamation efforts. Fernleaf...

Copper oxide nanoparticles and bulk copper oxide, combined with indole-3-acetic acid, alter aluminum, boron, and iron in Pisum sativum seeds.

PubMed

Ochoa, Loren; Zuverza-Mena, Nubia; Medina-Velo, Illya A; Flores-Margez, Juan Pedro; Peralta-Videa, José R; Gardea-Torresdey, Jorge L

2018-09-01

The interaction of CuO nanoparticles (nCuO), a potential nanopesticide, with the growth hormone indole-3-acetic acid (IAA) is not well understood. This study aimed to evaluate the nutritional components in seeds of green pea (Pisum sativum) cultivated in soil amended with nCuO at 50 or 100mgkg -1 , with/without IAA at 10 or 100μM. Similar treatments including bulk CuO (bCuO) and CuCl 2 were set as controls. Bulk CuO at 50mgkg -1 reduced seed yield (52%), compared with control. Bulk CuO at 50mgkg -1 and nCuO at 100mgkg -1 , plus IAA at 100μM, increased iron in seeds (41 and 42%, respectively), while nCuO at 50mgkg -1 , plus IAA at 100μM reduced boron (80%, respect to control and 63%, respect to IAA at 100μM). IAA, at 10μM increased seed protein (33%), compared with control (p≤0.05). At both concentrations IAA increased sugar in seeds (20%). Overall, nCuO, plus IAA at 10μM, does not affect the production or nutritional quality of green pea seeds. Copyright © 2018 Elsevier B.V. All rights reserved.

Gallic acid is an active component for the anticarcinogenic action of grape seed procyanidins in pancreatic cancer cells.

PubMed

Cedó, Lídia; Castell-Auví, Anna; Pallarès, Victor; Macià, Alba; Blay, Mayte; Ardévol, Anna; Motilva, Maria-José; Pinent, Montserrat

2014-01-01

The aim of the present work was to evaluate the effects of a grape seed procyanidin extract (GSPE) on proliferation and apoptosis in the pancreatic adenocarcinoma cell line MIA PaCa-2 and identify the components of the extract with higher activity. The effects of the extract were analyzed on the proliferation and apoptosis processes in MIA PaCa-2 cells, as well as in the levels of the apoptosis markers Bcl-2 and Bax, the mitochondrial membrane potential, and reactive oxygen species levels. Finally, the components of the extract with higher effects were elucidated using enriched fractions of the extract and pure compounds. The results showed that GSPE inhibits cell proliferation and increases apoptosis in MIA PaCa-2 cells, which is primarily mediated by the downregulation of the antiapoptotic protein Bcl-2 and the depolarization of the mitochondrial membrane. GSPE also reduced the formation of reactive oxygen species. The component of the extract that possesses the highest antiproliferative and proapoptotic activity was gallic acid. In conclusion, GSPE acts as anticarcinogenic in MIA PaCa-2 cells, with gallic acid as the major single active constituent of the extract.

Mathematical and statistical analysis of the effect of boron on yield parameters of wheat

DOE Office of Scientific and Technical Information (OSTI.GOV)

Rawashdeh, Hamzeh; Sala, Florin; Boldea, Marius

The main objective of this research is to investigate the effect of foliar applications of boron at different growth stages on yield and yield parameters of wheat. The contribution of boron in achieving yield parameters is described by second degree polynomial equations, with high statistical confidence (p<0.01; F theoretical < F calculated, according to ANOVA test, for Alfa = 0.05). Regression analysis, based on R{sup 2} values obtained, made it possible to evaluate the particular contribution of boron to the realization of yield parameters. This was lower for spike length (R{sup 2} = 0.812), thousand seeds weight (R{sup 2} =more » 0.850) and higher in the case of the number of spikelets (R{sup 2} = 0.936) and the number of seeds on a spike (R{sup 2} = 0.960). These results confirm that boron plays an important part in achieving the number of seeds on a spike in the case of wheat, as the contribution of this element to the process of flower fertilization is well-known. In regards to productivity elements, the contribution of macroelements to yield quantity is clear, the contribution of B alone being R{sup 2} = 0.868.« less

Variability in arginine content and yield components in Valencia peanut germplasm

USDA-ARS?s Scientific Manuscript database

Peanut seeds are rich in arginine, an amino acid that has several positive effects on human health. Establishing the genetic variability of arginine content in peanut will be useful for breeding programs that have high arginine as one of their goals. The objective of this study was to evaluate the...

The Effect of Seed-borne Mycoflora from Sorghum and Foxtail Millet Seeds on Germination and Disease Transmission

PubMed Central

Yago, Jonar I.; Bae, Soon-do; Yoon, Young-Nam; Kim, Hyun-Ju; Nam, Min-hee

2011-01-01

The seed-borne mycoflora of sorghum and foxtail millet collected from different growing areas in South Korea were isolated and taxonomically identified using dry inspection, standard blotter and the agar plate method. We investigated the in vitro and in vivo germination rates of disinfected and non-disinfected seeds of sorghum and foxtail millet using sterilized and unsterilized soil. The percent recovery of seed-borne mycoflora from the seed components of sorghum and foxtail millet seeds was determined and an infection experiment using the dominant species was evaluated for seedling emergence and mortality. A higher number of seed-borne fungi was observed in sorghum compared to that of foxtail millet. Eighteen fungal genera with 34 fungal species were identified from the seeds of sorghum and 13 genera with 22 species were identified from the seeds of foxtail millet. Five dominant species such as Alternaria alternata, Aspergillus flavus, Curvularia lunata, Fusarium moniliforme and Phoma sp. were recorded as seed-borne mycoflora in sorghum and 4 dominant species (Alternaria alternata, Aspergillus flavus, Curvularia lunata, Fusarium moniliforme) were observed in foxtail millet. The in vitro and in vivo germination rates were higher using disinfected seeds and sterilized soil. More seed-borne fungi were recovered from the pericarp compared to the endosperm and seed embryo. The percent recovery of seed-borne fungi ranged from 2.22% to 60.0%, and Alternaria alternata, Curvularia lunata and 4 species of Fusarium were isolated from the endosperm and embryo of sorghum and foxtail millet. Inoculation of the dominant seed-borne fungi showed considerable mortality of seedlings. All the transmitted seed-borne fungi might well be a primary source of infection of sorghum and foxtail millet crops. PMID:22783105

Studies on optimum harvest time for hybrid rice seed.

PubMed

Fu, Hong; Cao, Dong-Dong; Hu, Wei-Min; Guan, Ya-Jing; Fu, Yu-Ying; Fang, Yong-Feng; Hu, Jin

2017-03-01

Timely harvest is critical for hybrid rice to achieve maximum seed viability, vigor and yield. However, how to predict the optimum harvest time has been rarely reported so far. The seed vigor of Zhuliangyou 06 (ZLY06) increased and reached the highest level at 20 days after pollination (DAP), when seed moisture content had a lower value, which was maintained until final seed maturation. For Chunyou 84 (CY84), seed vigor, fresh and dry weight had relatively high values at 25 DAP, when seed moisture content reached the lowest value and changed slightly from 25 to 55 DAP. In both hybrid rice varieties, seed glume chlorophyll content declined rapidly from 10 to 30 DAP and remained at a very low level after 35 DAP. Starch content exhibited an increasing trend during seed maturation, while both soluble sugar content and amylase activity decreased significantly at the early stages of seed development. Moreover, correlation analyses showed that seed dry weight, starch content and superoxide dismutase activity were significantly positively correlated with seed vigor. In contrast, chlorophyll content, moisture content, soluble sugar, soluble protein, abscisic acid, gibberellin content, electrical conductivity, catalase and ascorbate peroxidase activities were significantly negatively correlated with seed vigor. Physiological and biochemical parameters were obviously more closely related with seed vigor than with seed germinability during seed development. Seed vigor could be better used as a comprehensive factor to predict the optimum seed harvest time. It is suggested that for ZLY06 seeds could be harvested as early as 20 DAP, whereas for CY84 the earliest optimum harvest time was 25 DAP. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Exotic Grass Yields Under Southern Pines

Treesearch

H.A. Pearson

1975-01-01

Kentucky 31 and Kenwell tall fescue, Pensacola bahia, and Brunswick grasses yielded nea,rly three times more forage under an established pine stand than native grasses 7 years after seeding. Introducing exotic grasses did not significantly increase total grass production but did enhance range quality since the cool-season grasses are green during winter and are higher...

A Quick-Test for Biochar Effects on Seed Germination ...

EPA Pesticide Factsheets

Biochar is being globally evaluated as a soil amendment to improve soil characteristics (e.g. soil water holding, nutrient exchange, microbiology, pesticides and chemical availability) to increase crop yields. Unfortunately, there are no quick tests to determine what biochar types are most effective at improving soil characteristics amenable for higher crop yields. Seed germination is a critical parameter for plant establishment and may be a quick indicator of biochar quality. We adapted Oregon State University Seed Laboratory procedures to develop a “quick-test” for screening the effects of biochar on seed germination. We used 11.0 cm rectangular x 3.5 cm deep containers fitted with blotter paper. The paper was premoistened with reverse-osmosis water, followed by placement of seeds (25 in a uniform 5 x 5 vacuum-assisted pattern, and biochar mixtures). A Norfolk and Coxville soil series from South Carolina were used. A total of 18 biochars were evaluated that were produced from 6 feedstocks (pine chips, poultry litter, swine solids, switchgrass, and two blends of pine chips and poultry litter); with biochar from each feedstock made by pyrolysis at 350, 500 and 700 ̊ C. Crops were cabbage, cucumber, onion, ryegrass and tomato. Preliminary results from the test indicated differences in seed germination due to soil type and possibly soil x biochar feedstock interactions. Other measurements including shoot dry weight per plate and pH of the soil+ biochar mixtur

Improved Resistance to Controlled Deterioration in Transgenic Seeds1[W][OA

PubMed Central

Prieto-Dapena, Pilar; Castaño, Raúl; Almoguera, Concepción; Jordano, Juan

2006-01-01

We show that seed-specific overexpression of the sunflower (Helianthus annuus) HaHSFA9 heat stress transcription factor (HSF) in tobacco (Nicotiana tabacum) enhances the accumulation of heat shock proteins (HSPs). Among these proteins were HSP101 and a subset of the small HSPs, including proteins that accumulate only during embryogenesis in the absence of thermal stress. Levels of late embryogenesis abundant proteins or seed oligosaccharides, however, were not affected. In the transgenic seeds, a high basal thermotolerance persisted during the early hours of imbibition. Transgenic seeds also showed significantly improved resistance to controlled deterioration in a stable and transgene-dependent manner. Furthermore, overexpression of HaHSFA9 did not have detrimental effects on plant growth or development, including seed morphology and total seed yield. Our results agree with previous work tentatively associating HSP gene expression with phenotypes important for seed longevity. These findings might have implications for improving seed longevity in economically important crops. PMID:16998084

Plasma and hepatic cholesterol-lowering in hamsters by tomato pomace, tomato seed oil and defatted tomato seed supplemented in high fat diets

USDA-ARS?s Scientific Manuscript database

We determined the cholesterol-lowering effects of tomato pomace (TP), a byproduct of tomato processing, and its components such as tomato seed oil (TSO) and defatted tomato seed (DTS) in hamsters, a widely used animal model for cholesterol metabolism. Male Syrian Golden hamsters were fed high-fat di...

Evaluation of maturity group III soybean lines for resistance to purple seed stain in Mississippi, 2010

USDA-ARS?s Scientific Manuscript database

Purple seed stain (PSS) of soybean is an important disease caused by Cercospora kikuchii. PSS reduces seed quality and market grade, affects seed germination and vigor, and has been reported wherever soybeans are grown worldwide. In 2009, PSS caused 6.4 million bushels of yield losses in 16 southern...

Evaluation of maturity group IV soybean lines for resistance to purple seed stains in Mississippi 2010

USDA-ARS?s Scientific Manuscript database

Purple seed stain (PSS) of soybean is an important disease caused by Cercospora kikuchii. PSS reduces seed quality and market grade, affects seed germination and vigor, and has been reported wherever soybeans are grown worldwide. In 2009, PSS caused 6.4 million bushels of yield losses in 16 southern...

Dry Priming of Maize Seeds Reduces Aluminum Stress

PubMed Central

Alcântara, Berenice Kussumoto; Machemer-Noonan, Katja; Silva Júnior, Francides Gomes; Azevedo, Ricardo Antunes

2015-01-01

Aluminum (Al) toxicity is directly related to acidic soils and substantially limits maize yield. Earlier studies using hormones and other substances to treat the seeds of various crops have been carried out with the aim of inducing tolerance to abiotic stress, especially chilling, drought and salinity. However, more studies regarding the effects of seed treatments on the induction of Al tolerance are necessary. In this study, two independent experiments were performed to determine the effect of ascorbic acid (AsA) seed treatment on the tolerance response of maize to acidic soil and Al stress. In the first experiment (greenhouse), the AsA seed treatment was tested in B73 (Al-sensitive genotype). This study demonstrates the potential of AsA for use as a pre-sowing seed treatment (seed priming) because this metabolite increased root and shoot growth under acidic and Al stress conditions. In the second test, the evidence from field experiments using an Al-sensitive genotype (Mo17) and an Al-tolerant genotype (DA) suggested that prior AsA seed treatment increased the growth of both genotypes. Enhanced productivity was observed for DA under Al stress after priming the seeds. Furthermore, the AsA treatment decreased the activity of oxidative stress-related enzymes in the DA genotype. In this study, remarkable effects using AsA seed treatment in maize were observed, demonstrating the potential future use of AsA in seed priming. PMID:26714286

Biological Networks Underlying Soybean Seed Oil Composition and Content

USDA-ARS?s Scientific Manuscript database

Soybean is the most important oil crop in the United States. Production of soybean seed oil requires coordinated expression of many biological components and pathways, which is further regulated by seed development and phyto-hormones. A new research project is initiated in my laboratory to delineat...

