Multiwavelength ytterbium-Brillouin random Rayleigh feedback fiber laser
NASA Astrophysics Data System (ADS)
Wu, Han; Wang, Zinan; Fan, Mengqiu; Li, Jiaqi; Meng, Qingyang; Xu, Dangpeng; Rao, Yunjiang
2018-03-01
In this letter, we experimentally demonstrate the multiwavelength ytterbium-Brillouin random fiber laser for the first time, in the half-open cavity formed by a fiber loop mirror and randomly distributed Rayleigh mirrors. With a cladding-pumped ytterbium-doped fiber and a long TrueWave fiber, the narrow linewidth Brillouin pump can generate multiple Brillouin Stokes lines with hybrid ytterbium-Brillouin gain. Up to six stable channels with a spacing of about 0.06 nm are obtained. This work extends the operation wavelength of the multiwavelength Brillouin random fiber laser to the 1 µm band, and has potential in various applications.
All-fibre ytterbium laser tunable within 45 nm
DOE Office of Scientific and Technical Information (OSTI.GOV)
Abdullina, S R; Babin, S A; Vlasov, A A
2007-12-31
A tunable ytterbium-doped fibre laser is fabricated. The laser is tuned by using a tunable fibre Bragg grating (FBG) as a selecting intracavity element. The laser is tunable within 45 nm (from 1063 to 1108 nm) and emits {approx}6 W in the line of width {approx}0.15 nm, the output power and linewidth being virtually invariable within the tuning range. The method is proposed for synchronous tuning the highly reflecting and output FBGs, and a tunable ytterbium all-fibre laser is built. (lasers)
NASA Astrophysics Data System (ADS)
Song, Rui; Lei, Chengmin; Han, Kai; Chen, Zilun; Pu, Dongsheng; Hou, Jing
2017-05-01
Supercontinuum generation directly from a nonlinear fiber amplifier, especially from a nonlinear ytterbium-doped fiber amplifier, attracts more and more attention due to its all-fiber structure, high optical to optical conversion efficiency, and high power output potential. However, the modeling of supercontinuum generation from a nonlinear fiber amplifier has been rarely reported. In this paper, the modeling of a tapered Ytterbium-doped fiber amplifier for visible extended to infrared supercontinuum generation is proposed based on the combination of the laser rate equations and the generalized nonlinear Schrödinger equation. Ytterbium-doped fiber amplifier generally can not generate visible extended supercontinuum due to its pumping wavelength and zero-dispersion wavelength. However, appropriate tapering and four-wave mixing makes the visible extended supercontinuum generation from an ytterbium-doped fiber amplifier possible. Tapering makes the zero-dispersion wavelength of the ytterbium-doped fiber shift to the short wavelength and minimizes the dispersion matching. Four-wave mixing plays an important role in the visible spectrum generation. The influence of pulse width and pump power on the supercontinuum generation is calculated and analyzed. The simulation results imply that it is promising and possible to fabricate a visible-to-infrared supercontinuum with low pump power and flat spectrum by using the tapered ytterbium-doped fiber amplifier scheme as long as the related parameters are well-selected.
Dimer self-organization of impurity ytterbium ions in synthetic forsterite single crystals
NASA Astrophysics Data System (ADS)
Tarasov, V. F.; Sukhanov, A. A.; Dudnikova, V. B.; Zharikov, E. V.; Lis, D. A.; Subbotin, K. A.
2017-07-01
Paramagnetic centers formed by impurity Yb3+ ions in synthetic forsterite (Mg2SiO4) grown by the Czochralski technique are studied by X-band CW and pulsed EPR spectroscopy. These centers are single ions substituting magnesium in two different crystallographic positions denoted M1 and M2, and dimer associates formed by two Yb3+ ions in nearby positions M1. It is established that there is a pronounced mechanism favoring self-organization of ytterbium ions in dimer associates during the crystal growth, and the mechanism of the spin-spin coupling between ytterbium ions in the associate has predominantly a dipole-dipole character, which makes it possible to control the energy of the spin-spin interaction by changing the orientation of the external magnetic field. The structural computer simulation of cluster ytterbium centers in forsterite crystals is carried out by the method of interatomic potentials using the GULP 4.0.1 code (General Utility Lattice Program). It is established that the formation of dimer associates in the form of a chain parallel to the crystallographic axis consisting of two ytterbium ions with a magnesium vacancy between them is the most energetically favorable for ytterbium ions substituting magnesium in the position M1.
Ytterbium trifluoride as a radiopaque agent for dental cements.
Collares, F M; Ogliari, F A; Lima, G S; Fontanella, V R C; Piva, E; Samuel, S M W
2010-09-01
To evaluate the radiopacity, degree of conversion (DC) and flexural strength of an experimental dental cement, with several added radiopaque substances. Titanium dioxide, quartz, zirconia, bismuth oxide, barium sulphate and ytterbium trifluoride were added to the experimental cement in five different concentrations. Radiopacity was evaluated with a phosphor plate system, and the radiodensity of specimens was compared with an aluminium step-wedge. DC was evaluated with FT-infrared spectroscopy following 20 s of photo-activation. Specimens with dimensions of 12 x 2 x 2 mm were used for the flexural strength test. Data were analysed with two-way anova and Tukey's post hoc test. Radiopacity of the experimental dental cements with barium sulphate and bismuth oxide at 40% and ytterbium fluoride at 30% and 40% showed no significant differences in comparison with 3 mm of Al (181, 96). The experimental dental cements with at least 30% added ytterbium trifluoride had satisfactory radiopacity without influencing other properties.
Structural and magnetic properties of ytterbium substituted spinel ferrites
NASA Astrophysics Data System (ADS)
Alonizan, Norah H.; Qindeel, Rabia
2018-06-01
Chemical co-precipitation route adopted to synthesize the magnetic materials. In the present work, iron is replaced by ytterbium ion in manganese-based spinel ferrites. The yield chemically represented by MnYb x Fe2- x O4 ( x = 0.00, 0.025, 0.05, 0.075, 0.10) and its structural, magnetic and electrical properties were observed. The cubic structure of spinel ferrites was confirmed by X-ray diffraction analysis. Spherically shaped grains were perceived in SEM pictures and size lessened with the growth of ytterbium concentration. SEM profile also shows little irregularity in spherical particles. The substitution of ytterbium (Yb) results in the enhancement of electrical resistivity. The resistivity was reduced with the gradual increase in temperature from 303 to 693 K. The trend of activation energy was found to be similar to that of room temperature resistivity. The coercivity of samples was raised with Yb-ion substitution while saturation magnetization and remanence reduced.
Single frequency 1083nm ytterbium doped fiber master oscillator power amplifier laser.
Huang, Shenghong; Qin, Guanshi; Shirakawa, Akira; Musha, Mitsuru; Ueda, Ken-Ichi
2005-09-05
Single frequency 1083nm ytterbium fiber master oscillator power amplifier system was demonstrated. The oscillator was a linear fiber cavity with loop mirror filter and polarization controller. The loop mirror with unpumped ytterbium fiber as a narrow bandwidth filter discriminated and selected laser longitudinal modes efficiently. Spatial hole burning effect was restrained by adjusting polarization controller appropriately in the linear cavity. The amplifier was 5 m ytterbium doped fiber pumped by 976nm pigtail coupled laser diode. The linewidth of the single frequency laser was about 2 KHz. Output power up to 177 mW was produced under the launched pump power of 332 mW.
Hearns, Nigel G R; Laflèche, Denis N; Sandercock, Mark L
2015-05-01
Preparation of a ytterbium-tagged gunshot residue (GSR) reference standard for scanning electron microscopy and energy dispersive X-ray spectroscopic (SEM-EDS) microanalysis is reported. Two different chemical markers, ytterbium and neodymium, were evaluated by spiking the primers of 38 Special ammunition cartridges (no propellant, no projectile) and discharging them onto 12.7 mm diameter aluminum SEM pin stubs. Following SEM-EDS microanalysis, the majority of tri-component particles containing lead, barium, and antimony (PbBaSb) were successfully tagged with the chemical marker. Results demonstrate a primer spiked with 0.75% weight percent of ytterbium nitrate affords PbBaSb particles characteristic of GSR with a ytterbium inclusion efficiency of between 77% and 100%. Reproducibility of the method was verified, and durability of the ytterbium-tagged tri-component particles under repeated SEM-EDS analysis was also tested. The ytterbium-tagged PbBaSb particles impart synthetic traceability to a GSR reference standard and are suitable for analysis alongside case work samples, as a positive control for quality assurance purposes. © 2015 American Academy of Forensic Sciences.
Residual stresses and phase transformations in Ytterbium silicate environmental barrier coatings
NASA Astrophysics Data System (ADS)
Stolzenburg, Fabian
Due to their high melting temperature, low density, and good thermomechanical stability, silicon-based ceramics (SiC, Si3N4) are some of the most promising materials systems for high temperature structural applications in gas turbine engines. However, their silica surface layer reacts with water vapor contained in combustion environments. The resulting hydroxide layer volatilizes, leading to component recession. Environmental barrier coatings (EBCs) have been developed to shield the substrate from degradation. Next generation coatings for silicon-based ceramics based on ytterbium silicates have shown a promising combination of very low and good thermomechanical properties. The focus of this thesis is threefold: In the first part, phase transformations in plasma sprayed ytterbium silicates were investigated. Plasma sprayed materials are known to contain large amounts of amorphous material. Phase changes during the conversion from amorphous to crystalline materials were investigated as they have been known to lead to failure in many coatings. The second part of this work focused on measuring residual stresses in multilayer EBCs using synchrotron X-ray diffraction (XRD). Strains were resolved spatially, with probe sizes as small as 20 um. Stresses were calculated using mechanical properties of ytterbium silicates, determined with in-situ loading and heating experiments. In-situ and ex-situ heating experiments allowed for the study of changes in stress states that occur in these EBC materials during heating and cooling cycles. Lastly, the interaction of ytterbium silicates with low-melting environmental calcium-magnesium-aluminosilicate (CMAS) glasses was studied. Synchrotron XRD was used to study the influence of CMAS on the stress state in the coating, X-ray computed tomography was used to provide 3D images of coatings, and EDS and TEM analysis were used to study the interactions at the CMAS/ytterbium silicate interface in detail.
Efficient Energy Transfer from Near-Infrared Emitting Gold Nanoparticles to Pendant Ytterbium(III).
Crawford, Scott E; Andolina, Christopher M; Kaseman, Derrick C; Ryoo, Bo Hyung; Smith, Ashley M; Johnston, Kathryn A; Millstone, Jill E
2017-12-13
Here, we demonstrate efficient energy transfer from near-infrared-emitting ortho-mercaptobenzoic acid-capped gold nanoparticles (AuNPs) to pendant ytterbium(III) cations. These functional materials combine the high molar absorptivity (1.21 × 10 6 M -1 cm -1 ) and broad excitation features (throughout the UV and visible regions) of AuNPs with the narrow emissive properties of lanthanides. Interaction between the AuNP ligand shell and ytterbium is determined using both nuclear magnetic resonance and electron microscopy measurements. In order to identify the mechanism of this energy transfer process, the distance of the ytterbium(III) from the surface of the AuNPs is systematically modulated by changing the size of the ligand appended to the AuNP. By studying the energy transfer efficiency from the various AuNP conjugates to pendant ytterbium(III) cations, a Dexter-type energy transfer mechanism is suggested, which is an important consideration for applications ranging from catalysis to energy harvesting. Taken together, these experiments lay a foundation for the incorporation of emissive AuNPs in energy transfer systems.
Photonic bandgap single-mode optical fibre with ytterbium-doped silica glass core
DOE Office of Scientific and Technical Information (OSTI.GOV)
Egorova, O N; Semenov, S L; Vel'miskin, V V
2011-01-24
A photonic bandgap fibre with an ytterbium-doped silica glass core is fabricated and investigated. The possibility of implementing single-mode operation of such fibres in a wide spectral range at a large (above 20 {mu}m) mode field diameter makes them promising for fibre lasers and amplifiers. To ensure a high quality of the beam emerging from the fibre, particular attention is paid to increasing the optical homogeneity of the ytterbium-doped core glass. (optical fibres)
NASA Astrophysics Data System (ADS)
Kalinovskaya, I. V.