DNA fingerprinting of maize seed lots to establish genetic purity using SSR markers.

USDA-ARS?s Scientific Manuscript database

Most countries in sub-Saharan Africa (SSA) grow open pollinated maize varieties (OPVs) because seed of maize OPVs can be recycled for several seasons with minimal yield reduction due to inbreeding as compared to hybrids. However, OPVs are heterogeneous, and some local seed suppliers attempt to take ...

Effects of nitrogen and planting seed size on cotton growth, development, and yield

USDA-ARS?s Scientific Manuscript database

A standardized experiment was conducted during 2009 and 2010 at 20 location-years across U.S. cotton (Gossypium hirsutum L.)-producing states to compare the N use requirement of contemporary cotton cultivars based on their planting seed size. Treatments consisted of three cotton varieties with plant...

Seed Nutrition and Quality, Seed Coat Boron and Lignin Are Influenced by Delayed Harvest in Exotically-Derived Soybean Breeding Lines under High Heat.

PubMed

Bellaloui, Nacer; Smith, James R; Mengistu, Alemu

2017-01-01

The timing of harvest is a major factor affecting seed quality in soybean, particularly in Midsouthern USA, when rain during harvest period is not uncommon. The objective of this research was to evaluate the effects of time of harvest on soybean seed quality (seed composition, germination, seed coat boron, and lignin) in high germinability (HG) breeding lines (50% exotic) developed under high heat. The hypothesis was that seeds of HG lines possess physiological and genetic traits for a better seed quality at harvest maturity and delayed harvest. A 2-year field experiment was conducted under irrigated conditions. Results showed that, at harvest maturity, the exotic HG lines had higher seed protein, oleic acid, sugars, seed coat boron, and seed coat lignin, but lower seed oil compared with the non-exotic checks (Control), confirming our hypothesis. At 28 days after harvest maturity (delayed harvest), the content of seed protein, oleic acid, sugars, seed coat boron, and seed coat lignin were higher in some of the HG lines compared with the checks, indicating a possible involvement of these seed constituents, especially seed coat boron and seed coat lignin, in maintaining seed coat integrity and protecting seed coat against physical damage. Highly significant positive correlations were found between germination and seed protein, oleic acid, sugars, and seed coat boron and seed coat lignin. Highly significant negative correlation was found between germination and oil, linoleic acid, seed coat wrinkling, shattering, and hard seed. Yields of some HG lines were competitive with checks. This research demonstrated that time of harvesting is an important factor influencing seed protein and oil production. Also, since high oleic acid is desirable for oxidative stability, shelf-life and biodiesel properties, using HG lines could positively influence these important traits. This result should suggest to breeders of some of the advantages of selecting for high seed coat boron and

Seed bank characteristics of the Nymphoides peltata population in Lake Taihu

NASA Astrophysics Data System (ADS)

Huang, Wei; Chen, Qiuwen; Chen, Kaining

2015-08-01

The Nymphoides peltata (N. peltata) population has shown rapid expansion in Lake Taihu, China, in recent years. The core question is whether N. peltata seeds have contributed to the expansion. To address this, we randomly selected three N. peltata stands to investigate the seed bank characteristics of N. peltata in Lake Taihu. Results showed that N. peltata had high seed production, with a maximum seed yield of 1763 seeds per m2. Density of intact and fragmented seeds decreased rapidly with sediment depth. Few intact or fragmented seeds were distributed at depths greater than 4 cm in the sediment. Spatial distribution of the seed bank indicated that most seeds sank to the sediment within the N. peltata stands, and few seeds took advantage of their floating ability. Seeds recovered from the sediment during April to June had a low germination rate, and no seeds germinated during October to April. Cold exposure treatment increased the germination rate remarkably. No seedlings were found in the field from January 2012 to December 2012, indicating that few seeds were successfully established in the surveyed area. The results suggested that sexual reproduction had little direct contribution to the N. peltata expansion in this large shallow lake.

Impact of Water Management on Efficacy of Insecticide Seed Treatments Against Rice Water Weevil (Coleoptera: Curculionidae) in Mississippi Rice

PubMed Central

Adams, A.; Gore, J.; Musser, F.; Cook, D.; Catchot, A.; Walker, T.; Awuni, G. A.

2015-01-01

Two experiments were conducted at the Delta Research and Extension Center in Stoneville, MS, during 2011 and 2012 to determine the impact of water management practices on the efficacy of insecticidal seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel. Larval densities and yield were compared for plots treated with labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin and an untreated control. In the first experiment, plots were subjected to flood initiated at 6 and 8 wk after planting. Seed treatments significantly reduced larval densities with the 8-wk flood timing, but not the 6-wk flood timing. Overall, the treated plots yielded higher than the control plots. In the second experiment, the impact of multiple flushes on the efficacy of insecticidal seed treatments was evaluated. Plots were subjected to zero, one, or two flushes with water. All seed treatments reduced larval densities compared with the untreated control. Significantly fewer larvae were observed in plots that received one or two flushes compared with plots that did not receive a flush. All seed treatments resulted in higher yields compared to the untreated control in the zero and one flush treatments. When two flushes were applied, yield from the thiamethoxam and clothianidin treated plots was not significantly different from those of the control plots, while the chlorantraniliprole treated plots yielded significantly higher than the control. These data suggest that time from planting to flood did not impact the efficacy of seed treatments, but multiple flushes reduced the efficacy of thiamethoxam and clothianidin. PMID:26470232

Seed population dynamics on abandoned slopes in the hill and gully Loess Plateau region of China

NASA Astrophysics Data System (ADS)

Yu, Weijie; Jiao, Juying

2017-04-01

Recovery of natural vegetation is an effective but slow approach to control the soil erosion in the Chinese hill and gully Loess Plateau region. As seed stage is particularly vulnerable to environmental conditions, characteristics of seed population should be needed to study for determining whether the recovery of natural vegetation is limited during this stage on the abandoned slopes in this region. The study was performed on three abandoned slopes in a watershed with an area of 8.27 km2in the Shaanxi province of China. The differences in soil seed banks were investigated in two different points in time, late March2011 and early April 2013. Main factors of seed population dynamics, such as seed yield of dominant species, seed inputs by seed rain as well as seed outputs through seed loss by overland flow and seedling emergence, were monitored from late March 2011 to early April 2013. In this study, seed rain densities of the main later successional species, i.e., Lespedeza davurica, Stipa bungeana and Artemisia gmelinii accounted for 51.5-71.6% of their own seed yields. The soil seed bank density in early April 2013 was larger than that in late March 2011. The density of seed inputs by seed rain was 10186 seeds•m-2, and the total seed bank, including seed rain and seeds present in the soil seed bank in late March 2011, reached a density of 15018 seeds•m-2 during the study period. Seed densities of loss due to overland flow and seedling emergence were 79 seeds•m-2 from 20 species and 938 seedlings•m-2 that belonged to 38 species during a study period, and the seed output through them accounted for 0.5% and 6.3% of the total seed bank, respectively. The study concluded that overland flow could not result in large numbers of seeds loss and seeds were accumulating in the soil seed bank due to seed rain, and vegetation succession might be limited by curbed spatial seed dispersal and seedling establishment.

Exploring the effects of cell seeding density on the differentiation of human pluripotent stem cells to brain microvascular endothelial cells.

PubMed

Wilson, Hannah K; Canfield, Scott G; Hjortness, Michael K; Palecek, Sean P; Shusta, Eric V

2015-05-21

Brain microvascular-like endothelial cells (BMECs) derived from human pluripotent stem cells (hPSCs) have significant promise as tools for drug screening and studying the structure and function of the BBB in health and disease. The density of hPSCs is a key factor in regulating cell fate and yield during differentiation. Prior reports of hPSC differentiation to BMECs have seeded hPSCs in aggregates, leading to non-uniform cell densities that may result in differentiation heterogeneity. Here we report a singularized-cell seeding approach compatible with hPSC-derived BMEC differentiation protocols and evaluate the effects of initial hPSC seeding density on the subsequent differentiation, yield, and blood-brain barrier (BBB) phenotype. A range of densities of hPSCs was seeded and differentiated, with the resultant endothelial cell yield quantified via VE-cadherin flow cytometry. Barrier phenotype of purified hPSC-derived BMECs was measured via transendothelial electrical resistance (TEER), and purification protocols were subsequently optimized to maximize TEER. Expression of characteristic vascular markers, tight junction proteins, and transporters was confirmed by immunocytochemistry and quantified by flow cytometry. P-glycoprotein and MRP-family transporter activity was assessed by intracellular accumulation assay. The initial hPSC seeding density of approximately 30,000 cells/cm(2) served to maximize the yield of VE-cadherin+ BMECs per input hPSC. BMECs displayed the highest TEER (>2,000 Ω × cm(2)) within this same range of initial seeding densities, although optimization of the BMEC purification method could minimize the seeding density dependence for some lines. Localization and expression levels of tight junction proteins as well as efflux transporter activity were largely independent of hPSC seeding density. Finally, the utility of the singularized-cell seeding approach was demonstrated by scaling the differentiation and purification process down from 6

Variability in seeds: biological, ecological, and agricultural implications.

PubMed

Mitchell, Jack; Johnston, Iain G; Bassel, George W

2017-02-01

Variability is observed in biology across multiple scales, ranging from populations, individuals, and cells to the molecular components within cells. This review explores the sources and roles of this variability across these scales, focusing on seeds. From a biological perspective, the role and the impact this variability has on seed behaviour and adaptation to the environment is discussed. The consequences of seed variability on agricultural production systems, which demand uniformity, are also examined. We suggest that by understanding the basis and underlying mechanisms of variability in seeds, strategies to increase seed population uniformity can be developed, leading to enhanced agricultural production across variable climatic conditions. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

[Analysis of essential oil extracted from Lactuca sativa seeds growing in Xinjiang by GC-MS].

PubMed

Xu, Fang; Wang, Qiang; Haji, Akber Aisa

2011-12-01

To analyze the components of essential oil from Lactuca sativa seeds growing in Xinjiang. The components of essential oil from Lactuca sativa seeds were analyzed by gas chromatography-mass spectrometry (GC-MS). 62 components were identified from 71 separated peaks,amounting to total mass fraction 95.07%. The dominant compounds were n-Hexanol (36.31%), n-Hexanal (13.71%), trans-2-Octen-l-ol (8.09%) and 2-n-Pentylfuran (4.41%). The research provides a theoretical basis for the exploitation and use of Lactuca sativa seeds resource.

Yield loss assessment due to Alternaria blight and its management in linseed.

PubMed

Singh, R B; Singh, H K; Parmar, Arpita

2014-04-01

Field experiments were conducted during 2010-11 and 2011-12 to assess the yield losses due to Alternaria blight disease caused by Alternaria lini and A. linicola in recently released cultivars and their management with the integration of Trichoderma viride, fungicides and plant extract. Disease severity on leaves varied from 41.07% (Parvati) to 65.01% (Chambal) while bud damage per cent ranged between 23.56% (Shekhar) to 46.12% (T-397), respectively in different cultivars. Maximum yield loss of 58.44% was recorded in cultivar Neelum followed by Parvati (55.56%), Meera (55.56%) and Chambal (51.72%), respectively while minimum loss was recorded in Kiran (19.99%) and Jeevan (22.22%). Minimum mean disease severity (19.47%) with maximum disease control (69.74%) was recorded with the treatment: seed treatment (ST) with vitavax power (2 g kg(-1) seed) + 2 foliar sprays (FS) of Saaf (a mixture of carbendazim+mancozeb) 0.2% followed by ST with Trichoderma viride (4g kg(-1) seed) + 2 FS of Saaf (0.2%). Minimum bud damage (13.75%) with maximum control (60.94%) was recorded with treatment of ST with vitavax power+2 FS of propiconazole (0.2%). Maximum mean seed yield (1440 kg ha(-1)) with maximum net return (Rs. 15352/ha) and benefit cost ratio (1:11.04) was obtained with treatment ST with vitavax power + 2 FS of Neem leaf extract followed by treatment ST with vitavax power+2 FS of Saaf (1378 kg ha(-1)).

Contagious Deposition of Seeds in Spider Monkeys' Sleeping Trees Limits Effective Seed Dispersal in Fragmented Landscapes

PubMed Central

González-Zamora, Arturo; Arroyo-Rodríguez, Víctor; Escobar, Federico; Rös, Matthias; Oyama, Ken; Ibarra-Manríquez, Guillermo; Stoner, Kathryn E.; Chapman, Colin A.