2014-09-01
The luminescence spectral characteristics of mixed-ligand compounds of ytterbium(III) with cinnamic acid and neutral phosphorus-containing ligands were studied by luminescence spectroscopy. The intensity of luminescence of the compounds was determined. The highest intensity of luminescence was found for the ytterbium(III) compound with triphenylphosphine oxide.
Luminescence and photoinduced absorption in ytterbium-doped optical fibres
DOE Office of Scientific and Technical Information (OSTI.GOV)
Rybaltovsky, A A; Aleshkina, S S; Likhachev, M E
2011-12-31
Photochemical reactions induced in the glass network of an ytterbium-doped fibre core by IR laser pumping and UV irradiation have been investigated by analysing absorption and luminescence spectra. We have performed comparative studies of the photoinduced absorption and luminescence spectra of fibre preforms differing in core glass composition: Al{sub 2}O{sub 3} : SiO{sub 2}, Al{sub 2}O{sub 3} : Yb{sub 2}O{sub 3} : SiO{sub 2}, and P{sub 2}O{sub 5} : Yb{sub 2}O{sub 3} : SiO{sub 2}. The UV absorption spectra of unirradiated preform core samples show strong bands peaking at 5.1 and 6.5 eV, whose excitation plays a key role inmore » photoinduced colour centre generation in the glass network. 'Direct' UV excitation of the 5.1- and 6.5-eV absorption bands at 244 and 193 nm leads to the reduction of some of the Yb{sup 3+} ions to Yb{sup 2+}. The photodarkening of ytterbium-doped fibres by IR pumping is shown to result from oxygen hole centre generation. A phenomenological model is proposed for the IR-pumping-induced photodarkening of ytterbium-doped fibres. The model predicts that colour centre generation in the core glass network and the associated absorption in the visible range result from a cooperative effect involving simultaneous excitation of a cluster composed of several closely spaced Yb{sup 3+} ions.« less
NASA Astrophysics Data System (ADS)
Tian, Hongchun; Zhang, Sa; Hou, Zhiyun; Xia, Changming; Zhou, Guiyao; Zhang, Wei; Liu, Jiantao; Wu, Jiale; Fu, Jian
2016-06-01
A stable dual-wavelength ytterbium-doped photonic crystal fiber laser pumped by a 976 nm laser diode has been demonstrated at room temperature. Single-wavelength, dual-wavelength laser oscillations are observed when the fiber laser operates under different pump power by using different length of fibers. Stable dual-wavelength radiation around 1045 nm and 1075 nm has been generated simultaneously at a high pump power directly from an ytterbium-doped fiber laser without using any spectral control mechanism. A small core ytterbium-doped PCF fabricated by the powder sinter direction drawn rod technology is used as gain medium. The pump power and fiber length which can affect the output characteristics of dual-wavelength fiber laser are analyzed in the experiment. Experiments confirm that higher pump power and longer fiber length favors 1075 nm output; lower pump power and shorter fiber length favors 1045 nm output. Those results have a good reference in multi-wavelength fiber laser.
Kinetic Monte Carlo Simulation of Oxygen Diffusion in Ytterbium Disilicate
NASA Astrophysics Data System (ADS)
Good, Brian
2015-03-01
Ytterbium disilicate is of interest as a potential environmental barrier coating for aerospace applications, notably for use in next generation jet turbine engines. In such applications, the diffusion of oxygen and water vapor through these coatings is undesirable if high temperature corrosion is to be avoided. In an effort to understand the diffusion process in these materials, we have performed kinetic Monte Carlo simulations of vacancy-mediated oxygen diffusion in Ytterbium Disilicate. Oxygen vacancy site energies and diffusion barrier energies are computed using Density Functional Theory. We find that many potential diffusion paths involve large barrier energies, but some paths have barrier energies smaller than one electron volt. However, computed vacancy formation energies suggest that the intrinsic vacancy concentration is small in the pure material, with the result that the material is unlikely to exhibit significant oxygen permeability.
Pump-Induced, Dual-Frequency Switching in a Short-Cavity, Ytterbium-Doped Fiber Laser
DOE Office of Scientific and Technical Information (OSTI.GOV)
Guan, W.; Marciante, J.R.
2008-07-23
Using a short linear cavity composed of a section of highly ytterbium-doped fiber surrounded by two fiber Bragg gratings, dual frequency switching is achieved by tuning the pump power of the laser. The dual-frequency switching is generated by the thermal effects of the absorbed pump in the ytterbium-doped fiber. At each frequency, the laser shows single-longitudinal-mode behavior. In each single-mode regime, the optical signal-to-noise ratio of the laser is greater than 50 dB. The dual-frequency, switchable, fiber laser can be designed for various applications by the careful selection of the two gratings.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Golyshev, A A; Malikov, A G; Orishich, A M
Processes of cutting stainless steel by ytterbium fibre and CO{sub 2} lasers have been experimentally compared. The cut surface roughnesses for 3- and 5-mm-thick stainless steel sheets are determined. The absorption coefficient of laser radiation during cutting is measured. It is established that the power absorbed by metal during cutting by the CO{sub 2} laser exceeds that for the ytterbium laser (provided that the cutting speed remains the same). The fact that the maximum cutting speed of the CO{sub 2} laser is lower than that of the ytterbium fibre laser is explained. (laser technologies)
Ytterbium-porphyrins as a new class of the luminescent labels
NASA Astrophysics Data System (ADS)
Tsvirko, M.; Korovin, Yu; Rusakova, N.
2007-08-01
New complexes of ytterbium with asymmetric porphyrins containing substituents in β-positions and hydrophobic meso-(monophenyl-p-oxypropyl)triphenylporphyrin (OPP) were obtained and characterized by elemental analysis, IR, UV-Vis absorption and luminescence spectroscopy. Electronic absorption, luminescence and luminescence excitation spectra of these complexes were studied at 295 K in DMF solutions and in the water-lecithin medium. The 4f-luminescence of ytterbium-porphyrins in the near infrared (IR) spectral region (λmax = 980 nm) is observed under excitation in Soret band (400-430 nm). The effect of substituent in porphyrin macroring on the 4f-luminescent properties was also investigated. The conjugates of these compounds with protein molecules - bovine serum albumin (BSA) were investigated as well. These compounds are interesting at the initial stage of diagnostics of tumor tissues as IR-luminescent probes due to their spectral-luminescent characteristics and some biochemical properties.
Role of oxygen hole centres in the photodarkening of ytterbium-doped phosphosilicate fibre
DOE Office of Scientific and Technical Information (OSTI.GOV)
Rybaltovsky, A A; Bobkov, K K; Likhachev, M E
2013-11-30
We have studied the photodarkening in active fibres with an ytterbium-doped phosphosilicate glass core under IR irradiation with a pump source (920 nm) and UV irradiation (193 nm). Analysis of absorption and luminescence spectra suggests that such irradiations produce phosphorus – oxygen – hole centres (P-OHCs) in the core glass network and lead to the reduction of the ytterbium ions to a divalent state (Yb{sup 2+}). The photoinduced optical loss in the fibres in the visible range (400 – 700 nm) is mainly due to absorption by the P-OHCs. A quantum-mechanical model is proposed for P-OHC and Yb{sup 2+} formation.more » (nonlinear optical phenomena)« less
Solid-State Laser Cooling of Ytterbium-Doped Tungstate Crystals
2001-01-01
namely the heavy metal fluoride glass ZBLAN and yttrium aluminum garnet . Favorable properties of the ytterbium-tungstates include exceptionally high...Optical refrigeration in Nd-doped yttrium aluminum garnet ,” Phys. Rev. Lett. 21, 1172 (1968). 2M.S. Chang, S.S. Elliott, T.K. Gustafson, C. Hu, and...idea gained experimental feasibility. Even with this tool, early failures to optically cool condensed media such as Nd3+ doped in yttrium aluminum
NASA Astrophysics Data System (ADS)
Jolly, A.; Vinçont, C.; Pierre, Ch.; Boullet, J.
2017-08-01
We propose an innovative, fully space-time model to take into account the seed-dependent nature of ageing penalties in high-power ytterbium-doped fibre amplifiers. Ageing is shown to be based on the on-going competition between photo-darkening and photo-bleaching phenomena. Our approach is based on the natural interplay between the excited states of co-existing ytterbium pairs and colour centres in highly doped fibres, in the presence of thermal coupling between the closely spaced excited states. As initiated from IR photons, the excitation of colour centres up to the UV band is supposed to be governed by multi-photon absorption. The interactions of interest in the kinetics of photo-bleaching then take the form of highly efficient charge transfers, which imply the reduction of some fraction of the basically trivalent ions to their divalent state. Due to the activation of ytterbium pairs by means of energy transfer up-conversion, these interactions get more and more effective at elevated operating powers. Computational results using these principles actually help to fit our experimental data regarding seeding effects, as well as fully generic trends already evidenced in the literature. This gives a fine demonstration for the need to discriminate co-active pump and signal contributions. Our self-consistent, still simplified model then consists of a valuable tool to help for a deeper understanding of the ageing issues. Furthermore, considering higher-order ytterbium aggregates, this should open new routes towards more comprehensive models.
Kinetic Monte Carlo Simulation of Oxygen Diffusion in Ytterbium Disilicate
NASA Technical Reports Server (NTRS)
Good, Brian S.
2015-01-01
Ytterbium disilicate is of interest as a potential environmental barrier coating for aerospace applications, notably for use in next generation jet turbine engines. In such applications, the transport of oxygen and water vapor through these coatings to the ceramic substrate is undesirable if high temperature oxidation is to be avoided. In an effort to understand the diffusion process in these materials, we have performed kinetic Monte Carlo simulations of vacancy-mediated and interstitial oxygen diffusion in Ytterbium disilicate. Oxygen vacancy and interstitial site energies, vacancy and interstitial formation energies, and migration barrier energies were computed using Density Functional Theory. We have found that, in the case of vacancy-mediated diffusion, many potential diffusion paths involve large barrier energies, but some paths have barrier energies smaller than one electron volt. However, computed vacancy formation energies suggest that the intrinsic vacancy concentration is small. In the case of interstitial diffusion, migration barrier energies are typically around one electron volt, but the interstitial defect formation energies are positive, with the result that the disilicate is unlikely to exhibit experience significant oxygen permeability except at very high temperature.
NASA Astrophysics Data System (ADS)
Borkowski, Mateusz; Buchachenko, Alexei A.; Ciuryło, Roman; Julienne, Paul S.; Yamada, Hirotaka; Kikuchi, Yuu; Takahashi, Kakeru; Takasu, Yosuke; Takahashi, Yoshiro
2017-12-01
We present high-resolution two-color photoassociation spectroscopy of Bose-Einstein condensates of ytterbium atoms. The use of narrow Raman resonances and careful examination of systematic shifts enabled us to measure 13 bound-state energies for three isotopologues of the ground-state ytterbium molecule with standard uncertainties of the order of 500 Hz. The atomic interactions are modeled using an ab initio based mass-scaled Born-Oppenheimer potential whose long-range van der Waals parameters and total WKB phase are fitted to experimental data. We find that the quality of the fit of this model, of about 112.9 kHz (rms) can be significantly improved by adding the recently calculated beyond-Born-Oppenheimer (BBO) adiabatic corrections [J. J. Lutz and J. M. Hutson, J. Mol. Spectrosc. 330, 43 (2016), 10.1016/j.jms.2016.08.007] and by partially treating the nonadiabatic effects using distance-dependent reduced masses. Our BBO interaction model represents the experimental data to within about 30.2 kHz on average, which is 3.7 times better than the "reference" Born-Oppenheimer model. We calculate the s -wave scattering lengths for bosonic isotopic pairs of ytterbium atoms with error bars over two orders of magnitude smaller than previous determinations. For example, the s -wave scattering length for 174Yb is +5.55812 (50 ) nm.
25 CFR 163.15 - Advertisement of sales.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Advertisement of sales. 163.15 Section 163.15 Indians... Management and Operations § 163.15 Advertisement of sales. Except as provided in §§ 163.13, 163.14, 163.16, and 163.26 of this part, sales of forest products shall be made only after advertising. (a) The...
25 CFR 163.15 - Advertisement of sales.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Advertisement of sales. 163.15 Section 163.15 Indians... Management and Operations § 163.15 Advertisement of sales. Except as provided in §§ 163.13, 163.14, 163.16, and 163.26 of this part, sales of forest products shall be made only after advertising. (a) The...
25 CFR 163.15 - Advertisement of sales.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement of sales. 163.15 Section 163.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.15 Advertisement of sales. Except as provided in §§ 163.13, 163.14, 163.16, and 163.26 of this part, sales of forest...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 12 Banks and Banking 1 2014-01-01 2014-01-01 false Advertising. 163.27 Section 163.27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SAVINGS ASSOCIATIONS-OPERATIONS Operation and Structure § 163.27 Advertising. No Federal savings association shall use advertising (which...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 12 Banks and Banking 1 2013-01-01 2013-01-01 false Advertising. 163.27 Section 163.27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SAVINGS ASSOCIATIONS-OPERATIONS Operation and Structure § 163.27 Advertising. No Federal savings association shall use advertising (which...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 12 Banks and Banking 1 2012-01-01 2012-01-01 false Advertising. 163.27 Section 163.27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SAVINGS ASSOCIATIONS-OPERATIONS Operation and Structure § 163.27 Advertising. No Federal savings association shall use advertising (which...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Policy. 16.3 Section 16.3 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ADVISORY COMMITTEE MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee only...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 14 Aeronautics and Space 4 2013-01-01 2013-01-01 false Record. 406.163 Section 406.163 Aeronautics... Transportation Adjudications § 406.163 Record. (a) Exclusive record. The transcript of all testimony in the..., applications, and requests, and responses thereto; and all rulings constitute the exclusive record for decision...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Record. 406.163 Section 406.163 Aeronautics... Transportation Adjudications § 406.163 Record. (a) Exclusive record. The transcript of all testimony in the..., applications, and requests, and responses thereto; and all rulings constitute the exclusive record for decision...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 14 Aeronautics and Space 4 2012-01-01 2012-01-01 false Record. 406.163 Section 406.163 Aeronautics... Transportation Adjudications § 406.163 Record. (a) Exclusive record. The transcript of all testimony in the..., applications, and requests, and responses thereto; and all rulings constitute the exclusive record for decision...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 14 Aeronautics and Space 3 2012-01-01 2012-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Code of Federal Regulations, 2011 CFR
2011-01-01
... 14 Aeronautics and Space 3 2011-01-01 2011-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 16 Commercial Practices 1 2014-01-01 2014-01-01 false Policy. 16.3 Section 16.3 Commercial... MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee only... making policy decisions and determining action to be taken with respect to any matter considered by an...
Size-dependent abnormal thermo-enhanced luminescence of ytterbium-doped nanoparticles.
Cui, Xiangshui; Cheng, Yao; Lin, Hang; Huang, Feng; Wu, Qingping; Wang, Yuansheng
2017-09-21
Thermal quenching above 300 K is widely expected in photoluminescence. Luminescence quenching is usually ascribed to the non-radiative relaxation of excited electrons to the ground state of the activators, during which a high temperature always plays a role in pushing the excited electrons towards the quenching channels, leading to thermal quenching. For the lanthanide-doped nanoparticles, however, there is a special luminescence quenching channel that does not exist in their bulk counterparts, i.e., energy migration-induced surface quenching. Herein, a size-dependent abnormal thermal enhancement of luminescence in the temperature range of 300 K to 423 K in the ytterbium-doped fluoride nanoparticles is presented for the first time. Importantly, in this work, we originally demonstrate that the energy migration-induced surface quenching can be suppressed by increasing temperature, which results in the abnormal thermal enhancement of luminescence. According to the temperature-dependent X-ray diffraction and lifetime analyses, an underlying mechanism based on the effect of thermal lattice expansion on ytterbium-mediated energy migration is proposed. This new finding adds new insights to the size effect on the luminescent characteristics of nanoparticles, which could be utilized to construct some unique nanostructures, especially for many important temperature-related purposes, such as thermal sensing technology.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2010 CFR
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
Feng, Lin; Zhou, Xin; Su, Long-Xiang; Feng, Dan; Jia, Yan-Hong; Xie, Li-Xin
2012-01-01
Objective We investigated serum soluble CD163 (sCD163) levels for use in the diagnosis, severity assessment, and prognosis of sepsis in the critical ill patients and compared sCD163 with other infection-related variables. Methods During july 2010 and April 2011, serum was obtained from 102 sepsis patients (days 1, 3, 5, 7, and 10 after admission to an ICU) and 30 systemic inflammatory response syndrome (SIRS) patients with no sepsis diagnosed. Serum levels of sCD163, procalcitonon (PCT), and C reactive protein (CRP) were determined respectively. Sequential organ failure assessment (SOFA) scores for sepsis patients were also recorded. Then evaluated their roles in sepsis. Results The sCD163 levels were 0.88(0.78–1.00)ug/mL for SIRS patients, 1.50(0.92–2.00)ug/mL for moderate sepsis patients, and 2.95(2.18–5.57)ug/mL for severe sepsis patients on day1. The areas under the ROC curves for sCD163, CRP, and PCT for the diagnosis of sepsis were, respectively, 0.856(95%CI: 0.791–0.921), 0.696(95%CI: 0.595–0.797), and 0.629(95%CI: 0.495–0.763), At the recommended cut-off 1.49 ug/mL for sCD163, the sensitivity is 74.0% with 93.3% specificity. Based on 28-day survivals, sCD163 levels in the surviving group stay constant, while they tended to gradually increase in the non-surviving group.The area under the ROC curve for sCD163 for sepsis prognosis was 0.706(95%CI 0.558–0.804). Levels of sCD163 with cut-off point >2.84 ug/mL have sensitivity of 55.8.0%, specificity 80.4%.Common risk factors for death and sCD163 were included in multivariate logistic regression analysis; the odds ratios (OR) for sCD163 and SOFA scores for sepsis prognosis were 1.173 and 1.396, respectively (P<0.05). Spearman rank correlation analysis showed that sCD163 was weakly, but positively correlated with CRP, PCT, and SOFA scores (0.2< r <0.4, P<0.0001), but not with leukocyte counts (r <0.2, P = 0.450). Conclusion Serum sCD163 is superior to PCT and CRP for the diagnosis of sepsis and
Anion dependent ion pairing in concentrated ytterbium halide solutions
NASA Astrophysics Data System (ADS)
Klinkhammer, Christina; Böhm, Fabian; Sharma, Vinay; Schwaab, Gerhard; Seitz, Michael; Havenith, Martina
2018-06-01
We have studied ion pairing of ytterbium halide solutions. THz spectra (30-400 cm-1) of aqueous YbCl3 and YbBr3 solutions reveal fundamental differences in the hydration structures of YbCl3 and YbBr3 at high salt concentrations: While for YbBr3 no indications for a changing local hydration environment of the ions were experimentally observed within the measured concentration range, the spectra of YbCl3 pointed towards formation of weak contact ion pairs. The proposed anion specificity for ion pairing was confirmed by supplementary Raman measurements.
Towards diode-pumped mid-infrared praseodymium-ytterbium-doped fluoride fiber lasers
NASA Astrophysics Data System (ADS)
Woodward, R. I.; Hudson, D. D.; Jackson, S. D.
2018-02-01
We explore the potential of a new mid-infrared laser transition in praseodymium-doped fluoride fiber for emission around 3.4 μm, which can be conveniently pumped by 0.975 μm diodes via ytterbium sensitizer co-doping. Optimal cavity designs are determined through spectroscopic measurements and numerical modeling, suggesting that practical diode-pumped watt-level mid-infrared fiber sources beyond 3 μm could be achieved.
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
25 CFR 163.72 - Supervisory relationship.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary, Indian...
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must be...
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must be...
25 CFR 163.72 - Supervisory relationship.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary, Indian...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 15 2012-01-01 2012-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 15 2011-01-01 2011-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 15 2014-01-01 2014-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 15 2013-01-01 2013-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 10 Energy 4 2011-01-01 2011-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2012 CFR
2012-01-01
... 10 Energy 4 2012-01-01 2012-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 10 Energy 4 2014-01-01 2014-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2013 CFR
2013-01-01
... 10 Energy 4 2013-01-01 2013-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.2 - Information collection.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR part...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163 OFE evaluation. (a) The record shall consist of the complaint and any supporting documents and all...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
Code of Federal Regulations, 2011 CFR
2011-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao fat...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 32 National Defense 1 2011-07-01 2011-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 32 National Defense 1 2013-07-01 2013-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 32 National Defense 1 2012-07-01 2012-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
21 CFR 163.111 - Chocolate liquor.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely grinding...
21 CFR 163.111 - Chocolate liquor.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely grinding...
21 CFR 163.111 - Chocolate liquor.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely grinding...
25 CFR 163.32 - Forest development.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management... development funds will be used to re-establish, maintain, and/or improve growth of commercial timber species...
25 CFR 163.34 - Environmental compliance.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Environmental compliance. 163.34 Section 163.34 Indians... Management and Operations § 163.34 Environmental compliance. Actions taken by the Secretary under the regulations in this part must comply with the National Environmental Policy Act of 1969, applicable Council on...
50 CFR 648.163 - Gear restrictions.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Gear restrictions. 648.163 Section 648.163... Bluefish Fishery § 648.163 Gear restrictions. If the Council determines through its annual review or framework adjustment process that gear restrictions are necessary to assure that the fishing mortality rate...
25 CFR 163.81 - Assessment guidelines.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Assessment guidelines. 163.81 Section 163.81 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.81 Assessment guidelines. Assessments shall be national in scope and shall include: (a) An...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Bobkov, K K; Rybaltovsky, A A; Vel'miskin, V V
2014-12-31
We have studied photodarkening in ytterbium-doped fibre preforms with an aluminosilicate glass core. Analysis of their absorption and luminescence spectra indicates the formation of stable Yb{sup 2+} ions in the glass network under IR laser pumping at a wavelength λ = 915 nm and under UV irradiation with an excimer laser (λ = 193 nm). We have performed comparative studies of the luminescence spectra of the preforms and crystals under excitation at a wavelength of 193 nm. The mechanism behind the formation of Yb{sup 2+} ions and aluminium – oxygen hole centres (Al-OHCs), common to ytterbium-doped YAG crystals and aluminosilicatemore » glass, has been identified: photoinduced Yb{sup 3+} charge-transfer state excitation. (optical fibres)« less
21 CFR 163.114 - Lowfat cocoa.
Code of Federal Regulations, 2010 CFR
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a) Description. Lowfat cocoa is the food that conforms to the definition and standard of identity, and is subject... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lowfat cocoa. 163.114 Section 163.114 Food and...
25 CFR 163.21 - Bonds required.
Code of Federal Regulations, 2011 CFR
2011-04-01
... and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with all sales of forest products, except they may or may not be required, as determined by the approving officer... part in § 163.13 or in timber cutting permits issued pursuant to § 163.26 of this part. (1) In sales in...
25 CFR 163.21 - Bonds required.
Code of Federal Regulations, 2010 CFR
2010-04-01
... and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with all sales of forest products, except they may or may not be required, as determined by the approving officer... part in § 163.13 or in timber cutting permits issued pursuant to § 163.26 of this part. (1) In sales in...
25 CFR 163.26 - Forest product harvesting permits.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal contract...
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing...
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true [Reserved] 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing...
Cladding-pumped ytterbium-doped fiber laser with radially polarized output.
Lin, Di; Daniel, J M O; Gecevičius, M; Beresna, M; Kazansky, P G; Clarkson, W A
2014-09-15
A simple technique for directly generating a radially polarized output beam from a cladding-pumped ytterbium-doped fiber laser is reported. Our approach is based on the use of a nanograting spatially variant waveplate as an intracavity polarization-controlling element. The laser yielded ~32 W of output power (limited by available pump power) with a radially polarized TM (01)-mode output beam at 1040 nm with a corresponding slope efficiency of 66% and a polarization purity of 95%. The beam-propagation factor (M(2)) was measured to be ~1.9-2.1.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 36 Parks, Forests, and Public Property 2 2011-07-01 2011-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
Code of Federal Regulations, 2013 CFR
2013-07-01
... 36 Parks, Forests, and Public Property 2 2013-07-01 2013-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
Code of Federal Regulations, 2014 CFR
2014-07-01
... 36 Parks, Forests, and Public Property 2 2014-07-01 2014-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
Code of Federal Regulations, 2012 CFR
2012-07-01
... 36 Parks, Forests, and Public Property 2 2012-07-01 2012-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
19 CFR 191.163 - Documentation.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to Sample...
19 CFR 191.163 - Documentation.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 19 Customs Duties 2 2013-04-01 2013-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to Sample...