2014-01-01

The repeated use of sleeping sites by frugivorous vertebrates promotes the deposition and aggregation of copious amounts of seeds in these sites. This spatially contagious pattern of seed deposition has key implications for seed dispersal, particularly because such patterns can persist through recruitment. Assessing the seed rain patterns in sleeping sites thus represents a fundamental step in understanding the spatial structure and regeneration of plant assemblages. We evaluated the seed rain produced by spider monkeys (Ateles geoffroyi) in latrines located beneath 60 sleeping trees in two continuous forest sites (CFS) and three forest fragments (FF) in the Lacandona rainforest, Mexico. We tested for differences among latrines, among sites, and between forest conditions in the abundance, diversity (α-, β- and, γ-components) and evenness of seed assemblages. We recorded 45,919 seeds ≥5 mm (in length) from 68 species. The abundance of seeds was 1.7 times higher in FF than in CFS, particularly because of the dominance of a few plant species. As a consequence, community evenness tended to be lower within FF. β-diversity of common and dominant species was two times greater among FF than between CFS. Although mean α-diversity per latrine did not differ among sites, the greater β-diversity among latrines in CFS increased γ-diversity in these sites, particularly when considering common and dominant species. Our results support the hypothesis that fruit scarcity in FF can ‘force’ spider monkeys to deplete the available fruit patches more intensively than in CFS. This feeding strategy can limit the effectiveness of spider monkeys as seed dispersers in FF, because (i) it can limit the number of seed dispersers visiting such fruit patches; (ii) it increases seed dispersal limitation; and (iii) it can contribute to the floristic homogenization (i.e., reduced β-diversity among latrines) in fragmented landscapes. PMID:24586705

The Source of the PB1 Gene in Influenza Vaccine Reassortants Selectively Alters the Hemagglutinin Content of the Resulting Seed Virus

PubMed Central

Cobbin, Joanna C. A.; Verity, Erin E.; Gilbertson, Brad P.; Rockman, Steven P.

2013-01-01

The yields of egg-grown influenza vaccines are maximized by the production of a seed strain using a reassortment of the seasonal influenza virus isolate with a highly egg-adapted strain. The seed virus is selected based on high yields of viral hemagglutinin (HA) and expression of the surface antigens from the seasonal isolate. The remaining proteins are usually derived from the high-growth parent. However, a retrospective analysis of vaccine seeds revealed that the seasonal PB1 gene was selected in more than 50% of reassortment events. Using the model seasonal H3N2 virus A/Udorn/307/72 (Udorn) virus and the high-growth A/Puerto Rico/8/34 (PR8) virus, we assessed the influence of the source of the PB1 gene on virus growth and vaccine yield. Classical reassortment of these two strains led to the selection of viruses that predominantly had the Udorn PB1 gene. The presence of Udorn PB1 in the seed virus, however, did not result in higher yields of virus or HA compared to the yields in the corresponding seed virus with PR8 PB1. The 8-fold-fewer virions produced with the seed virus containing the Udorn PB1 were somewhat compensated for by a 4-fold increase in HA per virion. A higher HA/nucleoprotein (NP) ratio was found in past vaccine preparations when the seasonal PB1 was present, also indicative of a higher HA density in these vaccine viruses. As the HA viral RNA (vRNA) and mRNA levels in infected cells were similar, we propose that PB1 selectively alters the translation of viral mRNA. This study helps to explain the variability of vaccine seeds with respect to HA yield. PMID:23468502

Screening of polysaccharides from tamarind, fenugreek and jackfruit seeds as pharmaceutical excipients.

PubMed

Nayak, Amit Kumar; Pal, Dilipkumar; Santra, Kousik

2015-08-01

The paper describes the isolation and screening of plant polysaccharides namely tamarind seed polysaccharide (TSP), fenugreek seed mucilage (FSM) and jackfruit seed starch (JFSS) from tamarind (Tamarindus indica L.) seeds, fenugreek (Trigonella foenum-graecum L.) seeds and jackfruit (Artocarpus heterophyllus L.) seeds, respectively. The yields of isolated dried TSP, FSM and JFSS were 47.00%, 17.36% and 18.86%, respectively. Various physicochemical properties like colour, odour, taste, solubility in water, pH and viscosity of these isolated plant polysaccharides were assessed. Isolated polysaccharide samples were subjected to some phytochemical identification tests. FTIR and (1)H NMR analyses of isolated polysaccharides were performed, which suggest the presence of sugar residues. Isolated TSP, FSM and JFSS can be used as pharmaceutical excipients in various pharmaceutical formulations. Copyright © 2015 Elsevier B.V. All rights reserved.

Production of high levels of poly-3-hydroxybutyrate in plastids of Camelina sativa seeds.

PubMed

Malik, Meghna R; Yang, Wenyu; Patterson, Nii; Tang, Jihong; Wellinghoff, Rachel L; Preuss, Mary L; Burkitt, Claire; Sharma, Nirmala; Ji, Yuanyuan; Jez, Joseph M; Peoples, Oliver P; Jaworski, Jan G; Cahoon, Edgar B; Snell, Kristi D

2015-06-01

Poly-3-hydroxybutyrate (PHB) production in plastids of Camelina sativa seeds was investigated by comparing levels of polymer produced upon transformation of plants with five different binary vectors containing combinations of five seed-specific promoters for expression of transgenes. Genes encoding PHB biosynthetic enzymes were modified at the N-terminus to encode a plastid targeting signal. PHB levels of up to 15% of the mature seed weight were measured in single sacrificed T1 seeds with a genetic construct containing the oleosin and glycinin promoters. A more detailed analysis of the PHB production potential of two of the best performing binary vectors in a Camelina line bred for larger seed size yielded lines containing up to 15% polymer in mature T2 seeds. Transmission electron microscopy showed the presence of distinct granules of PHB in the seeds. PHB production had varying effects on germination, emergence and survival of seedlings. Once true leaves formed, plants grew normally and were able to set seeds. PHB synthesis lowered the total oil but not the protein content of engineered seeds. A change in the oil fatty acid profile was also observed. High molecular weight polymer was produced with weight-averaged molecular weights varying between 600 000 and 1 500 000, depending on the line. Select lines were advanced to later generations yielding a line with 13.7% PHB in T4 seeds. The levels of polymer produced in this study are the highest reported to date in a seed and are an important step forward for commercializing an oilseed-based platform for PHB production. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Effects of stage of pregnancy on variance components, daily milk yields and 305-day milk yield in Holstein cows, as estimated by using a test-day model.

PubMed

Yamazaki, T; Hagiya, K; Takeda, H; Osawa, T; Yamaguchi, S; Nagamine, Y

2016-08-01

Pregnancy and calving are elements indispensable for dairy production, but the daily milk yield of cows decline as pregnancy progresses, especially during the late stages. Therefore, the effect of stage of pregnancy on daily milk yield must be clarified to accurately estimate the breeding values and lifetime productivity of cows. To improve the genetic evaluation model for daily milk yield and determine the effect of the timing of pregnancy on productivity, we used a test-day model to assess the effects of stage of pregnancy on variance component estimates, daily milk yields and 305-day milk yield during the first three lactations of Holstein cows. Data were 10 646 333 test-day records for the first lactation; 8 222 661 records for the second; and 5 513 039 records for the third. The data were analyzed within each lactation by using three single-trait random regression animal models: one model that did not account for the stage of pregnancy effect and two models that did. The effect of stage of pregnancy on test-day milk yield was included in the model by applying a regression on days pregnant or fitting a separate lactation curve for each days open (days from calving to pregnancy) class (eight levels). Stage of pregnancy did not affect the heritability estimates of daily milk yield, although the additive genetic and permanent environmental variances in late lactation were decreased by accounting for the stage of pregnancy effect. The effects of days pregnant on daily milk yield during late lactation were larger in the second and third lactations than in the first lactation. The rates of reduction of the 305-day milk yield of cows that conceived fewer than 90 days after the second or third calving were significantly (P<0.05) greater than that after the first calving. Therefore, we conclude that differences between the negative effects of early pregnancy in the first, compared with later, lactations should be included when determining the optimal number of days open

Non-Destructive Quality Evaluation of Pepper (Capsicum annuum L.) Seeds Using LED-Induced Hyperspectral Reflectance Imaging

PubMed Central

Mo, Changyeun; Kim, Giyoung; Lee, Kangjin; Kim, Moon S.; Cho, Byoung-Kwan; Lim, Jongguk; Kang, Sukwon

2014-01-01

In this study, we developed a viability evaluation method for pepper (Capsicum annuum L.) seeds based on hyperspectral reflectance imaging. The reflectance spectra of pepper seeds in the 400–700 nm range are collected from hyperspectral reflectance images obtained using blue, green, and red LED illumination. A partial least squares–discriminant analysis (PLS-DA) model is developed to classify viable and non-viable seeds. Four spectral ranges generated with four types of LEDs (blue, green, red, and RGB), which were pretreated using various methods, are investigated to develop the classification models. The optimal PLS-DA model based on the standard normal variate for RGB LED illumination (400–700 nm) yields discrimination accuracies of 96.7% and 99.4% for viable seeds and nonviable seeds, respectively. The use of images based on the PLS-DA model with the first-order derivative of a 31.5-nm gap for red LED illumination (600–700 nm) yields 100% discrimination accuracy for both viable and nonviable seeds. The results indicate that a hyperspectral imaging technique based on LED light can be potentially applied to high-quality pepper seed sorting. PMID:24763251

Non-destructive quality evaluation of pepper (Capsicum annuum L.) seeds using LED-induced hyperspectral reflectance imaging.

PubMed

Mo, Changyeun; Kim, Giyoung; Lee, Kangjin; Kim, Moon S; Cho, Byoung-Kwan; Lim, Jongguk; Kang, Sukwon

2014-04-24

In this study, we developed a viability evaluation method for pepper (Capsicum annuum L.) seeds based on hyperspectral reflectance imaging. The reflectance spectra of pepper seeds in the 400-700 nm range are collected from hyperspectral reflectance images obtained using blue, green, and red LED illumination. A partial least squares-discriminant analysis (PLS-DA) model is developed to classify viable and non-viable seeds. Four spectral ranges generated with four types of LEDs (blue, green, red, and RGB), which were pretreated using various methods, are investigated to develop the classification models. The optimal PLS-DA model based on the standard normal variate for RGB LED illumination (400-700 nm) yields discrimination accuracies of 96.7% and 99.4% for viable seeds and nonviable seeds, respectively. The use of images based on the PLS-DA model with the first-order derivative of a 31.5-nm gap for red LED illumination (600-700 nm) yields 100% discrimination accuracy for both viable and nonviable seeds. The results indicate that a hyperspectral imaging technique based on LED light can be potentially applied to high-quality pepper seed sorting.

Tree seed rain and seed removal, but not the seed bank, impede forest recovery in bracken (Pteridium aquilinum (L.) Kuhn)-dominated clearings in the African highlands.

PubMed

Ssali, Fredrick; Moe, Stein R; Sheil, Douglas

2018-04-01

Considerable areas dominated by bracken Pteridium aquilinum (L.) Kuhn occur worldwide and are associated with arrested forest recovery. How forest recovery is impeded in these areas remains poorly understood, especially in the African highlands. The component processes that can lead to recruitment limitation-including low seed arrival, availability and persistence-are important determinants of plant communities and offer a potential explanation for bracken persistence. We investigated key processes that can contribute to recruitment limitation in bracken-dominated clearings in the Bwindi Impenetrable National Park, Uganda. We examined if differences in seed rain (dispersal limitation), soil seed bank, or seed removal (seed viability and persistence) can, individually or in combination, explain the differences in tree regeneration found between bracken-dominated areas and the neighboring forest. These processes were assessed along ten 50-m transects crossing the forest-bracken boundary. When compared to the neighboring forest, bracken clearings had fewer seedlings (bracken 11,557 ± 5482 vs. forest 34,515 ± 6066 seedlings/ha), lower seed rain (949 ± 582 vs. 1605 ± 335 tree seeds m -2  year -1 ), comparable but sparse soil seed bank (304 ± 236 vs. 264 ± 99 viable tree seeds/m 2 ), higher seed removal (70.1% ± 2.4% vs. 40.6% ± 2.4% over a 3-day interval), and markedly higher rodent densities (25.7 ± 5.4 vs. 5.0 ± 1.6 rodents per 100 trapping sessions). Camera traps revealed that rodents were the dominant animals visiting the seeds in our seed removal study. Synthesis : Recruitment limitation contributes to both the slow recovery of forest in bracken-dominated areas, and to the composition of the tree species that occur. Low seed arrival and low persistence of unburied seeds can both explain the reduced density of seedlings found in bracken versus neighboring forest. Seed removal, likely due to rodents, in particular appears sufficient to

Perfusion seed cultures improve biopharmaceutical fed-batch production capacity and product quality.