Code of Federal Regulations, 2010 CFR
2010-04-01
... summons is prima facie evidence of the facts it states. (d) Transcript of testimony under oath. Testimony... 19 Customs Duties 2 2010-04-01 2010-04-01 false Summons. 163.7 Section 163.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED...
25 CFR 163.37 - Forest management research.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the basis...
25 CFR 163.37 - Forest management research.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the basis...
25 CFR 163.37 - Forest management research.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the basis...
46 CFR 163.003-7 - Independent laboratory.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent laboratory...
46 CFR 163.003-7 - Independent laboratory.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent laboratory...
46 CFR 163.003-3 - ASTM standard.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false ASTM standard. 163.003-3 Section 163.003-3 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-3 ASTM standard. The following standard of the American Society for Testing and Materials (ASTM) is incorporated by reference into this subpart: ASTM D...
46 CFR 163.002-7 - Independent laboratory.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent laboratory...
46 CFR 163.002-7 - Independent laboratory.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent laboratory...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Methods of analysis. 163.5 Section 163.5 Food and... CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in cacao products shall be determined by the following methods of analysis prescribed in “Official Methods...
25 CFR 163.25 - Forest management deductions.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest management deductions. 163.25 Section 163.25... Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions of 25 U.S.C. 413 and 25 U.S.C. 3105, a forest management deduction shall be withheld from the gross...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
25 CFR 163.25 - Forest management deductions.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest management deductions. 163.25 Section 163.25... Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions of 25 U.S.C. 413 and 25 U.S.C. 3105, a forest management deduction shall be withheld from the gross...
Creation of quantum-degenerate gases of ytterbium in a compact 2D-/3D-magneto-optical trap setup
DOE Office of Scientific and Technical Information (OSTI.GOV)
Doerscher, Soeren; Thobe, Alexander; Hundt, Bastian
2013-04-15
We report on the first experimental setup based on a 2D-/3D-magneto-optical trap (MOT) scheme to create both Bose-Einstein condensates and degenerate Fermi gases of several ytterbium isotopes. Our setup does not require a Zeeman slower and offers the flexibility to simultaneously produce ultracold samples of other atomic species. Furthermore, the extraordinary optical access favors future experiments in optical lattices. A 2D-MOT on the strong {sup 1}S{sub 0}{yields}{sup 1}P{sub 1} transition captures ytterbium directly from a dispenser of atoms and loads a 3D-MOT on the narrow {sup 1}S{sub 0}{yields}{sup 3}P{sub 1} intercombination transition. Subsequently, atoms are transferred to a crossed opticalmore » dipole trap and cooled evaporatively to quantum degeneracy.« less
46 CFR 163.002-21 - Approval tests.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Approval tests. 163.002-21 Section 163.002-21 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-21 Approval tests. (a) General. If a pilot hoist fails one of the tests in this section the cause of the failure must be identified and any needed design...
NASA Astrophysics Data System (ADS)
Khanum, Rizwana; Moirangthem, Rakesh S.; Das, Nayan Mani
2017-06-01
Smooth surfaced and crystalline undoped and ytterbium doped zinc oxide (ZnO) microspheres having an approximate size of 3-5 μm were synthesized by hydrothermal process. Out of these microspheres, a single microparticle was chosen and engaged as a whispering gallery wave microresonator. The defect induced luminescence from an individual ZnO microsphere was investigated with micro-photoluminescence measurement in the spectral range of 565 to 740 nm under the excitation of a green laser having a centered wavelength at 532 nm. The defects-related emissions from a single ZnO microsphere show optical resonance peaks so-called "whispering gallery modes" (WGMs) which are confirmed with the theoretical calculation. Further, ZnO microspheres were chemically doped with the different molar percentages of Ytterbium (Yb), and enhancement in their emission properties was investigated. Our experimental results show that ZnO microspheres with 0.5 mol. % doping of Yb gives the strongest optical emission and has highest Q-factor which can be employed in the development of WGM based optical biosensor or laser.
Hu, Meizhong; Zhao, Haizhen; Zhang, Chong; Yu, Jiansheng; Lu, Zhaoxin
2013-11-27
Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 °C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry.
978-nm square-wave in an all-fiber single-mode ytterbium-doped fiber laser
NASA Astrophysics Data System (ADS)
Li, Shujie; Xu, Lixin; Gu, Chun
2018-01-01
A 978 nm single mode passively mode-locked all-fiber laser delivering square-wave pulses was demonstrated using a figure-8 cavity and a 75 cm commercial double-clad ytterbium-doped fiber. We found the three-level system near 978 nm was able to operate efficiently under clad pumping, simultaneously oscillation around 1030 nm well inhibited. The optimized nonlinear amplifying loop mirror made the mode locking stable and performed the square-pulses shaping. To the best of our knowledge, it is the first time to report the square-wave pulse fiber laser operating at 980 nm. The spectral width of the 978 mode-locked square pulses was about 4 nm, far greater than that of the mode-locked square pulses around 1060 nm reported before, which would be helpful to deeply understand the various square-wave pulses' natures and forming mechanisms. Compared with modulated single-mode or multimode 980 nm LDs, this kind of 980 nm square-wave sources having higher brightness, more steeper rising and falling edge and shorter pulse width, might have potential applications in pumping nanosecond ytterbium or erbium fiber lasers and amplifiers.
Ytterbium-doped fibre laser Q-switched by a cantilever-type micro-mirror.
Fabert, Marc; Desfarges-Berthelemot, Agnès; Kermène, Vincent; Crunteanu, Aurelian; Bouyge, David; Blondy, Pierre
2008-12-22
We present an Ytterbium fibre laser operating in the Q-switch regime by using a Micro- Opto- Electro- Mechanical System (MOEMS) of novel design. The cantilever-type micro-mirror is designed to generate short laser pulses with duration between 20 ns and 100 ns at repetition rates ranging from a few kilohertz up to 800 kHz. The bent profile of this new type of MOEMS ensures a high modulation rate of the laser cavity losses while keeping a high actuating frequency.
40 CFR 61.163 - Emission monitoring.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission monitoring. 61.163 Section 61.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic...
40 CFR 61.163 - Emission monitoring.
Code of Federal Regulations, 2014 CFR
2014-07-01
....163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic Emissions From Glass Manufacturing Plants § 61.163 Emission monitoring. (a) An owner or operator of a glass...
40 CFR 61.163 - Emission monitoring.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 8 2011-07-01 2011-07-01 false Emission monitoring. 61.163 Section 61.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic...
NASA Technical Reports Server (NTRS)
Numata, Kenji; Camp, Jordan
2012-01-01
We have developed a linearly polarized Ytterbium-doped fiber ring laser with a single longitudinal mode output at 1064 run. A fiber-coupled intracavity phase modulator ensured mode-hop free operation and allowed fast frequency tuning. The fiber laser was locked with high stability to an iodine-stabilized laser, showing a frequency noise suppression of a factor approx 10 (exp 5) at 1 mHz
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2014 CFR
2014-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2013 CFR
2013-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2012 CFR
2012-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2010 CFR
2010-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2011 CFR
2011-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
46 CFR 163.002-3 - Applicable technical regulations.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Applicable technical regulations. 163.002-3 Section 163.002-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-3 Applicable technical regulations...
Deterministic chaos in an ytterbium-doped mode-locked fiber laser
NASA Astrophysics Data System (ADS)
Mélo, Lucas B. A.; Palacios, Guillermo F. R.; Carelli, Pedro V.; Acioli, Lúcio H.; Rios Leite, José R.; de Miranda, Marcio H. G.
2018-05-01
We experimentally study the nonlinear dynamics of a femtosecond ytterbium doped mode-locked fiber laser. With the laser operating in the pulsed regime a route to chaos is presented, starting from stable mode-locking, period two, period four, chaos and period three regimes. Return maps and bifurcation diagrams were extracted from time series for each regime. The analysis of the time series with the laser operating in the quasi mode-locked regime presents deterministic chaos described by an unidimensional Rossler map. A positive Lyapunov exponent $\\lambda = 0.14$ confirms the deterministic chaos of the system. We suggest an explanation about the observed map by relating gain saturation and intra-cavity loss.
42 CFR 416.163 - General rules.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false General rules. 416.163 Section 416.163 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... beneficiaries by a participating ASC in connection with covered surgical procedures as determined by the...
42 CFR 416.163 - General rules.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 42 Public Health 3 2011-10-01 2011-10-01 false General rules. 416.163 Section 416.163 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... beneficiaries by a participating ASC in connection with covered surgical procedures as determined by the...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 49 Transportation 2 2013-10-01 2013-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 49 Transportation 2 2012-10-01 2012-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 49 Transportation 2 2014-10-01 2014-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 49 Transportation 2 2011-10-01 2011-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
46 CFR 163.002-27 - Production tests and examination.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.002-27 Section 163... examination. Each pilot hoist manufactured under Coast Guard approval must be tested as prescribed in § 163... laboratory must also conduct the visual examination described in § 163.002-21(b). The hoist may not be sold...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
14 CFR 145.163 - Training requirements.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training requirements. 145.163 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Personnel § 145.163 Training requirements. (a) A certificated repair station must have an employee training program approved by the FAA that consists of initial...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
NASA Astrophysics Data System (ADS)
He, Xiangming; Wang, Li; Li, Wen; Jiang, Changyin; Wan, Chunrong
The Yb/Co coated nickel hydroxides were prepared by precipitation of Yb(OH) 3 on the surface of spherical nickel hydroxide, followed by precipitation of Co(OH) 2 on its surface. The optimum coating content of ytterbium was around 2% (atomic concentration) to obtain high discharge capacity at 60 °C. It was shown that the discharge capacity of nickel hydroxide at high temperatures was improved by coating of ytterbium and cobalt hydroxide. The high temperature performances of the sealed AAA-sized Ni-MH batteries using Yb/Co coated nickel hydroxide as positive electrodes were carried out, showing much better than those using the un-coated and only Co(OH) 2 coated nickel hydroxide electrodes. The charge acceptance of the battery using 2% Yb and 2% Co coated nickel hydroxide reached 92% at 60 °C, where the charge acceptances for the un-coated and only cobalt coated ones were only 42 and 46%, respectively. It has shown that the Yb/Co coating is an effective way to improve the high temperature performance of nickel hydroxide for nickel-metal hydride batteries.
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2014-04-01 2014-04-01 false Method of tax payment. 25.163 Section 25.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY ALCOHOL BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
32 CFR 935.163 - Unexploded ordnance material.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 32 National Defense 6 2013-07-01 2013-07-01 false Unexploded ordnance material. 935.163 Section 935.163 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND... immediately report its site to the Commander. ...
32 CFR 935.163 - Unexploded ordnance material.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 32 National Defense 6 2011-07-01 2011-07-01 false Unexploded ordnance material. 935.163 Section 935.163 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND... immediately report its site to the Commander. ...
Reverse spontaneous laser line sweeping in ytterbium fiber laser
NASA Astrophysics Data System (ADS)
Navratil, P.; Peterka, P.; Honzatko, P.; Kubecek, V.
2017-03-01
Self-induced laser line sweeping of various regimes of sweep direction is reported for an experimental ytterbium fiber laser. The regimes involve sweeping from shorter to longer wavelengths (1076~\\text{nm}\\to 1083 nm)—so-called normal self-sweeping; from longer to shorter wavelengths (1079~\\text{nm}\\to 1073 nm)—so-called reverse self-sweeping; and a mixed regime in which a precarious balance of the normal and reverse sweeping exists and the sweep direction can change between consecutive sweeps. The regimes of sweeping were selected by changing the pump wavelength only. A detailed explanation of this sweep direction dynamics is presented based on a semi-empirical model. This model also provides a way to predict the sweep direction of fiber lasers based on other rare-earth-doped laser media.