PubMed

Yang, William C; Lu, Jiuyi; Kwiatkowski, Chris; Yuan, Hang; Kshirsagar, Rashmi; Ryll, Thomas; Huang, Yao-Ming

2014-01-01

Volumetric productivity and product quality are two key performance indicators for any biopharmaceutical cell culture process. In this work, we showed proof-of-concept for improving both through the use of alternating tangential flow perfusion seed cultures coupled with high-seed fed-batch production cultures. First, we optimized the perfusion N-1 stage, the seed train bioreactor stage immediately prior to the production bioreactor stage, to minimize the consumption of perfusion media for one CHO cell line and then successfully applied the optimized perfusion process to a different CHO cell line. Exponential growth was observed throughout the N-1 duration, reaching >40 × 10(6) vc/mL at the end of the perfusion N-1 stage. The cultures were subsequently split into high-seed (10 × 10(6) vc/mL) fed-batch production cultures. This strategy significantly shortened the culture duration. The high-seed fed-batch production processes for cell lines A and B reached 5 g/L titer in 12 days, while their respective low-seed processes reached the same titer in 17 days. The shortened production culture duration potentially generates a 30% increase in manufacturing capacity while yielding comparable product quality. When perfusion N-1 and high-seed fed-batch production were applied to cell line C, higher levels of the active protein were obtained, compared to the low-seed process. This, combined with correspondingly lower levels of the inactive species, can enhance the overall process yield for the active species. Using three different CHO cell lines, we showed that perfusion seed cultures can optimize capacity utilization and improve process efficiency by increasing volumetric productivity while maintaining or improving product quality. © 2014 American Institute of Chemical Engineers.

Crotonic acid as a bioactive factor in carrot seeds (Daucus carota L.).

PubMed

Jasicka-Misiak, Izabela; Wieczorek, Piotr P; Kafarski, Paweł

2005-06-01

Water extracts from the carrot seed (Daucus carota L.) var. Perfekcja exhibit plant growth inhibitory properties against cress, cucumber, onion and carrot in a dose-dependant manner. This property results from the action of low-and high-molecular components of the extract. The low-molecular component was identified as crotonic acid ((E)-2-butenoic acid). Its presence was also confirmed in other late varieties of carrot. The determined strong herbicidal properties of crotonic acid and its availability after release to soil combined with its high level in seeds suggest that it might be considered as an allelopathic and autotoxic factor in the seeds.

Extra soil fertilization of mother plants increases botanical seed yield but not long-term germination in wild Solanum (potato) species

USDA-ARS?s Scientific Manuscript database

Potato has about 100 wild species relatives that are multiplied in the form of botanical seed populations by genebanks, and distributed for use in research and breeding, so factors that affect long term seed germination are of interest. In 1987 the US Potato Genebank conducted routine seed multiplic...

A transgene design for enhancing oil content in Arabidopsis and Camelina seeds

DOE PAGES

Zhu, Yerong; Xie, Linan; Chen, Grace Q.; ...

2018-02-21

Background: Increasing the oil yield is a major objective for oilseed crop improvement. Oil biosynthesis and accumulation are influenced by multiple genes involved in embryo and seed development. The leafy cotyledon1 (LEC1) is a master regulator of embryo development that also enhances the expression of genes involved in fatty acid biosynthesis. We speculated that seed oil could be increased by targeted overexpression of a master regulating transcription factor for oil biosynthesis, using a downstream promoter for a gene in the oil biosynthesis pathway. To verify the effect of such a combination on seed oil content, we made constructs with maizemore » (Zea mays) ZmLEC1 driven by serine carboxypeptidase-like (SCPL17) and acyl carrier protein (ACP5) promoters, respectively, for expression in transgenic Arabidopsis thaliana and Camelina sativa. Results: Agrobacterium-mediated transformation successfully generated Arabidopsis and Camelina lines that overexpressed ZmLEC1 under the control of a seed-specific promoter. This overexpression does not appear to be detrimental to seed vigor under laboratory conditions and did not cause observable abnormal growth phenotypes throughout the life cycle of the plants. Overexpression of ZmLEC1 increased the oil content in mature seeds by more than 20% in Arabidopsis and 26% in Camelina. In conclusion: The findings suggested that the maize master regulator, ZmLEC1, driven by a downstream seed-specific promoter, can be used to increase oil production in Arabidopsis and Camelina and might be a promising target for increasing oil yield in oilseed crops.0« less

A transgene design for enhancing oil content in Arabidopsis and Camelina seeds

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhu, Yerong; Xie, Linan; Chen, Grace Q.

Background: Increasing the oil yield is a major objective for oilseed crop improvement. Oil biosynthesis and accumulation are influenced by multiple genes involved in embryo and seed development. The leafy cotyledon1 (LEC1) is a master regulator of embryo development that also enhances the expression of genes involved in fatty acid biosynthesis. We speculated that seed oil could be increased by targeted overexpression of a master regulating transcription factor for oil biosynthesis, using a downstream promoter for a gene in the oil biosynthesis pathway. To verify the effect of such a combination on seed oil content, we made constructs with maizemore » (Zea mays) ZmLEC1 driven by serine carboxypeptidase-like (SCPL17) and acyl carrier protein (ACP5) promoters, respectively, for expression in transgenic Arabidopsis thaliana and Camelina sativa. Results: Agrobacterium-mediated transformation successfully generated Arabidopsis and Camelina lines that overexpressed ZmLEC1 under the control of a seed-specific promoter. This overexpression does not appear to be detrimental to seed vigor under laboratory conditions and did not cause observable abnormal growth phenotypes throughout the life cycle of the plants. Overexpression of ZmLEC1 increased the oil content in mature seeds by more than 20% in Arabidopsis and 26% in Camelina. In conclusion: The findings suggested that the maize master regulator, ZmLEC1, driven by a downstream seed-specific promoter, can be used to increase oil production in Arabidopsis and Camelina and might be a promising target for increasing oil yield in oilseed crops.0« less

Release of Esterase Following Germination of Lettuce Seed (Lactuca sativa L.)

PubMed Central

Chandra, G. Ram; Toole, Vivian K.

1977-01-01

Light-insensitive lettuce seeds, Lactuca sativa L. cv. Great Lakes, release esterases for a period following radicle protrusion. Very little or no enzymes are released prior to 24 hours or after 48 hours of germination. As compared to intact seeds, half-seeds readily release esterases and the release is not affected by far red irradiation. Bulk of the released esterases are derived from the endosperm tissue and presumably exists in the intact seed as a component of the extraembryonic fluid. PMID:16659992

Nutritional quality and essential oil compositions of Thaumatococcus danielli (Benn.) tissue and seed.

PubMed

Abiodun, O A; Akinoso, R; Olosunde, O O; Adegbite, J A; Omolola, O A

2014-10-01

Nutritional quality and essential oil compositions of Thaumatococcus danielli (Benn.) tissue and seed were determined. Oil was extracted from the seed using standard methods while the fatty acids of the oil, chemical and anti-nutritional properties of defatted seed flour were determined. Total fat yield of the seed flour was 12.20%. Defatted seed flour had higher crude fibre (36.92%), carbohydrate (40.07%) and ash (8.17%) contents. Major mineral contents were potassium, calcium, sodium and magnesium. The tissue contain appreciable amount of vitamin C (8.10 mg/100 g). Oleic acid (42.59%) was the major fatty acid in the seed oil and the total unsaturated fatty acid was 62.38%. The seed oil had higher acid and saponification values and low iodine value. Oxalate (11.09 mg/100 g) content was the major anti-nutrient in the defatted seed flour. Defatted T. danielli seed flour serves as good source of dietary fibre and energy. Copyright © 2014 Elsevier Ltd. All rights reserved.

Aplication of giberelins on flowering and yield of two varieties of shallot in lowland

NASA Astrophysics Data System (ADS)

Triharyanto, E.; Nyoto, S.; Yusrifani, I.

2018-03-01

Shallot is one of horticultural commodities which has difficulties in flowering and producing seeds. Flowering of shallot generally occurs in highlands at 9-12° C. Flowering in lowland can be supported with vernalization or replace cold temperature with gibberelin (GA3). This research is aimed to determine the effect of varieties, the concentration of GA3 applied and their interaction on flowering and yield of shallots grown in the lowlands, 98 m altitude with Vertisol-type soil. The research was conducted in a randomized complete block design (RCBD) with two factors, which were varieties (V): Bima and Mentes and concentration of GA3 (C) 0 ppm, 50 ppm, 100 ppm, 150 ppm and 200 ppm and repeated three times. Varieties have significant effect (P<0.05) on plant height, leaf number, the number of bulbs per clumps, weight of fresh bulbs per clumps, and percentage of small and large bulbs produced. Bima varieties were able to flower and produced seeds, while Mentes varieties could not produce flowers and seeds. GA3 concentration have no significant effect in all of the observed component. GA3 can’t replace cold temperature for supported flowering in varieties Mentes which were planted in lowlands. There was interaction between varieties and GA3 concentration occurs in variable percentage of small and large bulbs.

Phenotypic Stability of Zea mays Grain Yield and Its Attributing Traits under Drought Stress

PubMed Central

Ali, Fawad; Ahsan, Muhammad; Ali, Qurban; Kanwal, Naila

2017-01-01

Phenotypic stability under stress environment facilitate the fitness of genotype and opens new horizons to explore the cryptic genetic variation. Variation in tolerance to drought stress, a major grain yield constraint to global maize production, was identified, at the phenotypic and genotypic level. Here we found a prominent hybrid H9 that showed fitness over four growing seasons for grain yield under water stress conditions. Genotypic and phenotypic correlation of yield attributing traits over four seasons demonstrated that cobs per plant, 100 seed weight, number of grains rows per cob, total dry matter, cob diameter had positive association (r2 = 0.3–0.9) to grain yield. The perturbation was found for chlorophyll content as it showed moderate to strong association (P < 0.01) over four seasons, might be due to environment or genotype dependent. Highest heritability (95%) and genetic advance (79%) for grain yield was found in H9 over four consecutive crop growing seasons. Combined analysis over four seasons showed that studied variables together explained 85% of total variation in dependent structure (grain yield) obtained by Principal component analysis. This significant finding is the best example of phenotypic stability of grain yield in H9 and made it best fitted for grain yield under drought stress scenario. Detailed genetic analysis of H9 will help us to identify significant loci and alleles that made H9 the best fitted and it could serve as a potential source to generate novel transgressive levels of tolerance for drought stress in arid/semiarid regions. PMID:28878785

Phenotypic Stability of Zea mays Grain Yield and Its Attributing Traits under Drought Stress.

PubMed

Ali, Fawad; Ahsan, Muhammad; Ali, Qurban; Kanwal, Naila

2017-01-01

Phenotypic stability under stress environment facilitate the fitness of genotype and opens new horizons to explore the cryptic genetic variation. Variation in tolerance to drought stress, a major grain yield constraint to global maize production, was identified, at the phenotypic and genotypic level. Here we found a prominent hybrid H 9 that showed fitness over four growing seasons for grain yield under water stress conditions. Genotypic and phenotypic correlation of yield attributing traits over four seasons demonstrated that cobs per plant, 100 seed weight, number of grains rows per cob, total dry matter, cob diameter had positive association ( r 2 = 0.3-0.9) to grain yield. The perturbation was found for chlorophyll content as it showed moderate to strong association ( P < 0.01) over four seasons, might be due to environment or genotype dependent. Highest heritability (95%) and genetic advance (79%) for grain yield was found in H 9 over four consecutive crop growing seasons. Combined analysis over four seasons showed that studied variables together explained 85% of total variation in dependent structure (grain yield) obtained by Principal component analysis. This significant finding is the best example of phenotypic stability of grain yield in H 9 and made it best fitted for grain yield under drought stress scenario. Detailed genetic analysis of H 9 will help us to identify significant loci and alleles that made H 9 the best fitted and it could serve as a potential source to generate novel transgressive levels of tolerance for drought stress in arid/semiarid regions.

Effect of ground poppy seed as a fat replacer on meat burgers.

PubMed

Gök, Veli; Akkaya, Levent; Obuz, Ersel; Bulut, Sait

2011-12-01

Poppy seed paste was used in koefte production as an animal fat replacer and efficacy of using poppy seed was investigated. The use of ground poppy seed in formulation of meat burgers had no effect on the moisture content of uncooked meat burgers; however, it did have a significant effect (p<0.05) on the fat content of meat burgers. Ground poppy seed addition significantly affected (p<0.05) cooking yield, moisture retention, and fat retention of meat burgers. Ground poppy seed addition significantly decreased (p<0.05) saturated fatty acid contents as the amount of ground poppy seed increased in meat burgers. A strong significant decrease (p<0.05) on the cholesterol content of meat burgers with ground poppy seed addition was observed. Samples having 20% ground poppy seed had significantly better texture and juiciness score (p<0.05) than any other sample which could be explained by increased moisture retention. Replacing animal fat with ground poppy seed paste is effective and may pave the way for an innovative meat product. Copyright © 2011 Elsevier Ltd. All rights reserved.