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Indian tribal forest enterprise operations. 163.13 Section 163.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations...
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Indian tribal forest enterprise operations. 163.13 Section 163.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations...
25 CFR 163.4 - Secretarial recognition of tribal laws.
Code of Federal Regulations, 2010 CFR
2010-04-01
... REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the Secretary's trust responsibilities, and unless otherwise prohibited by Federal statutory law, the Secretary shall... 25 Indians 1 2010-04-01 2010-04-01 false Secretarial recognition of tribal laws. 163.4 Section 163...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Akulov, V A; Kablukov, S I; Babin, Sergei A
2012-02-28
This paper presents an experimental study of frequency doubling of a tunable ytterbium-doped fibre laser in KTP crystals phase-matched in the XY and YZ planes. In the XY plane, we obtained continuous tuning in the range 528 - 540 nm through intracavity frequency doubling. The second-harmonic power reached 450 mW for 18 W of multimode diode pump power, which was five times higher in comparison with single-pass frequency doubling. In a single-pass configuration in the YZ plane, we obtained a wide tuning range (527 - 551 nm) in the green spectral region and a second-harmonic power of {approx}10 mW. Themore » tuning range was only limited by the mechanical performance of the fibre Bragg grating and can potentially be extended to the entire lasing range of the ytterbium-doped fibre laser.« less
2015-02-11
RESPONSIBLE PERSON 19b. TELEPHONE NUMBER Liang Dong Fanting Kong,, Guancheng Gu,, Thomas W. Hawkins ,, Joshua Parsons, Maxwell Jones,, Christopher...Dunn,, Monica T. Kalichevsky-Dong,, Benjamin Pulford,, Iyad Dajani,, Kunimasa Saitoh,, Stephen P. Palese,, Eric Cheung,, Liang Dong c. THIS PAGE The...ytterbium-doped all-solid photonic bandgap fiber with ~1150µm2 effective mode area Fanting Kong,1,* Guancheng Gu,1 Thomas W. Hawkins ,1 Joshua Parsons
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2010 CFR
2010-04-01
... FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations... 25 Indians 1 2010-04-01 2010-04-01 false Indian tribal forest enterprise operations. 163.13... accordance with § 163.22. However, the Secretary may issue special instructions for payment by methods other...
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Indian tribal forest enterprise operations. 163.13 Section 163.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
19 CFR 163.5 - Methods for storage of records.
Code of Federal Regulations, 2012 CFR
2012-04-01
... standard business practice for storage of records include, but are not limited to, machine readable data... 19 Customs Duties 2 2012-04-01 2012-04-01 false Methods for storage of records. 163.5 Section 163... THE TREASURY (CONTINUED) RECORDKEEPING § 163.5 Methods for storage of records. (a) Original records...
19 CFR 163.5 - Methods for storage of records.
Code of Federal Regulations, 2011 CFR
2011-04-01
... standard business practice for storage of records include, but are not limited to, machine readable data... 19 Customs Duties 2 2011-04-01 2011-04-01 false Methods for storage of records. 163.5 Section 163... THE TREASURY (CONTINUED) RECORDKEEPING § 163.5 Methods for storage of records. (a) Original records...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 28 Judicial Administration 1 2014-07-01 2014-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 28 Judicial Administration 1 2012-07-01 2012-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 28 Judicial Administration 1 2011-07-01 2011-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 28 Judicial Administration 1 2013-07-01 2013-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
25 CFR 163.28 - Fire management measures.
Code of Federal Regulations, 2010 CFR
2010-04-01
... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... 25 Indians 1 2010-04-01 2010-04-01 false Fire management measures. 163.28 Section 163.28 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...
14 CFR 125.163 - Fire-extinguishing agents.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fire-extinguishing agents. 125.163 Section... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that... some other person using satisfactory recharging equipment. If carbon dioxide is used, it must not be...
25 CFR 163.16 - Forest product sales without advertisement.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest product sales without advertisement. 163.16 Section 163.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
The dawn of computer-assisted robotic osteotomy with ytterbium-doped fiber laser.
Sotsuka, Yohei; Nishimoto, Soh; Tsumano, Tomoko; Kawai, Kenichiro; Ishise, Hisako; Kakibuchi, Masao; Shimokita, Ryo; Yamauchi, Taisuke; Okihara, Shin-ichiro
2014-05-01
Currently, laser radiation is used routinely in medical applications. For infrared lasers, bone ablation and the healing process have been reported, but no laser systems are established and applied in clinical bone surgery. Furthermore, industrial laser applications utilize computer and robot assistance; medical laser radiations are still mostly conducted manually nowadays. The purpose of this study was to compare the histological appearance of bone ablation and healing response in rabbit radial bone osteotomy created by surgical saw and ytterbium-doped fiber laser controlled by a computer with use of nitrogen surface cooling spray. An Ytterbium (Yb)-doped fiber laser at a wavelength of 1,070 nm was guided by a computer-aided robotic system, with a spot size of 100 μm at a distance of approximately 80 mm from the surface. The output power of the laser was 60 W at the scanning speed of 20 mm/s scan using continuous wave system with nitrogen spray level 0.5 MPa (energy density, 3.8 × 10(4) W/cm(2)). Rabbits radial bone osteotomy was performed by an Yb-doped fiber laser and a surgical saw. Additionally, histological analyses of the osteotomy site were performed on day 0 and day 21. Yb-doped fiber laser osteotomy revealed a remarkable cutting efficiency. There were little signs of tissue damage to the muscle. Lased specimens have shown no delayed healing compared with the saw osteotomies. Computer-assisted robotic osteotomy with Yb-doped fiber laser was able to perform. In rabbit model, laser-induced osteotomy defects, compared to those by surgical saw, exhibited no delayed healing response.
Simultaneous effects of photo- and radio- darkening in ytterbium-doped aluminosilicate fibers
DOE Office of Scientific and Technical Information (OSTI.GOV)
Duchez, Jean-Bernard, E-mail: jbduchez@unice.fr; Mady, Franck, E-mail: jbduchez@unice.fr; Mebrouk, Yasmine, E-mail: jbduchez@unice.fr
2014-10-21
We present original characterizations of photo-radio-darkening in ytterbium-doped silica optical fibers submitted to the simultaneous action of the pump and of an ionizing radiation. We present the interplay between both radiations, showing e.g. that the pump is able to darken or bleach the fiber depending on the ionizing dose. The photo-resistance of the fiber is shown to play a crucial role on its radio-resistance, and that photo-resistant fibers should be also radio-resistant in low dose rate conditions. All the results are thoroughly explained by a physical model presented in a separate article by Mady et al. (this conference proceeding)
Ytterbium-doped glass-ceramics for optical refrigeration.
Filho, Elton Soares de Lima; Krishnaiah, Kummara Venkata; Ledemi, Yannick; Yu, Ye-Jin; Messaddeq, Younes; Nemova, Galina; Kashyap, Raman
2015-02-23
We report for the first time the characterization of glass-ceramics for optical refrigeration. Ytterbium-doped nanocrystallites were grown in an oxyfluoride glass matrix of composition 2YbF(3):30SiO(2)-15Al(2)O(3)-25CdF(2)-22PbF(2)-4YF(3), forming bulk glass-ceramics at three different crystalisation levels. The samples are compared with a corresponding uncrystalised (glass) sample, as well as a Yb:YAG sample which has presented optical cooling. The measured X-ray diffraction spectra, and thermal capacities of the samples are reported. We also report for the first time the use of Yb:YAG as a reference for absolute photometric quantum efficiency measurement, and use the same setup to characterize the glass and glass-ceramic samples. The cooling figure-of-merit was measured by optical calorimetry using a fiber Bragg grating and found to depend on the level of crystallization of the sample, and that samples with nanocrystallites result in higher quantum efficiency and lower background absorption than the pure-glass sample. In addition to laser-induced cooling, the glass-ceramics have the potential to serve as a reference for quantum efficiency measurements.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Borkowski, M.; Ciurylo, R.; Julienne, P. S.
2010-10-29
We study theoretically the properties of photoassociation spectra near the {sup 1}S{sub 0}-{sup 3}P{sub 1} inter-combination line of bosonic ytterbium. We construct a mass scaled model of the excited state interaction potential that well describes bound state energies obtained in a previous photoassociation experiment. We then use it to calculate theoretical photoassociation spectra in a range of ultracold temperatures using semianalytical theory developed by Bohn and Julienne.Photoassociation spectra not only give us the energies of excited bound states, but also provide information about the behavior of the ground state wavefunction. In fact, it can be shown that within the so-calledmore » reflection approximation the line intensity is proportional to the ground state wavefunction at the transition's Condon point. We show that in the case of ytterbium, the rotational structure of the photoassociation spectra depends heavily on the behavior of the ground-state wavefunction. The change of the scattering length from one isotope to another and the resulting occurence of shape resonances in higher partial waves determines the appearance and disapperance of rotational components, especially in the deeper lying states, whose respective Condon points lie near the ground state centrifugal barrier. Thus, photoassociation spectra differ qualitatively between isotopes.« less
Temperature measurements in an ytterbium fiber amplifier up to the mode instability threshold
NASA Astrophysics Data System (ADS)
Beier, F.; Heinzig, M.; Sattler, Bettina; Walbaum, Till; Haarlammert, N.; Schreiber, T.; Eberhardt, R.; Tünnermann, A.
2016-03-01
We report on the measurement of the longitudinal temperature distribution in a fiber amplifier fiber during high power operation. The measurement signal of an optical frequency domain reflectometer is coupled to an ytterbium doped amplifier fiber via a wavelength division multiplexer. The longitudinal temperature distribution was examined for different pump powers with a sub mm resolution. The results show even small temperature variations induced by slight changes of the environmental conditions along the fiber. The mode instability threshold of the fiber under investigation was determined to be 480W and temperatures could be measured overall the measured output power values.
NASA Astrophysics Data System (ADS)
Ab Razak, Mohd Zulhakimi; Saleh, Zatul Saliza; Ahmad, Fauzan; Anyi, Carol Livan; Harun, Sulaiman W.; Arof, Hamzah
2016-10-01
Due to an enormous potential of pulsed lasers in applications such as manufacturing, metrology, environmental sensing, and biomedical diagnostics, a high-power and stable Q-switched erbium-ytterbium codoped double-clad fiber laser (EYDFL) incorporating of multiwall carbon nanotubes (MWCNTs) saturable absorber (SA) made based on polyvinyl alcohol (PVA) with a 3∶2 ratio is demonstrated. The SA was fabricated by mixing a dilute PVA solution with an MWCNTs homogeneous solution. Subsequently, the mixture was sonicated and centrifuged to produce a homogeneous suspension that was left to dry at room temperature to form the MWCNTs-PVA film. The SA was formed by inserting the film between a pair of FC/PC fiber connectors. Then, it was integrated into the EYDFL's ring cavity, which uses a 5-m-long erbium-ytterbium codoped fiber (EYDF). The lasing threshold for the Q-switched EYDFL was at 330 mW. At the maximum available pump power of 900 mW, the proposed EYDFL produced Q-switched pulses with a repetition rate of 74.85 kHz, pulsewidth of ˜3.6 μs, and an average output power of about 5 mW. The maximum energy per pulse of ˜85 nJ was obtained at pump power of ˜700 mW with peak power of 21 mW.
Serum soluble CD163 levels in patients with influenza-associated encephalopathy.