Preinoculation of Soybean Seeds Treated with Agrichemicals up to 30 Days before Sowing: Technological Innovation for Large-Scale Agriculture

PubMed Central

da Cruz, Sonia Purin; Martin, Thomas Newton; Nakatani, André Shigueyoshi; Nogueira, Marco Antonio; Hungria, Mariangela

2017-01-01

The cultivation of soybean in Brazil experienced an expressive growth in the last decades. Soybean is highly demanding on nitrogen (N) that must come from fertilizers or from biological fixation. The N supply to the soybean crop in Brazil relies on the inoculation with elite strains of Bradyrhizobium japonicum, B. elkanii, and B. diazoefficiens, which are able to fulfill the crop's N requirements and enrich the soil for the following crop. The effectiveness of the association between N2-fixing bacteria and soybean plants depends on the efficacy of the inoculation process. Seed treatment with pesticides, especially fungicides or micronutrients, may rapidly kill the inoculated bacteria, affecting the establishment and outcome of the symbiosis. The development of technologies that allow inoculation to become a successful component of industrial seed treatment represents a valuable tool for the seed industry, as well as for the soybean crop worldwide. In this article, we report the results of new technologies, developed by the company Total Biotecnologia Indústria e Comércio S/A of Brazil, for preinoculation of soybean seeds with bradyrhizobia, in the presence of agrichemicals. Our results demonstrate improved bacterial survival for up to 30 days after inoculation, without compromising nodulation, N2-fixation, and yield in the field. PMID:29129977

Preinoculation of Soybean Seeds Treated with Agrichemicals up to 30 Days before Sowing: Technological Innovation for Large-Scale Agriculture.

PubMed

Araujo, Ricardo Silva; da Cruz, Sonia Purin; Souchie, Edson Luiz; Martin, Thomas Newton; Nakatani, André Shigueyoshi; Nogueira, Marco Antonio; Hungria, Mariangela

2017-01-01

The cultivation of soybean in Brazil experienced an expressive growth in the last decades. Soybean is highly demanding on nitrogen (N) that must come from fertilizers or from biological fixation. The N supply to the soybean crop in Brazil relies on the inoculation with elite strains of Bradyrhizobium japonicum, B. elkanii, and B. diazoefficiens , which are able to fulfill the crop's N requirements and enrich the soil for the following crop. The effectiveness of the association between N 2 -fixing bacteria and soybean plants depends on the efficacy of the inoculation process. Seed treatment with pesticides, especially fungicides or micronutrients, may rapidly kill the inoculated bacteria, affecting the establishment and outcome of the symbiosis. The development of technologies that allow inoculation to become a successful component of industrial seed treatment represents a valuable tool for the seed industry, as well as for the soybean crop worldwide. In this article, we report the results of new technologies, developed by the company Total Biotecnologia Indústria e Comércio S/A of Brazil, for preinoculation of soybean seeds with bradyrhizobia, in the presence of agrichemicals. Our results demonstrate improved bacterial survival for up to 30 days after inoculation, without compromising nodulation, N 2 -fixation, and yield in the field.

Identification of quantitative trait loci for yield and yield components in an advanced backcross population derived from the Oryza sativa variety IR64 and the wild relative O. rufipogon.

PubMed

Septiningsih, E M; Prasetiyono, J; Lubis, E; Tai, T H; Tjubaryat, T; Moeljopawiro, S; McCouch, S R

2003-11-01

A BC(2)F(2) population developed from an interspecific cross between Oryza sativa (cv IR64) and O. rufipogon (IRGC 105491) was used in an advanced backcross QTL analysis to identify and introduce agronomically useful genes from this wild relative into the cultivated gene pool. The objectives of this study were: (1) to identify putative yield and yield component QTLs that can be useful to improve the elite cultivar IR64; (2) to compare the QTLs within this study with previously reported QTLs in rice as the basis for identifying QTLs that are stable across different environments and genetic backgrounds; and (3) to compare the identified QTLs with previously reported QTLs from maize to examine the degree of QTL conservation across the grass family. Two hundred eighty-five families were evaluated in two field environments in Indonesia, with two replications each, for 12 agronomic traits. A total of 165 markers consisting of 131 SSRs and 34 RFLPs were used to construct the genetic linkage map. By employing interval mapping and composite interval mapping, 42 QTLs were identified. Despite its inferior performance, 33% of the QTL alleles originating from O. rufipogon had a beneficial effect for yield and yield components in the IR64 background. Twenty-two QTLs (53.4%) were located in similar regions as previously reported rice QTLs, suggesting the existence of stable QTLs across genetic backgrounds and environments. Twenty QTLs (47.6%) were exclusively detected in this study, uncovering potentially novel alleles from the wild, some of which might improve the performance of the tropical indica variety IR64. Additionally, several QTLs for plant height, grain weight, and flowering time detected in this study corresponded to homeologous regions in maize containing previously detected maize QTLs for these traits.

Antifungal activities of ethanolic extract from Jatropha curcas seed cake.

PubMed

Saetae, Dolaporn; Suntornsuk, Worapot

2010-02-01

Phorbol ester extraction was carried out from Jatropha curcas seed cake, a by-product from the bio-diesel fuel industry. Four repeated extractions from 5 g J. curcas seed cake using 15 ml of 90% (v/v) ethanol and a shaking speed of 150 rev/min gave the highest yield of phosbol esters. The ethanolic extract of J. curcas seed cake showed antifungal activities against important phytofungal pathogens: Fusarium oxysporum, Pythium aphanidermatum, Lasiodiplodia theobromae, Curvularia lunata, Fusarium semitectum, Colletotrichum capsici and Colletotrichum gloeosporiodes. The extract contained phorbol esters mainly responsible for antifungal activities. The extract could therefore be used as an antifungal agent for agricultural applications.

Yield and financial performance estimates of four elite loblolly pine seed sources planted in the Western Gulf Region

Treesearch

Michael A. Blazier; A. Gordon Holley

2015-01-01

Eastern seed sources of loblolly pine (Pinus taeda L.) have been planted in the Western Gulf region for nearly three decades because they often have higher growth rates than local seed sources. However, productivity gains for eastern families are sometimes offset by poorer survival rates relative to local families.

CLUSTERED PRIMARY BRANCH 1, a new allele of DWARF11, controls panicle architecture and seed size in rice.

PubMed

Wu, Yongzhen; Fu, Yongcai; Zhao, Shuangshuang; Gu, Ping; Zhu, Zuofeng; Sun, Chuanqing; Tan, Lubin

2016-01-01

Panicle architecture and seed size are important agronomic traits that directly determine grain yield in rice (Oryza sativa L.). Although a number of key genes controlling panicle architecture and seed size have been cloned and characterized in recent years, their genetic and molecular mechanisms remain unclear. In this study, we identified a mutant that produced panicles with fascicled primary branching and reduced seeds in size. We isolated the underlying CLUSTERED PRIMARY BRANCH 1 (CPB1) gene, a new allele of DWARF11 (D11) encoding a cytochrome P450 protein involved in brassinosteroid (BR) biosynthesis pathway. Genetic transformation experiments confirmed that a His360Leu amino acid substitution residing in the highly conserved region of CPB1/D11 was responsible for the panicle architecture and seed size changes in the cpb1 mutants. Overexpression of CPB1/D11 under the background of cpb1 mutant not only rescued normal panicle architecture and plant height, but also had a larger leaf angle and seed size than the controls. Furthermore, the CPB1/D11 transgenic plants driven by panicle-specific promoters can enlarge seed size and enhance grain yield without affecting other favourable agronomic traits. These results demonstrated that the specific mutation in CPB1/D11 influenced development of panicle architecture and seed size, and manipulation of CPB1/D11 expression using the panicle-specific promoter could be used to increase seed size, leading to grain yield improvement in rice. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Yield responses of wild C3 and C4 crop progenitors to subambient CO2 : a test for the role of CO2 limitation in the origin of agriculture.

PubMed

Cunniff, Jennifer; Jones, Glynis; Charles, Michael; Osborne, Colin P

2017-01-01

Limitation of plant productivity by the low partial pressure of atmospheric CO 2 (C a ) experienced during the last glacial period is hypothesized to have been an important constraint on the origins of agriculture. In support of this hypothesis, previous work has shown that glacial C a limits vegetative growth in the wild progenitors of both C 3 and C 4 founder crops. Here, we present data showing that glacial C a also reduces grain yield in both crop types. We grew four wild progenitors of C 3 (einkorn wheat and barley) and C 4 crops (foxtail and broomcorn millets) at glacial and postglacial C a , measuring grain yield and the morphological and physiological components contributing to these yield changes. The C 3 species showed a significant increase in unthreshed grain yield of ~50% with the glacial to postglacial increase in C a , which matched the stimulation of photosynthesis, suggesting that increases in photosynthesis are directly translated into yield at subambient levels of C a . Increased yield was controlled by a higher rate of tillering, leading to a larger number of tillers bearing fertile spikes, and increases in seed number and size. The C 4 species showed smaller, but significant, increases in grain yield of 10-15%, arising from larger seed numbers and sizes. Photosynthesis was enhanced by C a in only one C 4 species and the effect diminished during development, suggesting that an indirect mechanism mediated by plant water relations could also be playing a role in the yield increase. Interestingly, the C 4 species at glacial C a showed some evidence that photosynthetic capacity was upregulated to enhance carbon capture. Development under glacial C a also impacted negatively on the subsequent germination and viability of seeds. These results suggest that the grain production of both C 3 and C 4 crop progenitors was limited by the atmospheric conditions of the last glacial period, with important implications for the origins of agriculture. © 2016

Seed maturation associated transcriptional programs and regulatory networks underlying genotypic difference in seed dormancy and size/weight in wheat (Triticum aestivum L.).

PubMed

Yamasaki, Yuji; Gao, Feng; Jordan, Mark C; Ayele, Belay T

2017-09-16

for enhancing seed yield and quality.

Seed Transmission of Soybean vein necrosis virus: The First Tospovirus Implicated in Seed Transmission.

PubMed

Groves, Carol; German, Thomas; Dasgupta, Ranjit; Mueller, Daren; Smith, Damon L

2016-01-01

Soybean vein necrosis virus (SVNV; genus Tospovirus; Family Bunyaviridae) is a negative-sense single-stranded RNA virus that has been detected across the United States and in Ontario, Canada. In 2013, a seed lot of a commercial soybean variety (Glycine max) with a high percentage of discolored, deformed and undersized seed was obtained. A random sample of this seed was planted in a growth room under standard conditions. Germination was greater than 90% and the resulting seedlings looked normal. Four composite samples of six plants each were tested by reverse transcription polymerase chain reaction (RT-PCR) using published primers complimentary to the S genomic segment of SVNV. Two composite leaflet samples retrieved from seedlings yielded amplicons with a size and sequence predictive of SVNV. Additional testing of twelve arbitrarily selected individual plants resulted in the identification of two SVNV positive plants. Experiments were repeated by growing seedlings from the same seed lot in an isolated room inside a thrips-proof cage to further eliminate any external source of infection. Also, increased care was taken to reduce any possible PCR contamination. Three positive plants out of forty-eight were found using these measures. Published and newly designed primers for the L and M RNAs of SVNV were also used to test the extracted RNA and strengthen the diagnosis of viral infection. In experiments, by three scientists, in two different labs all three genomic RNAs of SVNV were amplified in these plant materials. RNA-seq analysis was also conducted using RNA extracted from a composite seedling sample found to be SVNV-positive and a symptomatic sample collected from the field. This analysis revealed both sense and anti-sense reads from all three gene segments in both samples. We have shown that SVNV can be transmitted in seed to seedlings from an infected seed lot at a rate of 6%. To our knowledge this is the first report of seed-transmission of a Tospovirus.

Brassinosteroid Regulates Seed Size and Shape in Arabidopsis1[W][OPEN

PubMed Central

Jiang, Wen-Bo; Huang, Hui-Ya; Hu, Yu-Wei; Zhu, Sheng-Wei; Wang, Zhi-Yong; Lin, Wen-Hui

2013-01-01

Seed development is important for agriculture productivity. We demonstrate that brassinosteroid (BR) plays crucial roles in determining the size, mass, and shape of Arabidopsis (Arabidopsis thaliana) seeds. The seeds of the BR-deficient mutant de-etiolated2 (det2) are smaller and less elongated than those of wild-type plants due to a decreased seed cavity, reduced endosperm volume, and integument cell length. The det2 mutant also showed delay in embryo development, with reduction in both the size and number of embryo cells. Pollination of det2 flowers with wild-type pollen yielded seeds of normal size but still shortened shape, indicating that the BR produced by the zygotic embryo and endosperm is sufficient for increasing seed volume but not for seed elongation, which apparently requires BR produced from maternal tissues. BR activates expression of SHORT HYPOCOTYL UNDER BLUE1, MINISEED3, and HAIKU2, which are known positive regulators of seed size, but represses APETALA2 and AUXIN RESPONSE FACTOR2, which are negative regulators of seed size. These genes are bound in vivo by the BR-activated transcription factor BRASSINAZOLE-RESISTANT1 (BZR1), and they are known to influence specific processes of integument, endosperm, and embryo development. Our results demonstrate that BR regulates seed size and seed shape by transcriptionally modulating specific seed developmental pathways. PMID:23771896

Raman Hyperspectral Imaging for Detection of Watermelon Seeds Infected with Acidovorax citrulli.