Hasegawa, Shunji; Matsushige, Takeshi; Inoue, Hirofumi; Takahara, Midori; Kajimoto, Madoka; Momonaka, Hiroshi; Ishida, Chiemi; Tanaka, Saya; Morishima, Tsuneo; Ichiyama, Takashi
2013-08-01
Influenza-associated encephalopathy (IE) is a serious complication during influenza viral infection. Common clinical symptoms of IE include seizures and progressive coma with high-grade fever. We previously reported that hypercytokinemia and monocyte/macrophage activation may play an important role in the pathogenesis of IE. CD163 is a scavenger receptor for hemoglobin-haptoglobin complexes and is expressed by monocytes/macrophages. Proteolytic cleavage of monocyte-bound CD163 by matrix metalloproteinases releases soluble CD163 (sCD163). However, there have been no reports regarding serum sCD163 levels in IE patients. We measured serum levels of sCD163 as a marker of monocyte/macrophage activation in IE patients with poor outcomes, those without neurological sequelae, influenza patients without IE, and control subjects. Serum sCD163 levels were significantly higher in IE patients with poor outcomes than in those without neurological sequelae. In particular, sCD163 levels in cases of death were significantly higher than those in other cases. Our results suggest that monocyte/macrophage activation is related to the pathogenesis of severe IE. Copyright © 2012 The Japanese Society of Child Neurology. Published by Elsevier B.V. All rights reserved.
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk chocolate and vegetable fat coating. 163.155 Section 163.155 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Milk chocolate and vegetable fat coating. 163.155 Section 163.155 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2012-04-01 2010-04-01 true Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2013-04-01 2013-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2011-04-01 2010-04-01 true Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2014-04-01 2014-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
7 CFR 457.163 - Nursery peak inventory endorsement.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery peak inventory endorsement. 457.163 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.163 Nursery peak inventory endorsement. Nursery Crop Insurance Peak Inventory Endorsement This endorsement is not continuous and must be...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that one or more...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that one or more...
5 CFR 550.163 - Relationship to other payments.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Relationship to other payments. 550.163 Section 550.163 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... Relationship to other payments. (a) An employee receiving premium pay on an annual basis under § 550.141 may...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 163.145 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of the...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
Core-pumped mode-locked ytterbium-doped fiber laser operating around 980 nm
NASA Astrophysics Data System (ADS)
Zhou, Yue; Dai, Yitang; Li, Jianqiang; Yin, Feifei; Dai, Jian; Zhang, Tian; Xu, Kun
2018-07-01
In this letter, we first demonstrate a core-pumped passively mode-locked all-normal-dispersion ytterbium-doped fiber oscillator based on nonlinear polarization evolution operating around 980 nm. The dissipative soliton fiber laser pulse can be compressed down to 250 fs with 1 nJ pulse energy, and the slope efficiency of the oscillator can be as high as 19%. To improve the dissipative soliton laser output spectrum smoothness, we replace the birefringent plate based intracavity filter with a diffraction-grating based filter. The output pulse duration can then be further compressed down to 180 fs with improved spectral-smoothness. These schemes have potential applications in seeding cryogenic Yb:YLF amplifiers and underwater exploration of marine resources.
Expression of CD163 in the liver of patients with viral hepatitis.
Hiraoka, Atsushi; Horiike, Norio; Akbar, Sk Md Fazle; Michitaka, Kojiro; Matsuyama, Takami; Onji, Morikazu
2005-01-01
CD163 is a marker of activated macrophages, and increased levels of soluble CD163 have been detected in sera obtained from patients with hepatitis. The aim of this study was to detect the expression of CD163 in the liver from patients with viral hepatitis. Frozen sections of liver specimens were obtained from 5 patients with acute viral hepatitis (AH) and from 23 patients with chronic viral hepatitis (CH). The expression of CD163 in the liver was determined immunohistochemically using monoclonal antibody to human CD163. Double immunostaining was done to assess those cell types that express CD163 in the liver. The frequencies of CD163-positive cells were significantly higher both in the portal areas and in the hepatic lobules in the liver of patients with AH compared to those with CH (p < 0.05). Double immunostaining revealed that most of the CD163-positive cells were macrophages and Kupffer cells, because they expressed CD68. The expression of CD163 was very low in endothelial cells and liver stellate cells. This study shows that macrophages are activated in hepatitis liver.
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
25 CFR 163.26 - Forest product harvesting permits.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest product harvesting permits. 163.26 Section 163.26 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS... be used by the Secretary in his or her discretion for planting or other work to offset damage to the...
NASA Astrophysics Data System (ADS)
Herda, Robert; Zach, Armin
2015-03-01
We present an Erbium:Ytterbium codoped fiber-amplifer system based on Divided-Pulses-Amplification (DPA) for ultrashort pulses. The output from a saturable-absorber mode-locked polarization-maintaining (PM) fiber oscillator is amplified in a PM normal-dispersion Erbium-doped fiber. After this stage the pulses are positively chirped and have a duration of 2.0 ps at an average power of 93 mW. A stack of 5 birefringent Yttrium-Vanadate crystals divides these pulses 32 times. We amplify these pulses using a double-clad Erbium:Ytterbium codoped fiber pumped through a multimode fiber combiner. The pulses double pass the amplifier and recombine in the crystals using non-reciprocal polarization 90° rotation by a Faraday rotating mirror. Pulses with a duration of 144 fs are obtained after separation from the input beam using a polarizing beam splitter cube. These pulses have an average power of 1.85 W at a repetition rate of 80 MHz. The generation of femtosecond pulses directly from the amplifier was enabled by a positively chirped seed pulse, normally dispersive Yttrium-Vanadate crystals, and anomalously dispersive amplifier fibers. Efficient frequency doubling to 780 nm with an average power of 725 mW and a pulse duration of 156 fs is demonstrated. In summary we show a DPA setup that enables the generation of femtosecond pulses at watt-level at 1560 nm without the need for further external dechirping and demonstrate a good pulse quality by efficient frequency doubling. Due to the use of PM fiber components and a Faraday rotator the setup is environmentally stable.
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 7 2012-07-01 2012-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 7 2013-07-01 2013-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 7 2014-07-01 2014-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 6 2011-07-01 2011-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
Study of nonlinear liquid effects into ytterbium-doped fiber laser for multi-wavelength generation
NASA Astrophysics Data System (ADS)
Lozano-Hernandez, T.; Jauregui-Vazquez, D.; Estudillo-Ayala, J.; Herrera-Piad, L. A.; Rojas-Laguna, R.; Hernandez-Garcia, J. M.; Sierra-Hernandez, J. M.
2018-02-01
We present an experimental study of liquid refractive index effects into Ytterbium ring fiber laser cavity configuration. The laser is operated using a bi-tapered optical fiber immersed in water-alcohol concentrations. When the tapered fiber is dipped into a distilled water, a single lasing line with a peak power centered at 1025 nm is achieved. Afterward, by changing the polarization state into the cavity the lasing line can be switched. Moreover, by modifying the refractive index liquid surrounding media the lasing lines can be controlled and special liquid provide nonlinear response. The laser offers compactness, low effective cost and good stability.
Rovere, Andrea; Jeong, Young-Gyun; Piccoli, Riccardo; Lee, Seung-Heon; Lee, Seung-Chul; Kwon, O-Pil; Jazbinsek, Mojca; Morandotti, Roberto; Razzari, Luca
2018-02-05
We present the generation of high-peak-electric-field terahertz pulses via collinear optical rectification in a 2-(4-hydroxy-3-methoxystyryl)-1-methilquinolinium-2,4,6-trimethylbenzenesulfonate (HMQ-TMS) organic crystal. The crystal is pumped by an amplified ytterbium laser system, emitting 170-fs-long pulses centered at 1030 nm. A terahertz peak electric field greater than 200 kV/cm is obtained for 420 µJ of optical pump energy, with an energy conversion efficiency of 0.26% - about two orders of magnitude higher than in common inorganic crystals collinearly pumped by amplified femtosecond lasers. An open-aperture Z-scan measurement performed on an n-doped InGaAs thin film using such terahertz source shows a nonlinear increase in the terahertz transmission of about 2.2 times. Our findings demonstrate the potential of this terahertz generation scheme, based on ytterbium laser technology, as a simple and efficient alternative to the existing intense table-top terahertz sources. In particular, we show that it can be readily used to explore nonlinear effects at terahertz frequencies.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Koptev, M Yu; Anashkina, E A; Lipatov, D S
2015-05-31
We report a new ytterbium-doped active tapered fibre used in the output amplifier stage of a fibre laser system for the generation of megawatt peak power ultrashort pulses in the microjoule energy range. The tapered fibre is single-mode at its input end (core and cladding diameters of 10 and 80 μm) and multimode at its output end (diameters of 45 and 430 μm), but ultrashort pulses are amplified in a quasi-single-mode regime. Using a hybrid Er/Yb fibre system comprising an erbium master oscillator and amplifier at a wavelength near 1.5 μm, a nonlinear wavelength converter to the 1 μm rangemore » and a three-stage ytterbium-doped fibre amplifier, we obtained pulses of 1 μJ energy and 7 ps duration, which were then compressed by a grating-pair dispersion compressor with 60% efficiency to a 130 fs duration, approaching the transform-limited pulse duration. The present experimental data agree well with numerical simulation results for pulse amplification in the threestage amplifier. (extreme light fields and their applications)« less
Pulsed ytterbium-doped fibre laser with a combined modulator based on single-wall carbon nanotubes
DOE Office of Scientific and Technical Information (OSTI.GOV)
Khudyakov, D V; Borodkin, A A; Vartapetov, S K
2015-09-30
This paper describes an all-normal-dispersion pulsed ytterbium-doped fibre ring laser mode-locked by a nonlinear combined modulator based on single-wall carbon nanotubes. We have demonstrated 1.7-ps pulse generation at 1.04 μm with a repetition rate of 35.6 MHz. At the laser output, the pulses were compressed to 180 fs. We have examined an intracavity nonlinear modulator which utilises nonlinear polarisation ellipse rotation in conjunction with a saturable absorber in the form of a polymer-matrix composite film containing single-wall carbon nanotubes. (lasers)
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 29 Labor 5 2013-07-01 2013-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163 Section 1910.163 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Fixed Fire Suppression Equipment § 1910.163 Fixed...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2013 CFR
2013-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2013-01-01 2013-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2011 CFR
2011-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2011-01-01 2011-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2012 CFR
2012-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2012-01-01 2012-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2014 CFR
2014-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2014-01-01 2014-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2010 CFR
2010-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2010-01-01 2010-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
Phosphate ytterbium-doped single-mode all-solid photonic crystal fiber with output power of 13.8 W
Wang, Longfei; He, Dongbing; Feng, Suya; Yu, Chunlei; Hu, Lili; Qiu, Jianrong; Chen, Danping
2015-01-01
Single-mode ytterbium-doped phosphate all-solid photonic crystal fiber (AS-PCF) with 13.8 W output power and 32% slope efficiency was reported. By altering the diameter of the rods around the doped core and thus breaking the symmetry of the fiber, a polarization-maintaining AS-PCF with degree of polarization of >85% was also achieved, for the first time to knowledge, in a phosphate PCF. PMID:25684731
46 CFR 163.003-27 - Production tests and examination.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.003-27 Section 163... examination. (a) General. Each ladder produced under Coast Guard approval must be tested in accordance with... for effective monitoring throughout the production schedule. (e) Visual examination. The visual...
CXCL4 downregulates the atheroprotective hemoglobin receptor CD163 in human macrophages.
Gleissner, Christian A; Shaked, Iftach; Erbel, Christian; Böckler, Dittmar; Katus, Hugo A; Ley, Klaus
2010-01-08
CXCL4 is a platelet-derived chemokine that promotes macrophage differentiation from monocytes. Deletion of the PF4 gene that encodes CXCL4 reduces atherosclerotic lesions in ApoE(-/-) mice. We sought to study effects of CXCL4 on macrophage differentiation with possible relevance for atherogenesis. Flow cytometry for expression of surface markers in macrophage colony-stimulating factor (M-CSF)- and CXCL4-induced macrophages demonstrated virtually complete absence of the hemoglobin scavenger receptor CD163 in CXCL4-induced macrophages. mRNA for CD163 was downregulated as early as 2 hours after CXCL4. CD163 protein reached a minimum after 3 days, which was not reversed by treatment of cells with M-CSF. The CXCL4 effect was entirely neutralized by heparin, which bound CXCL4 and prevented CXCL4 surface binding to monocytes. Pretreatment of cells with chlorate, which inhibits glycosaminoglycan synthesis, strongly inhibited CXCL4-dependent downregulation of CD163. Similar to recombinant CXCL4, releasate from human platelets also reduced CD163 expression. CXCL4-differentiated macrophages were unable to upregulate the atheroprotective enzyme heme oxygenase-1 at the RNA and protein level in response to hemoglobin-haptoglobin complexes. Immunofluorescence of human atherosclerotic plaques demonstrated presence of both CD68+CD163+ and CD68+CD163- macrophages. PF4 and CD163 gene expression within human atherosclerotic lesions were inversely correlated, supporting the in vivo relevance of CXCL4-induced downregulation of CD163. CXCL4 may promote atherogenesis by suppressing CD163 in macrophages, which are then unable to upregulate the atheroprotective enzyme heme oxygenase-1 in response to hemoglobin.