PubMed

Lee, Hoonsoo; Kim, Moon S; Qin, Jianwei; Park, Eunsoo; Song, Yu-Rim; Oh, Chang-Sik; Cho, Byoung-Kwan

2017-09-23

The bacterial infection of seeds is one of the most important quality factors affecting yield. Conventional detection methods for bacteria-infected seeds, such as biological, serological, and molecular tests, are not feasible since they require expensive equipment, and furthermore, the testing processes are also time-consuming. In this study, we use the Raman hyperspectral imaging technique to distinguish bacteria-infected seeds from healthy seeds as a rapid, accurate, and non-destructive detection tool. We utilize Raman hyperspectral imaging data in the spectral range of 400-1800 cm -1 to determine the optimal band-ratio for the discrimination of watermelon seeds infected by the bacteria Acidovorax citrulli using ANOVA. Two bands at 1076.8 cm -1 and 437 cm -1 are selected as the optimal Raman peaks for the detection of bacteria-infected seeds. The results demonstrate that the Raman hyperspectral imaging technique has a good potential for the detection of bacteria-infected watermelon seeds and that it could form a suitable alternative to conventional methods.

Functional group diversity of bee pollinators increases crop yield

PubMed Central

Hoehn, Patrick; Tscharntke, Teja; Tylianakis, Jason M; Steffan-Dewenter, Ingolf

2008-01-01

Niche complementarity is a commonly invoked mechanism underlying the positive relationship between biodiversity and ecosystem functioning, but little empirical evidence exists for complementarity among pollinator species. This study related differences in three functional traits of pollinating bees (flower height preference, daily time of flower visitation and within-flower behaviour) to the seed set of the obligate cross-pollinated pumpkin Cucurbita moschata Duch. ex Poir. across a land-use intensity gradient from tropical rainforest and agroforests to grassland in Indonesia. Bee richness and abundance changed with habitat variables and we used this natural variation to test whether complementary resource use by the diverse pollinator community enhanced final yield. We found that pollinator diversity, but not abundance, was positively related to seed set of pumpkins. Bees showed species-specific spatial and temporal variation in flower visitation traits and within-flower behaviour, allowing for classification into functional guilds. Diversity of functional groups explained even more of the variance in seed set (r2=45%) than did species richness (r2=32%) highlighting the role of functional complementarity. Even though we do not provide experimental, but rather correlative evidence, we can link spatial and temporal complementarity in highly diverse pollinator communities to pollination success in the field, leading to enhanced crop yield without any managed honeybees. PMID:18595841

Supercritical CO2 extract from strawberry seeds as a valuable component of mild cleansing compositions.

PubMed

Sikora, E; Michorczyk, P; Olszańska, M; Ogonowski, J

2015-12-01

The aim of this work was an elaboration of mild cleansing compositions, containing supercritical CO2 extract from strawberry seeds (SC-CO2 strawberry seed oil), as a moisturizing and skin-softening agent. The influence of concentration of the oil on user properties of shower/bath products was studied. A series of products (shower/bath cosmetics) composed mainly of mild surfactants (amphoacetates, sulfosuccinates, betaines) and containing different amounts of the oil (0.5 up to 5.0%) were prepared. For the stable products (formulations containing up to 2% of the oil), the influence of the SC-CO2 strawberry seed oil addition on the products' stability, foam ability, surface tension, pH and rheological properties was studied. Moreover, the skin compatibility and moisturizing efficiency of the cleansing products were recorded in a group of 15 volunteers (including 10 women and five men, aged 20-30 years), using skin diagnosis system AramoTS, Aram Huvis Co. Additionally, characterization of CO2 extract from strawberry seeds was performed. Measurements of the oil's analytical constants, that is acid value and saponification number, were conducted according to Polish Standard PN-EN ISO 660:2010 and PN-EN ISO 3657:2013, respectively. The oil concentration influences stability of the products. Only the formulations containing 0.5-2% of the extract have shown high stability. Moreover, used in the amount up to 2% the SC-CO2, strawberry seed oil does not affect significantly the cleansing and foaming properties of the products. The obtained shower/bath cosmetics showed good user properties and additionally good skin-moisturizing effect. The supercritical CO2 extract from strawberry seeds, rich source of unsaturated fatty acid, could be successfully used in the formulation of body washing compositions as a moisturizing and skin-softening agent. © 2015 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

Functional morphology and seed anatomy of the invasive weed, benghal dayflower (Commelina benghalensis): Implications for dispersal by mourning doves

USDA-ARS?s Scientific Manuscript database

Benghal dayflower (BD) is an exotic weed that reduces yields in many agricultural crops. Potential dispersal of this weed by migratory Mourning doves was investigated in this study. Evidence shows that doves feed on BD seeds, with some birds containing hundreds of seeds. Seeds extracted from harvest...

Machine vision system for inspecting characteristics of hybrid rice seed

NASA Astrophysics Data System (ADS)

Cheng, Fang; Ying, Yibin

2004-03-01

Obtaining clear images advantaged of improving the classification accuracy involves many factors, light source, lens extender and background were discussed in this paper. The analysis of rice seed reflectance curves showed that the wavelength of light source for discrimination of the diseased seeds from normal rice seeds in the monochromic image recognition mode was about 815nm for jinyou402 and shanyou10. To determine optimizing conditions for acquiring digital images of rice seed using a computer vision system, an adjustable color machine vision system was developed. The machine vision system with 20mm to 25mm lens extender produce close-up images which made it easy to object recognition of characteristics in hybrid rice seeds. White background was proved to be better than black background for inspecting rice seeds infected by disease and using the algorithms based on shape. Experimental results indicated good classification for most of the characteristics with the machine vision system. The same algorithm yielded better results in optimizing condition for quality inspection of rice seed. Specifically, the image processing can correct for details such as fine fissure with the machine vision system.

[Fatty acid of Rkatsiteli grape seed oil, Phellodendron lavallei oil and Amaranthus seeds oil and its comparative byological activity].

PubMed

Kikalishvili, B Iu; Zurabashvili, D Z; Zurabashvili, Z A; Turabelidze, D G; Shanidze, L A

2012-11-01

The aim of the study is individual qualitively and quantitatively identification of fatty acids in Pkatsiteli grape seed oil, Phellodendron lavallei oil and Amaranthus seed oil and prediction of its biological activity. Using high-effective liquid chromatogramphy fatty acids were franctionated. Their relative concentrations are expressed as percentages of the total fatty acid component. Identification of the fatty acids consituents is based on comparison of their retention time with that of known standards. The predominant fatty acids in the oils were palmitic, oleic and stearic acids. The investigation demonstrated that fatty acids composition takes marked part in lipid metabolism of biological necessary components. The most interesting result of the investigation was the detection of unusual for the essentain oil begenic acid.

Effect of treated tannery effluent with domestic wastewater and amendments on growth and yield of cotton.

PubMed

Jagathjothi, N; Amanullah, M Mohamed; Muthukrishnan, P

2013-11-15

Pot culture and field experiments were carried out at the Common Effluent Treatment Plant (CETP), Dindigul during kharif 2011-12 to investigate the influence of irrigation of treated tannery effluent along with domestic wastewater on growth, yield attributes and yield of cotton. The pot culture was in a factorial completely randomized design and field experiment laid out in factorial randomized block design with four replications. The results revealed that the mixing proportion of 25% Treated Tannery Effluent (TTE)+75% domestic wastewater (DWW) application recorded taller plants, higher dry matter production, number of sympodial branches plant(-1), number of fruiting points plant(-1), number of bolls plant(-1) and seed cotton yield with yield reduction of 15.28 and 16.11% compared to normal water irrigation under pot culture and field experiment, respectively. Regarding amendments, gypsum application registered higher seed cotton yield followed by VAM.

Growth characteristics of maize seeds exposed to magnetic field.

PubMed

Vashisth, Ananta; Joshi, Devendra Kumar

2017-02-01

Standardization of magnetic field was done for maximum enhancement in germination characteristics of maize seeds. Seeds of maize were exposed to static magnetic fields of strength 50, 100, 150, 200, and 250 for 1, 2, 3, and 4 h for all field strengths. Results indicate that magnetic field application enhanced seed performance in terms of percentage germination, speed of germination, seedling length, and seedling dry weight significantly compared to unexposed control. Among the various combinations of field strength and duration, 200 mT for 1 h exposure gave best results. Exposure of seeds to magnetic fields improved seed coat membrane integrity as it reduced cellular leakage and, consequently, electrical conductivity. Experiments conducted at a research farm as well as farmer's field showed that plants raised from seeds exposed to 200 mT for 1 h had higher values of leaf area index, shoot length, number of leaves, chlorophyll content, shoot/root dry weight, and root characteristics as compared to corresponding values in untreated control. From the studies, it may be concluded that exposure of dry seeds to static magnetic field of 200 mT for 1 h improved shoot and root growth. Improved root system and biomass led to increased seed yield. Improved functional root parameters suggested that magnetically treated maize seeds could be used under moisture stress conditions. Bioelectromagnetics. 38:151-157, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Thiamethoxam seed treatments hav no impact on pest numbers or yield in cultivated sunflowers

USDA-ARS?s Scientific Manuscript database

The use of neonicotinoid seed treatments is a nearly ubiquitous practice in sunflower (Helianthus annuus) pest management. Sunflowers have a speciose pest complex, but also harbor a diverse and abundant community of beneficial, non-target organisms which may be negatively affected by pest management...

Anti-cyanobacterial activity of Moringa oleifera seeds

PubMed Central

Beekman, Wendy

2009-01-01

Filtrates from crushed Moringa oleifera seeds were tested for their effects on growth and Photosystem II efficiency of the common bloom-forming cyanobacterium Microcystis aeruginosa. M. aeruginosa populations exhibited good growth in controls and treatments with 4- and 8-mg crushed Moringa seeds per liter, having similar growth rates of 0.50 (±0.01) per day. In exposures of 20- to 160-mg crushed Moringa seeds L−1, growth rates were negative and on average −0.23 (±0.05) .day−1. Presumably, in the higher doses of 20- to 160-mg crushed seeds per liter, the cyanobacteria died, which was supported by a rapid drop in the Photosystem II efficiency (ΦPSII), while the ΦPSII was high and unaffected in 0, 4, and 8 mg L−1. High-density populations of M. aeruginosa (chlorophyll-a concentrations of ∼270 µg L−1) were reduced to very low levels within 2 weeks of exposure to ≥80-mg crushed seeds per liter. At the highest dosage of 160 mg L−1, the ΦPSII dropped to zero rapidly and remained nil during the course of the experiment (14 days). Hence, under laboratory conditions, a complete wipeout of the bloom could be achieved. This is the first study that yielded evidence for cyanobactericidal activity of filtrate from crushed Moringa seeds, suggesting that Moringa seed extracts might have a potential as an effect-oriented measure lessening cyanobacterial nuisance. PMID:20676212

Constitutive expression of cell wall invertase genes increases grain yield and starch content in maize.

PubMed

Li, Bei; Liu, Hua; Zhang, Yue; Kang, Tao; Zhang, Li; Tong, Jianhua; Xiao, Langtao; Zhang, Hongxia

2013-12-01

Grain size, number and starch content are important determinants of grain yield and quality. One of the most important biological processes that determine these components is the carbon partitioning during the early grain filling, which requires the function of cell wall invertase. Here, we showed the constitutive expression of cell wall invertase-encoding gene from Arabidopsis, rice (Oryza sativa) or maize (Zea mays), driven by the cauliflower mosaic virus (CaMV) 35S promoter, all increased cell wall invertase activities in different tissues and organs, including leaves and developing seeds, and substantially improved grain yield up to 145.3% in transgenic maize plants as compared to the wild-type plants, an effect that was reproduced in our 2-year field trials at different locations. The dramatically increased grain yield is due to the enlarged ears with both enhanced grain size and grain number. Constitutive expression of the invertase-encoding gene also increased total starch content up to 20% in the transgenic kernels. Our results suggest that cell wall invertase gene can be genetically engineered to improve both grain yield and grain quality in crop plants. © 2013 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

[Growth of wheat from seed-to-seed in space flight

NASA Technical Reports Server (NTRS)

Levinskikh, M. A.; Sychev, V. N.; Derendiaeva, T. A.; Signalova, O. B.; Podol'skii, I. G.; Padalka, G. I.; Avdeev, S. V.; Bingham, G. E.; Campbell, W. F. (Principal Investigator)

2000-01-01

In our earlier space experiment with super dwarf wheat we found the spikes developed in space to be barren. The cause of the full crop sterility was sensitivity of this wheat species to the ethylene concentration of 0.3-0.8 mg/m3 during the experiment. The follow-up ground experiments were made to identify species of dwarf wheat that could be raised in space greenhouse Svet and are distinguished by partial tolerance of their reproductive organs to elevated ethylene in air. The choice fell on the USU-Apogee cultivar specially developed for planting in growth chambers as an integral part of various bioregenerative life support systems, including the space ones. An experiment with wheat Apogee was performed in greenhouse Svet on board MIR. The period of the full crop vegetation cycle was not significantly altered under the spaceflight conditions. The experiment yielded 508 seeds from 12 plants, i.e. by 38% less than in laboratory experiments and by 69% more as compared with results of growing crops in ethylene-contaminated atmosphere (1 mg/m3). Mass of the space seeds was low if compared with the laboratory crops. This was the first time when the feasibility of gathering seeds from wheat that had passed the whole vegetation cycle in space flight was demonstrated. The experiment will give mightly impetus to the advancement of research on space biological LSS and gravitational biology.