CXCL4 Downregulates the Atheroprotective Hemoglobin Receptor CD163 in Human Macrophages
Gleissner, Christian A.; Shaked, Iftach; Erbel, Christian; Böckler, Dittmar; Katus, Hugo A.; Ley, Klaus
2010-01-01
Rationale CXCL4 is a platelet-derived chemokine that promotes macrophage differentiation from monocytes. Deletion of the PF4 gene that encodes CXCL4 reduces atherosclerotic lesions in ApoE−/− mice. Objective We sought to study effects of CXCL4 on macrophage differentiation with possible relevance for atherogenesis. Methods and Results Flow cytometry for expression of surface markers in macrophage colony–stimulating factor (M-CSF)– and CXCL4-induced macrophages demonstrated virtually complete absence of the hemoglobin scavenger receptor CD163 in CXCL4-induced macrophages. mRNA for CD163 was downregulated as early as 2 hours after CXCL4. CD163 protein reached a minimum after 3 days, which was not reversed by treatment of cells with M-CSF. The CXCL4 effect was entirely neutralized by heparin, which bound CXCL4 and prevented CXCL4 surface binding to monocytes. Pretreatment of cells with chlorate, which inhibits glycosaminoglycan synthesis, strongly inhibited CXCL4-dependent downregulation of CD163. Similar to recombinant CXCL4, releasate from human platelets also reduced CD163 expression. CXCL4-differentiated macrophages were unable to upregulate the atheroprotective enzyme heme oxygenase-1 at the RNA and protein level in response to hemoglobin–haptoglobin complexes. Immunofluorescence of human atherosclerotic plaques demonstrated presence of both CD68+CD163+ and CD68+CD163− macrophages. PF4 and CD163 gene expression within human atherosclerotic lesions were inversely correlated, supporting the in vivo relevance of CXCL4-induced downregulation of CD163. Conclusions CXCL4 may promote atherogenesis by suppressing CD163 in macrophages, which are then unable to upregulate the atheroprotective enzyme heme oxygenase-1 in response to hemoglobin. PMID:19910578
21 CFR 522.163 - Betamethasone dipropionate and betamethasone sodium phosphate aqueous suspension.
Code of Federal Regulations, 2010 CFR
2010-04-01
... sodium phosphate aqueous suspension. 522.163 Section 522.163 Food and Drugs FOOD AND DRUG ADMINISTRATION... INJECTABLE DOSAGE FORM NEW ANIMAL DRUGS § 522.163 Betamethasone dipropionate and betamethasone sodium phosphate aqueous suspension. (a) Specifications. Betamethasone dipropionate and betamethasone sodium...
Multi-Wavelength Q-Switched Ytterbium-Doped Fiber Laser with Multi-Walled Carbon Nanotubes
NASA Astrophysics Data System (ADS)
Al-Masoodi, A. H. H.; Ahmed, M. H. M.; Arof, H.; Harun, S. W.
2018-03-01
We demonstrate a passively multi-wavelength Q-switched Ytterbium-doped fiber laser (YDFL) based on a multi-wall carbon nanotubes embedded in polyethylene oxide film as saturable absorber. The YDFL generates a stable multi-wavelength with spacing of 1.9 nm as the 980 nm pump power is fixed within 62. 4 mW and 78.0 mW. The repetition rate of the laser is tunable from 10.41 to 29.04 kHz by increasing the pump power from the threshold power of 62.4 mW to 78 mW. At 78 mW pump power, the maximum pulse energy of 38 nJ and the shortest pulse width of 8.87 µs are obtained.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Nelson, A J; van Buuren, T; Bostedt, C
X-ray photoemission and x-ray photoabsorption were used to study the composition and the electronic structure of ytterbium doped strontium fluoroapatite (Yb:S-FAP). High resolution photoemission measurements on the valence band electronic structure was used to evaluate the density of occupied states of this fluoroapatite. Element specific density of unoccupied electronic states in Yb:S-FAP were probed by x-ray absorption spectroscopy (XAS) at the Yb 4d (N{sub 4,5}-edge), Sr 3d (M{sub 4,5}-edge), P 2p (L{sub 2,3}-edge), F 1s and O 1s (K-edges) absorption edges. These results provide the first measurements of the electronic structure and surface chemistry of this material.
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 49 Transportation 7 2014-10-01 2014-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 49 Transportation 7 2013-10-01 2013-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 49 Transportation 7 2012-10-01 2012-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 49 Transportation 7 2011-10-01 2011-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
Control of pulse format in high energy per pulse all-fiber erbium/ytterbium laser systems
NASA Astrophysics Data System (ADS)
Klopfer, Michael; Block, Matthew K.; Deffenbaugh, James; Fitzpatrick, Zak G.; Urioste, Michael T.; Henry, Leanne J.; Jain, Ravinder
2017-02-01
A multi-stage linearly polarized (PM) (15 dB) pulsed fiber laser system at 1550 nm capable of operating at repetition rates between 3 and 20 kHz was investigated. A narrow linewidth seed source was linewidth broadened to approximately 20 GHz and pulses were created and shaped via an electro-optic modulator (EOM) in conjunction with a home built arbitrary waveform generator. As expected, a high repetition rate pulse train with a near diffraction limited beam quality (M2 1.12) was achieved. However, the ability to store energy was limited by the number of active ions within the erbium/ytterbium doped gain fiber within the various stages. As a result, the maximum energy per pulse achievable from the system was approximately 0.3 and 0.38 mJ for 300 ns and 1 μs pulses, respectively, at 3 kHz. Because the system was operated at high inversion, the erbium/ytterbium doped optical fiber preferred to lase at 1535 nm versus 1550 nm resulting in amplified spontaneous emission (ASE) both intra- and inter-pulse. For the lower power stages, the ASE was controllable via a EOM whose function was to block the energy between pulses as well as ASE filters whose purpose was to block spectral components outside of the 1550 nm passband. For the higher power stages, the pump diodes were pulsed to enable strategic placement of an inversion resulting in higher intrapulse energies as well as an improved spectrum of the signal. When optimized, this system will be used to seed higher power solid state amplifier stages.
NASA Astrophysics Data System (ADS)
Bykovskiy, D. P.; Petrovskii, V. N.; Uspenskiy, S. A.
2015-03-01
The vapour-plasma plume produced in the welding of 6-mm thick VT-23 titanium alloy plates by ytterbium fibre laser radiation of up to 10 kW power is studied in the protective Ar gas medium. High-speed video filming of the vapour-plasma plume is used to visualise the processes occurring during laser welding. The coefficient of inverse bremsstrahlung by the welding plasma plume is calculated from the data of the spectrometric study.
26 CFR 1.163-9T - Personal interest (temporary).
Code of Federal Regulations, 2010 CFR
2010-04-01
... computing income or loss from a passive activity of the taxpayer, (iv) Any qualified residence interest (within the meaning of section 163(h)(3) and § 1.163-10T), and (v) Any interest payable under section 6601...-10T for rules concerning qualified residence interest. (c) Effective date—(1) In general. The...
A luminescent ytterbium(III)-organic framework for highly selective sensing of 2,4,6-trinitrophenol
NASA Astrophysics Data System (ADS)
Xin, Xuelian; Zhang, Minghui; Ji, Shijie; Dong, Hanxiao; Zhang, Liangliang
2018-06-01
An ytterbium(III)-organic framework, [Yb4(abtc)3(HCOO) (H2O)]·(C2H8N) (H2O) (UPC-22, H4abtc = 3,3‧,5,5‧-azobenzene-tetracarboxylic acid) was synthesized under solvothermal conditions and characterized. UPC-22 exhibited strong H4abtc-based luminescence and can be used for sensing nitroaromatic compounds (NACs) in an ethanol suspension with outstanding selectivity and sensitivity. The most striking property of UPC-22 is its ability to selectively detect 2,4,6-trinitrophenol (TNP), thereby rendering it a promising TNP-selective luminescence probe.
49 CFR 37.163 - Keeping vehicle lifts in operative condition: Public entities.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 49 Transportation 1 2014-10-01 2014-10-01 false Keeping vehicle lifts in operative condition: Public entities. 37.163 Section 37.163 Transportation Office of the Secretary of Transportation TRANSPORTATION SERVICES FOR INDIVIDUALS WITH DISABILITIES (ADA) Provision of Service § 37.163 Keeping vehicle lifts in operative condition: Public entities. ...
49 CFR 37.163 - Keeping vehicle lifts in operative condition: Public entities.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 49 Transportation 1 2013-10-01 2013-10-01 false Keeping vehicle lifts in operative condition: Public entities. 37.163 Section 37.163 Transportation Office of the Secretary of Transportation TRANSPORTATION SERVICES FOR INDIVIDUALS WITH DISABILITIES (ADA) Provision of Service § 37.163 Keeping vehicle lifts in operative condition: Public entities. ...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Nelson, Art J.; Van Buuren, Tony W.; Bostedt, C
X-ray photoemission and x-ray photoabsorption were used to study the composition and the electronic structure of ytterbium-doped strontium fluoroapatite (Yb:S-FAP). High resolution photoemission measurements on the valence band electronic structure and Sr 3d, P 2p and 2s, Yb 4d and 4p, F 1s and O 1s core lines were used to evaluate the surface and near surface chemistry of this fluoroapatite. Element specific density of unoccupied electronic states in Yb:S-FAP were probed by x-ray absorption spectroscopy (XAS) at the Yb 4d (N4,5-edge), Sr 3d (M4,5-edge), P 2p (L2,3-edge), F 1s and O 1s (K-edges) absorption edges. These results provide themore » first measurements of the electronic structure and surface chemistry of this material.« less
21 CFR 163.114 - Lowfat cocoa.
Code of Federal Regulations, 2011 CFR
2011-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a... that the cacao fat content is less than 10 percent by weight, as determined by the method prescribed in...
Code of Federal Regulations, 2013 CFR
2013-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2011 CFR
2011-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2014 CFR
2014-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2012 CFR
2012-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2010 CFR
2010-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2011 CFR
2011-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2011-04-01 2011-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2014 CFR
2014-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2014-04-01 2014-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2013 CFR
2013-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2013-04-01 2013-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2012 CFR
2012-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2012-04-01 2011-04-01 true How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2010 CFR
2010-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2010-04-01 2010-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Annual funding needs assessment and rating. 163.62 Section... REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment from ANCSA...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Bykovskiy, D P; Petrovskii, V N; Uspenskiy, S A
2015-03-31
The vapour-plasma plume produced in the welding of 6-mm thick VT-23 titanium alloy plates by ytterbium fibre laser radiation of up to 10 kW power is studied in the protective Ar gas medium. High-speed video filming of the vapour-plasma plume is used to visualise the processes occurring during laser welding. The coefficient of inverse bremsstrahlung by the welding plasma plume is calculated from the data of the spectrometric study. (interaction of laser radiation with matter)
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... specified dairy ingredient. (b) Optional ingredients. (1) Safe and suitable vegetable derived fats, oils...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... specified dairy ingredient. (b) Optional ingredients. (1) Safe and suitable vegetable derived fats, oils...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... specified dairy ingredient. (b) Optional ingredients. (1) Safe and suitable vegetable derived fats, oils...
Code of Federal Regulations, 2010 CFR
2010-01-01
... PROCEDURES FOR PRODUCTS AND PARTS Production Certificates § 21.163 Privileges. (a) The holder of a production... Administrator may inspect the aircraft for conformity with the type design; or (2) In the case of other products... § 147.3 of this chapter, the holder of a production certificate for a primary category aircraft, or for...
Soluble CD163 is increased in patients with acute pancreatitis independent of disease severity.