Meta-analyses of oil yield in Cuphea PSR23

USDA-ARS?s Scientific Manuscript database

Oil content and composition of Cuphea seed are of special economic value as raw materials for industrial and food applications. The inherent unpredictability in determining and predicting Cuphea’s oil yield is attributed, in part, to the indeterminate growth habit and the persistence of the domestic...

Accumulation of silymarin in milk thistle seeds under drought stress.

PubMed

Keshavarz Afshar, Reza; Chaichi, Mohammad Reza; Ansari Jovini, Mahya; Jahanzad, Emad; Hashemi, Masoud

2015-09-01

According to the results obtained in this study, drought stress can enhance the accumulation of silymarin in milk thistle seeds. Moreover, under drought stress, the share of silybin increased which possess the greatest degree of biological activity among the silymarin components. Silymarin, an isomeric mixture of flavonolignans found in milk thistle (Silybum marianum (L.) Gaertn) seeds, has been used for its hepatoprotective effects for more than 2,000 years. Biosynthesis and accumulation of active substances like silymarin in plant tissues highly interacts with the environmental conditions. Effects of moderate and severe drought stress (based on soil moisture depletion) on silymarin content and composition in milk thistle seeds were evaluated in a field study. Averaged across treatments, milk thistle seeds contained 19.3 g kg(-1) silymarin. Drought stress enhanced silymarin accumulation in milk thistle seeds. Plants grown under moderate and severe drought stress treatments contained 4 and 17 % greater silymarin than those grown in well-watered condition, respectively. Greater content of sylimarin in stressed plants was attributed to more contents of silybin, isosilybin and silychristin, while silydianin content was lower under drought condition. According to the results obtained in this study, drought stress enhanced accumulation of silymarin in milk thistle seeds and improved its quality by increasing the share of silybin, which possess the greatest degree of biological activity among the silymarin components.

Optimization of mechanical extraction conditions for producing grape seed oil

USDA-ARS?s Scientific Manuscript database

In the United States, over 150 thousand metric tons of dried grape seeds containing 13-19% of oil are produced every year, as a byproduct from processing of about 5.8 million metric tons of grapes. The health promoting properties of grape seed oil is due to the presence of many bioactive components ...

Seed-to-seed-to-seed growth and development of Arabidopsis in microgravity.

PubMed

Link, Bruce M; Busse, James S; Stankovic, Bratislav

2014-10-01

Arabidopsis thaliana was grown from seed to seed wholly in microgravity on the International Space Station. Arabidopsis plants were germinated, grown, and maintained inside a growth chamber prior to returning to Earth. Some of these seeds were used in a subsequent experiment to successfully produce a second (back-to-back) generation of microgravity-grown Arabidopsis. In general, plant growth and development in microgravity proceeded similarly to those of the ground controls, which were grown in an identical chamber. Morphologically, the most striking feature of space-grown Arabidopsis was that the secondary inflorescence branches and siliques formed nearly perpendicular angles to the inflorescence stems. The branches grew out perpendicularly to the main inflorescence stem, indicating that gravity was the key determinant of branch and silique angle and that light had either no role or a secondary role in Arabidopsis branch and silique orientation. Seed protein bodies were 55% smaller in space seed than in controls, but protein assays showed only a 9% reduction in seed protein content. Germination rates for space-produced seed were 92%, indicating that the seeds developed in microgravity were healthy and viable. Gravity is not necessary for seed-to-seed growth of plants, though it plays a direct role in plant form and may influence seed reserves.

Isolation and characterization of coagulant extracted from Moringa oleifera seed by salt solution.

PubMed

Okuda, T; Baes, A U; Nishijima, W; Okada, M

2001-02-01

It is known that M. oleifera contains a natural coagulant in the seeds. In our previous research, the method using salt water to extract the active coagulation component from M. oleifera seeds was developed and compared with the conventional method using water. In this research, the active coagulation component was purified from a NaCl solution crude extract of Moringa oleifera seeds. The active component was isolated and purified from the crude extract through a sequence of steps that included salting-out by dialysis, removal of lipids and carbohydrates by homogenization with acetone, and anion exchange. Specific coagulation activity of the active material increased up to 34 times more than the crude extract after the ion exchange. The active component was not the same as that of water extract. The molecular weight was about 3000 Da. The Lowry method and the phenol-sulfuric acid method indicated that the active component was neither protein nor polysaccharide. The optimum pH of the purified active component for coagulation of turbidity was pH 8 and above. Different from the conventional water extracts, the active component can be used for waters with low turbidity without increase in the dissolved organic carbon concentration.

Method for obtaining three products with different properties from fennel (Foeniculum vulgare) seed

USDA-ARS?s Scientific Manuscript database

The objectives of this study were to determine the effects of distillation time (DT; 15-1080 min) on yield, composition, and antioxidant capacity of fennel (Foeniculum vulgare) seed essential oil (EO) as well as on the yield, composition, and properties of lipids extracted from steam-distilled fenne...

A Novel Acoustic Sensor Approach to Classify Seeds Based on Sound Absorption Spectra

PubMed Central

Gasso-Tortajada, Vicent; Ward, Alastair J.; Mansur, Hasib; Brøchner, Torben; Sørensen, Claus G.; Green, Ole

2010-01-01

A non-destructive and novel in situ acoustic sensor approach based on the sound absorption spectra was developed for identifying and classifying different seed types. The absorption coefficient spectra were determined by using the impedance tube measurement method. Subsequently, a multivariate statistical analysis, i.e., principal component analysis (PCA), was performed as a way to generate a classification of the seeds based on the soft independent modelling of class analogy (SIMCA) method. The results show that the sound absorption coefficient spectra of different seed types present characteristic patterns which are highly dependent on seed size and shape. In general, seed particle size and sphericity were inversely related with the absorption coefficient. PCA presented reliable grouping capabilities within the diverse seed types, since the 95% of the total spectral variance was described by the first two principal components. Furthermore, the SIMCA classification model based on the absorption spectra achieved optimal results as 100% of the evaluation samples were correctly classified. This study contains the initial structuring of an innovative method that will present new possibilities in agriculture and industry for classifying and determining physical properties of seeds and other materials. PMID:22163455

Cone and Seed Maturation of Southern Pines

Treesearch

James P. Barnett

1976-01-01

If slightly reduced yields and viability are acceptable, loblolly and slash cone collections can begin 2 to 3 weeks before maturity if the cones are stored before processing. Longleaf(P. palestris Mill.) pine cones should be collected only when mature, as storage decreased germination of seeds from immature cones. Biochemical analyses to determine reducing sugar...

Nanobiotechnology can boost crop production and quality: first evidence from increased plant biomass, fruit yield and phytomedicine content in bitter melon (Momordica charantia).

PubMed

Kole, Chittaranjan; Kole, Phullara; Randunu, K Manoj; Choudhary, Poonam; Podila, Ramakrishna; Ke, Pu Chun; Rao, Apparao M; Marcus, Richard K

2013-04-26

Recent research on nanoparticles in a number of crops has evidenced for enhanced germination and seedling growth, physiological activities including photosynthetic activity and nitrogen metabolism, mRNA expression and protein level, and also positive changes in gene expression indicating their potential use in crop improvement. We used a medicinally rich vegetable crop, bitter melon, as a model to evaluate the effects of seed treatment with a carbon-based nanoparticle, fullerol [C60(OH)20], on yield of plant biomass and fruit characters, and phytomedicine contents in fruits. We confirmed the uptake, translocation and accumulation of fullerol through bright field imaging and Fourier transform infra-red spectroscopy. We observed varied effects of seed treatment at five concentrations, including non-consequential and positive, on plant biomass yield, fruit yield and its component characters, and content of five phytomedicines in fruits. Fullerol-treatment resulted in increases up to 54% in biomass yield and 24% in water content. Increases of up to 20% in fruit length, 59% in fruit number, and 70% in fruit weight led to an improvement up to 128% in fruit yield. Contents of two anticancer phytomedicines, cucurbitacin-B and lycopene, were enhanced up to 74% and 82%, respectively, and contents of two antidiabetic phytomedicines, charantin and insulin, were augmented up to 20% and 91%, respectively. Non-significant correlation inter se plant biomass, fruit yield, phytomedicine content and water content evidenced for separate genetic control and biosynthetic pathways for production of plant biomass, fruits, and phytomedicines in fruits, and also no impact of increased water uptake. While our results indicated possibility of improving crop yield and quality by using proper concentrations of fullerol, extreme caution needs to be exercised given emerging knowledge about accumulation and toxicity of nanoparticles in bodily tissues.

Nanobiotechnology can boost crop production and quality: first evidence from increased plant biomass, fruit yield and phytomedicine content in bitter melon (Momordica charantia)

PubMed Central

2013-01-01

Background Recent research on nanoparticles in a number of crops has evidenced for enhanced germination and seedling growth, physiological activities including photosynthetic activity and nitrogen metabolism, mRNA expression and protein level, and also positive changes in gene expression indicating their potential use in crop improvement. We used a medicinally rich vegetable crop, bitter melon, as a model to evaluate the effects of seed treatment with a carbon-based nanoparticle, fullerol [C60(OH)20], on yield of plant biomass and fruit characters, and phytomedicine contents in fruits. Results We confirmed the uptake, translocation and accumulation of fullerol through bright field imaging and Fourier transform infra-red spectroscopy. We observed varied effects of seed treatment at five concentrations, including non-consequential and positive, on plant biomass yield, fruit yield and its component characters, and content of five phytomedicines in fruits. Fullerol-treatment resulted in increases up to 54% in biomass yield and 24% in water content. Increases of up to 20% in fruit length, 59% in fruit number, and 70% in fruit weight led to an improvement up to 128% in fruit yield. Contents of two anticancer phytomedicines, cucurbitacin-B and lycopene, were enhanced up to 74% and 82%, respectively, and contents of two antidiabetic phytomedicines, charantin and insulin, were augmented up to 20% and 91%, respectively. Non-significant correlation inter se plant biomass, fruit yield, phytomedicine content and water content evidenced for separate genetic control and biosynthetic pathways for production of plant biomass, fruits, and phytomedicines in fruits, and also no impact of increased water uptake. Conclusions While our results indicated possibility of improving crop yield and quality by using proper concentrations of fullerol, extreme caution needs to be exercised given emerging knowledge about accumulation and toxicity of nanoparticles in bodily tissues. PMID:23622112

Comparative role of neem seed extract, moringa leaf extract and imidacloprid in the management of wheat aphids in relation to yield losses in Pakistan

PubMed Central

Shah, Farhan Mahmood; Razaq, Muhammad; Han, Peng; Chen, Julian

2017-01-01

Wheat being staple food of Pakistan is constantly attacked by major wheat aphid species, Schizaphis graminum (R.), Rhopalosiphum padi (L.) and Sitobion avenae (F.). Due to concern on synthetic chemical use in wheat, it is imperative to search for alternative environment- and human- friendly control measures such as botanical pesticides. In the present study, we evaluated the comparative role of neem seed extract (NSE), moringa leaf extract (MLE) and imidacloprid (I) in the management of the aphid as well as the yield losses parameters in late planted wheat fields. Imidacloprid reduced significantly aphids infestation compared to the other treatments, hence resulting in higher yield, particularly when applied with MLE. The percentages of yield increase in I+MLE treated plots over the control were 19.15–81.89% for grains per spike, 5.33–37.62% for thousand grain weight and 27.59–61.12% for yield kg/ha. NSE was the second most effective control measure in suppressing aphid population, but the yield protected by NSE treatment over the control was comparable to that by imidacloprid. Population densities of coccinellids and syrphids in the plots treated with NSE-2 were higher than those treated with imidacloprid in two out of three experiments during 2013–14. Low predator density in imidacloprid-treated plots was attributed to the lower availability of prey aphids. The efficacy of NSE against aphids varied depending on degree of synchronization among the application timing, the activity of aphids, crop variety and environmental conditions. Despite that, we suggested NSE to be a promising alternative botanical insecticide compared to the most commonly recommended imidiacloprid. Further studies should consider the side effects of biopesticides on non-target organisms in order to provide better management practices in the field. PMID:28953894

Comparative role of neem seed extract, moringa leaf extract and imidacloprid in the management of wheat aphids in relation to yield losses in Pakistan.

PubMed

Shah, Farhan Mahmood; Razaq, Muhammad; Ali, Abid; Han, Peng; Chen, Julian

2017-01-01

Wheat being staple food of Pakistan is constantly attacked by major wheat aphid species, Schizaphis graminum (R.), Rhopalosiphum padi (L.) and Sitobion avenae (F.). Due to concern on synthetic chemical use in wheat, it is imperative to search for alternative environment- and human- friendly control measures such as botanical pesticides. In the present study, we evaluated the comparative role of neem seed extract (NSE), moringa leaf extract (MLE) and imidacloprid (I) in the management of the aphid as well as the yield losses parameters in late planted wheat fields. Imidacloprid reduced significantly aphids infestation compared to the other treatments, hence resulting in higher yield, particularly when applied with MLE. The percentages of yield increase in I+MLE treated plots over the control were 19.15-81.89% for grains per spike, 5.33-37.62% for thousand grain weight and 27.59-61.12% for yield kg/ha. NSE was the second most effective control measure in suppressing aphid population, but the yield protected by NSE treatment over the control was comparable to that by imidacloprid. Population densities of coccinellids and syrphids in the plots treated with NSE-2 were higher than those treated with imidacloprid in two out of three experiments during 2013-14. Low predator density in imidacloprid-treated plots was attributed to the lower availability of prey aphids. The efficacy of NSE against aphids varied depending on degree of synchronization among the application timing, the activity of aphids, crop variety and environmental conditions. Despite that, we suggested NSE to be a promising alternative botanical insecticide compared to the most commonly recommended imidiacloprid. Further studies should consider the side effects of biopesticides on non-target organisms in order to provide better management practices in the field.

Developmental Differences in Embryos of High and Low Protein Wheat Seeds during Germination 1

PubMed Central

Ching, Te May; Rynd, Lori

1978-01-01

Developmental patterns of embryos from high and low protein wheat (Triticum aestivum) grain produced under varied fertilizer conditions were compared. High protein grain produced seedlings 25% heavier with 25% more total RNA, 30% more DNA, 40% more amino acids, 60% more ribosomes, and 80% more soluble protein content than that of low protein seed. Consistently higher glutamine synthetase and α-amylase and lower acid phosphatase activities were observed in high protein seeds, though the isozyme pattern of α-amylase was not different in the two kinds of seeds. The high total ribosomes and particularly, polysome content observed in high protein seeds may be responsible for the rapid growth and high yield of these seeds. PMID:16660627

Residual effects of applied chemical fertilisers on growth and seed yields of sunflower (Helianthus annuus cv. high sun 33) after the harvests of initial main crops of maize (Zea mays L.), soybean (Glycine max L.) and sunflower (Helianthus annuus).

PubMed

Srisa-ard, K

2007-03-15

The experiments consisted of two locations, i.e., the first one was carried out on a growers's upland area at Saraburi Province, Central Plane region of Thailand with the use of Chatturat soil series (Typic Haplustalfs, fine, mixed) and the second experiment was carried out at Suranaree Technology university Experimental Farm, Suranaree Technology University Northeast Thailand with the use of Korat soil series (Oxic Paleustults). The experiments aimed to investigate the effect of residual effects of applied chemical fertilisers on growth and seed yields of sunflower (Helianthus annuus) after the harvests of initial main crops of maize, soybean and sunflower. The experiments consisted of four cultural methods being practiced by growers in both regions. For Methods 1 and 2, each had four fertiliser treatments; Method 3 consisted of two fertiliser treatments and Method 4 was used as a control treatment. The results showed that soil pH, organic matter and nutrients of Korat soil series were most suited soil conditions for growth of sunflower plants, whilst that of Chatturat soil series at Saraburi province was an alkaline soil with a mean value of soil pH of 7.8. Chatturat soil series, in most cases, gave higher amounts of seed yields (1,943.75 kg ha(-1)) than Korat soil series. Residual effects of applied chemical fertilisers to main crops of soybean gave better growth and seed yields of sunflower plants and it is considered to be the first choice. The use of sunflower and maize as main crops gave a second choice for subsequent crop of sunflower.

Seed-to-Seed-to-Seed Growth and Development of Arabidopsis in Microgravity

PubMed Central

Link, Bruce M.; Busse, James S.

2014-01-01

Abstract Arabidopsis thaliana was grown from seed to seed wholly in microgravity on the International Space Station. Arabidopsis plants were germinated, grown, and maintained inside a growth chamber prior to returning to Earth. Some of these seeds were used in a subsequent experiment to successfully produce a second (back-to-back) generation of microgravity-grown Arabidopsis. In general, plant growth and development in microgravity proceeded similarly to those of the ground controls, which were grown in an identical chamber. Morphologically, the most striking feature of space-grown Arabidopsis was that the secondary inflorescence branches and siliques formed nearly perpendicular angles to the inflorescence stems. The branches grew out perpendicularly to the main inflorescence stem, indicating that gravity was the key determinant of branch and silique angle and that light had either no role or a secondary role in Arabidopsis branch and silique orientation. Seed protein bodies were 55% smaller in space seed than in controls, but protein assays showed only a 9% reduction in seed protein content. Germination rates for space-produced seed were 92%, indicating that the seeds developed in microgravity were healthy and viable. Gravity is not necessary for seed-to-seed growth of plants, though it plays a direct role in plant form and may influence seed reserves. Key Words: Arabidopsis—Branch—Inflorescence—Microgravity—Morphology—Seed—Space. Astrobiology 14, 866–875. PMID:25317938

High-throughput phenotyping (HTP) identifies seedling root traits linked to variation in seed yield and nutrient capture in field-grown oilseed rape (Brassica napus L.)

PubMed Central

Thomas, C. L.; Graham, N. S.; Hayden, R.; Meacham, M. C.; Neugebauer, K.; Nightingale, M.; Dupuy, L. X.; Hammond, J. P.; White, P. J.; Broadley, M. R.

2016-01-01

Background and Aims Root traits can be selected for crop improvement. Techniques such as soil excavations can be used to screen root traits in the field, but are limited to genotypes that are well-adapted to field conditions. The aim of this study was to compare a low-cost, high-throughput root phenotyping (HTP) technique in a controlled environment with field performance, using oilseed rape (OSR; Brassica napus) varieties. Methods Primary root length (PRL), lateral root length and lateral root density (LRD) were measured on 14-d-old seedlings of elite OSR varieties (n = 32) using a ‘pouch and wick’ HTP system (∼40 replicates). Six field experiments were conducted using the same varieties at two UK sites each year for 3 years. Plants were excavated at the 6- to 8-leaf stage for general vigour assessments of roots and shoots in all six experiments, and final seed yield was determined. Leaves were sampled for mineral composition from one of the field experiments. Key Results Seedling PRL in the HTP system correlated with seed yield in four out of six (r = 0·50, 0·50, 0·33, 0·49; P < 0·05) and with emergence in three out of five (r = 0·59, 0·22, 0·49; P < 0·05) field experiments. Seedling LRD correlated positively with leaf concentrations of some minerals, e.g. calcium (r = 0·46; P < 0·01) and zinc (r = 0·58; P < 0·001), but did not correlate with emergence, general early vigour or yield in the field. Conclusions Associations between PRL and field performance are generally related to early vigour. These root traits might therefore be of limited additional selection value, given that vigour can be measured easily on shoots/canopies. In contrast, LRD cannot be assessed easily in the field and, if LRD can improve nutrient uptake, then it may be possible to use HTP systems to screen this trait in both elite and more genetically diverse, non-field-adapted OSR. PMID:27052342

Multi-population selective genotyping to identify soybean (Glycine max (L.) Merr.) seed protein and oil QTLs

USDA-ARS?s Scientific Manuscript database

Plant breeders continually generate ever-higher yielding cultivars, but also want to improve seed constituent value, which in soybean [Glycine max (L.) Merr.] is seed protein and oil. Identification of genetic loci governing those two traits would facilitate that effort, and though genome-wide asso...

Discrimination of transgenic soybean seeds by terahertz spectroscopy

NASA Astrophysics Data System (ADS)

Liu, Wei; Liu, Changhong; Chen, Feng; Yang, Jianbo; Zheng, Lei

2016-10-01

Discrimination of genetically modified organisms is increasingly demanded by legislation and consumers worldwide. The feasibility of a non-destructive discrimination of glyphosate-resistant and conventional soybean seeds and their hybrid descendants was examined by terahertz time-domain spectroscopy system combined with chemometrics. Principal component analysis (PCA), least squares-support vector machines (LS-SVM) and PCA-back propagation neural network (PCA-BPNN) models with the first and second derivative and standard normal variate (SNV) transformation pre-treatments were applied to classify soybean seeds based on genotype. Results demonstrated clear differences among glyphosate-resistant, hybrid descendants and conventional non-transformed soybean seeds could easily be visualized with an excellent classification (accuracy was 88.33% in validation set) using the LS-SVM and the spectra with SNV pre-treatment. The results indicated that THz spectroscopy techniques together with chemometrics would be a promising technique to distinguish transgenic soybean seeds from non-transformed seeds with high efficiency and without any major sample preparation.

Supercritical fluid extraction of phenolic compounds and antioxidants from grape (Vitis labrusca B.) seeds.

PubMed

Ghafoor, Kashif; Al-Juhaimi, Fahad Y; Choi, Yong Hee

2012-12-01

Supercritical fluid extraction (SFE) technique was applied and optimized for temperature, CO₂ pressure and ethanol (modifier) concentration using orthogonal array design and response surface methodology for the extract yield, total phenols and antioxidants from grape (Vitis labrusca B.) seeds. Effects of extraction temperature and pressure were found to be significant for all these response variables in SFE process. Optimum SFE conditions (44 ~ 46 °C temperature and 153 ~ 161 bar CO₂ pressure) along with ethanol (<7 %) as modifier, for the maximum predicted values of extract yield (12.09 %), total phenols (2.41 mg GAE/ml) and antioxidants (7.08 mg AAE/ml), were used to obtain extracts from grape seeds. The predicted values matched well with the experimental values (12.32 % extract yield, 2.45 mg GAE/ml total phenols and 7.08 mg AAE/ml antioxidants) obtained at optimum SFE conditions. The antiradical assay showed that SFE extracts of grape seeds can scavenge more than 85 % of 1, 1-diphenyl-2-picrylhydrazyl (DPPH) radicals. The grape seeds extracts were also analyzed for hydroxybenzoic acids which included gallic acid (1.21 ~ 3.84 μg/ml), protocatechuic acid (3.57 ~ 11.78 μg/ml) and p-hydroxybenzoic acid (206.72 ~ 688.18 μg/ml).

Iridoids from seeds of Gentiana lutea.

PubMed

Bianco, Armandodoriano; Ramunno, Alessia; Melchioni, Cristiana

2003-08-01

In the seeds of Gentiana lutea L. there were also detected, in addition to the known sweroside and getiopicroside, loganic acid 3 and trifloroside 4 that is present as main glycosidic component. The structures of 3 and 4 were established by spectroscopic studies.

Application of paclobutrazol affect maize grain yield by regulating root morphological and physiological characteristics under a semi-arid region.

PubMed

Kamran, Muhammad; Wennan, Su; Ahmad, Irshad; Xiangping, Meng; Wenwen, Cui; Xudong, Zhang; Siwei, Mou; Khan, Aaqil; Qingfang, Han; Tiening, Liu

2018-03-19

A field experiment was conducted to investigate the effects of paclobutrazol on ear characteristics and grain yield by regulating root growth and root-bleeding sap of maize crop. Seed-soaking at rate of 0 (CK1), 200 (S1), 300 (S2), and 400 (S3) mg L -1 , and seed-dressing at rate of 0 (CK2), 1.5 (D1), 2.5 (D2), and 3.5 (D3) g kg -1 were used. Our results showed that paclobutrazol improved the ear characteristics and grain yield, and were consistently higher than control during 2015-2016. The average grain yield of S1, S2 and S3 were 18.9%, 61.3%, and 45.9% higher, while for D1, D2 and D3 were 20.2%, 33.3%, and 45.2%, compared to CK, respectively. Moreover, paclobutrazol-treated maize had improved root-length density (RLD), root-surface area density (RSD) and root-weight density (RWD) at most of the soil profiles (0-70 cm for seed-soaking, 0-60 cm for seed-dressing) and was attributed to enhancing the grain yield. In addition, root-activity, root-bleeding sap, root dry weight, diameter and root/shoot ratio increased by paclobutrazol, with highest values achieved in S2 and D3 treatments, across the whole growth stages in 2015-2016. Our results suggested that paclobutrazol could efficiently be used to enhance root-physiological and morphological characteristics, resulting in higher grain yield.

Herbicidal Activity of Glucosinolate Degradation Products in Fermented Meadowfoam (Limnanthes alba) Seed Meal

PubMed Central

STEVENS, JAN F.; REED, RALPH L.; ALBER, SUSAN; PRITCHETT, LARRY; MACHADO, STEPHEN

2009-01-01

Meadowfoam (Limnanthes alba) is an oilseed crop grown in western Oregon. After extraction of the oil from the seeds, the remaining seed meal contains 2-4% of the glucosinolate, glucolimnanthin. We investigated the effect of fermentation of seed meal on its chemical composition and the effect of the altered composition on downy brome (Bromus tectorum) coleoptile emergence. Incubation of enzyme-inactive seed meal with enzyme-active seeds (1% by weight) resulted in complete degradation of glucolimnanthin and formation of 3-methoxybenzyl isothiocyanate in 28% yield. Fermentation in the presence of an aqueous solution of FeSO4 (10 mM) resulted in the formation of 3-methoxyphenylacetonitrile and 2-(3-methoxyphenyl)ethanethioamide, a novel natural product. The formation of the isothiocyanate, the nitrile and the thioamide, as a total, correlated with an increase of herbicidal potency of seed meal (r2 = 0.96). The results of this study open new possibilities for the refinement of glucosinolate-containing seed meals for use as bioherbicides. PMID:19170637

Herbicidal activity of glucosinolate degradation products in fermented meadowfoam ( Limnanthes alba ) seed meal.