Karrasch, Thomas; Brünnler, Tanja; Hamer, Okka W; Schmid, Karin; Voelk, Markus; Herfarth, Hans; Buechler, Christa
2015-10-01
Macrophages are crucially involved in the pathophysiology of acute pancreatitis. Soluble CD163 (sCD163) is specifically released from macrophages and systemic levels are increased in inflammatory diseases. Here, sCD163 was measured in serum of 50 patients with acute pancreatitis to find out possible associations with disease activity. Admission levels of systemic sCD163 were nearly three-fold higher in patients with acute pancreatitis compared to controls. In patients sCD163 did not correlate with C-reactive protein and leukocyte count as established markers of inflammation. Levels were not associated with disease severity assessed by the Schroeder score, Balthazar score, Acute Physiology, Age, and Chronic Health Evaluation (Apache) II score and peripancreatic necrosis score. Soluble CD163 was not related to complications of acute pancreatitis. These data show that serum sCD163 is increased in acute pancreatitis indicating activation of macrophages but is not associated with disease severity and outcome. Copyright © 2015 Elsevier Inc. All rights reserved.
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...) Safe and suitable vegetable derived oils, fats, and stearins other than cacao fat. The oils, fats, and...
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...) Safe and suitable vegetable derived oils, fats, and stearins other than cacao fat. The oils, fats, and...
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...) Safe and suitable vegetable derived oils, fats, and stearins other than cacao fat. The oils, fats, and...
NASA Astrophysics Data System (ADS)
Eliseev, S.; Blaum, K.; Block, M.; Chenmarev, S.; Dorrer, H.; Düllmann, Ch. E.; Enss, C.; Filianin, P. E.; Gastaldo, L.; Goncharov, M.; Köster, U.; Lautenschläger, F.; Novikov, Yu. N.; Rischka, A.; Schüssler, R. X.; Schweikhard, L.; Türler, A.
2015-08-01
The atomic mass difference of 163 and 163Dy has been directly measured with the Penning-trap mass spectrometer SHIPTRAP applying the novel phase-imaging ion-cyclotron-resonance technique. Our measurement has solved the long-standing problem of large discrepancies in the Q value of the electron capture in 163Ho determined by different techniques. Our measured mass difference shifts the current Q value of 2555(16) eV evaluated in the Atomic Mass Evaluation 2012 [G. Audi et al., Chin. Phys. C 36, 1157 (2012)] by more than 7 σ to 2833 (30stat)(15sys) eV /c2 . With the new mass difference it will be possible, e.g., to reach in the first phase of the ECHo experiment a statistical sensitivity to the neutrino mass below 10 eV, which will reduce its present upper limit by more than an order of magnitude.
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2010 CFR
2010-10-01
... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each... defects affecting its strength or durability. (c) Wood preservative. After each wooden part is formed and...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Sweet cocoa and vegetable fat coating. 163.150... § 163.150 Sweet cocoa and vegetable fat coating. (a) Description. Sweet cocoa and vegetable fat coating...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Sweet cocoa and vegetable fat coating. 163.150... § 163.150 Sweet cocoa and vegetable fat coating. (a) Description. Sweet cocoa and vegetable fat coating...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Sweet cocoa and vegetable fat coating. 163.150... § 163.150 Sweet cocoa and vegetable fat coating. (a) Description. Sweet cocoa and vegetable fat coating...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
NASA Astrophysics Data System (ADS)
Uspenskiy, S. A.; Petrovskiy, V. N.; Bykovskiy, D. P.; Mironov, V. D.; Prokopova, N. M.; Tret'yakov, E. V.
2015-03-01
This work is devoted to the research of welding plume during high power ytterbium fiber laser welding of a titanium alloy in the Ar shielding gas environment. High speed video observation of a vapor-plasma plume for visualization of processes occurring at laser welding was carried out. The coefficient of the inverse Bremsstrahlung absorption of laser radiation is calculated for a plasma welding plume by results of spectrometer researches. The conclusion deals with the impact of plasma on a high-power fiber laser radiation.
20 CFR 655.163 - Certification fee.
Code of Federal Regulations, 2011 CFR
2011-04-01
... Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF FOREIGN WORKERS IN THE UNITED STATES Labor Certification Process for Temporary Agricultural Employment in the United States (H-2A Workers) Labor Certification Determinations § 655.163 Certification fee. A...
Development of trivalent ytterbium doped fluorapatites for diode-pumped laser applications
NASA Astrophysics Data System (ADS)
Bayramian, Andrew James
2000-11-01
A major motivator of this work is the Mercury Project, a one kilowatt diode-pumped solid-state laser system under development at Lawrence Livermore National Laboratory (LLNL), which incorporates ytterbium doped strontium fluorapatite, Sr5(PO4)3F (S-FAP), as the amplifier gain medium. The primary focus of this thesis is a full understanding of the properties of this material, which is necessary for proper design and modeling of the system. Ytterbium-doped fluorapatites were investigated at LLNL prior to this work and found to be ideal candidate materials for high-power amplifier systems providing high absorption and emission cross sections, long radiative lifetimes, and high efficiency. A family of barium substituted S-FAP crystals was grown in an effort to modify the pump and emission bandwidths for application to broadband diode pumping and short pulse generation. Crystals of Yb 3+:Srs5-xBax(PO4) 3F where x < 1 showed homogeneous lines offering 8.4 nm (1.8X enhancement) of absorption bandwidth and 6.9 nm (1.4X enhancement) of emission bandwidth. The gain saturation fluence of Yb:S-FAP was measured to be 3.2 J/cm 2 with homogeneous extraction using a pump-probe experiment where the probe laser was a high intensity Q-switched master oscillator power amplifier system. The crystal quality of Czochralski grown Yb:S-FAP boules, which is effected by defects such as cracking, cloudiness, bubble core, slip dislocations, and anomalous absorption, was investigated interferometrically and quantified by means of Power Spectral Density (PSD) plots. Stimulated Raman Scattering (SRS) losses were evaluated by first measuring the SRS gain coefficient to be 1.3 cm/GW, then modeling the losses in the Mercury amplifier system. Countermeasures including the addition of bandwidth to the extraction beam and wedging of amplifier surfaces are shown to reduce the SRS losses allowing efficient laser gain extraction at higher intensities. Finally, an efficient Q-switched Yb:S-FAP oscillator
25 CFR 163.12 - Harvesting restrictions.
Code of Federal Regulations, 2014 CFR
2014-04-01
... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest land will not be permitted unless provisions for natural and/or artificial reforestation of acceptable tree...
Moeller, Jesper B; Nielsen, Marianne J; Reichhardt, Martin P; Schlosser, Anders; Sorensen, Grith L; Nielsen, Ole; Tornøe, Ida; Grønlund, Jørn; Nielsen, Maria E; Jørgensen, Jan S; Jensen, Ole N; Mollenhauer, Jan; Moestrup, Søren K; Holmskov, Uffe
2012-03-01
CD163-L1 belongs to the group B scavenger receptor cysteine-rich family of proteins, where the CD163-L1 gene arose by duplication of the gene encoding the hemoglobin scavenger receptor CD163 in late evolution. The current data demonstrate that CD163-L1 is highly expressed and colocalizes with CD163 on large subsets of macrophages, but in contrast to CD163 the expression is low or absent in monocytes and in alveolar macrophages, glia, and Kupffer cells. The expression of CD163-L1 increases when cultured monocytes are M-CSF stimulated to macrophages, and the expression is further increased by the acute-phase mediator IL-6 and the anti-inflammatory mediator IL-10 but is suppressed by the proinflammatory mediators IL-4, IL-13, TNF-α, and LPS/IFN-γ. Furthermore, we show that CD163-L1 is an endocytic receptor, which internalizes independently of cross-linking through a clathrin-mediated pathway. Two cytoplasmic splice variants of CD163-L1 are differentially expressed and have different subcellular distribution patterns. Despite its many similarities to CD163, CD163-L1 does not possess measurable affinity for CD163 ligands such as the haptoglobin-hemoglobin complex or various bacteria. In conclusion, CD163-L1 exhibits similarity to CD163 in terms of structure and regulated expression in cultured monocytes but shows clear differences compared with the known CD163 ligand preferences and expression pattern in the pool of tissue macrophages. We postulate that CD163-L1 functions as a scavenger receptor for one or several ligands that might have a role in resolution of inflammation.
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Cocoa with dioctyl sodium sulfosuccinate for manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific...
NASA Astrophysics Data System (ADS)
Yeh, Chien-Hung; Tsai, Ning; Zhuang, Yuan-Hong; Chow, Chi-Wai; Chen, Jing-Heng
2017-02-01
In this demonstration, to achieve stabilized and wavelength-selectable single-longitudinal-mode (SLM) erbium-doped fiber (EDF) laser, a short length of ytterbium-doped fiber (YDF) is utilized to serve as a spatial multi-mode interference (MMI) inside a fiber cavity for suppressing multi-longitudinal-mode (MLM) significantly. In the measurement, the output powers and optical signal to noise ratios (OSNRs) of proposed EDF ring laser are measured between -9.85 and -5.71 dBm; and 38.03 and 47.95 dB, respectively, in the tuning range of 1530.0-1560.0 nm. In addition, the output SLM and stability performance are also analyzed and discussed experimentally.
NASA Astrophysics Data System (ADS)
Golovanova, O. A.; Tropin, O. A.; Volkovich, V. A.
2017-09-01
The redox behavior of samarium, europium and ytterbium ions was investigated in the ternary 6NaCl-9KCl- 5CsCl eutectic based melts between 823 and 1073 K employing cyclic voltammetry on a tungsten working electrode. Ln(II)/Ln(III) (Ln=Sm, Eu, Yb) reduction-oxidation is reversible and controlled by diffusion of the electroactive species at the potential scan rates up to 0.1 V/s. Formal standard redox potentials E*Ln(II)/Ln(III) were determined, and the thermodynamic and transport properties of the corresponding Ln(III) and Ln(II) ions were estimated.
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2010 CFR
2010-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
25 CFR 163.40 - Indian and Alaska Native forestry education assistance.
Code of Federal Regulations, 2010 CFR
2010-04-01
.... 163.40 Section 163.40 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER..., professional Indians and Alaska Natives in the management of Indian and Alaska Native forest land. In keeping... forestry-related field which could include courses on indigenous culture; and (iii) To create an...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2012 CFR
2012-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2013 CFR
2013-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2014 CFR
2014-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
Chow, Hiu Tung; Ng, Danny W-K
2017-04-12
Small RNAs are important regulators for a variety of biological processes, including leaf development, flowering-time, embryogenesis and defense responses. miR163 is a non-conserved miRNA and its locus has evolved recently through inverted duplication of its target genes to which they belong to the SABATH family of related small-molecule methyltransferases (MTs). In Arabidopsis thaliana, previous study demonstrated that miR163 accumulation was induced by alamethicin treatment, suggesting its roles in defense response pathways. Enhanced resistance against Pseudomonas syringae pv. tomato (Pst) was observed in the mir163 mutant, whereas transgenic lines overexpressing miR163 showed increase sensitivity to Pst, suggesting that miR163 is a negative regulator of defense response. Elevated level of miR163 and its targets in A. thaliana were observed upon Pst treatment, suggesting a modulating relationship between miR163 and its targets. In addition, miR163 and histone deacetylase were found to act cooperatively in mediating defense against Pst. Transgenic plants overexpressing miR163-resistant targets suggested their different contributions in defense. Results from this study revealed that the stress-inducible miR163 and its targets act in concert to modulate defense responses against bacterial pathogen in A. thaliana.
Kinetic Monte Carlo Simulation of Oxygen Diffusion in Ytterbium Disilicate
NASA Technical Reports Server (NTRS)
Good, Brian S.
2015-01-01
Silicon-based ceramic components for next-generation jet turbine engines offer potential weight savings, as well as higher operating temperatures, both of which lead to increased efficiency and lower fuel costs. Silicon carbide (SiC), in particular, offers low density, good strength at high temperatures, and good oxidation resistance in dry air. However, reaction of SiC with high-temperature water vapor, as found in the hot section of jet turbine engines in operation, can cause rapid surface recession, which limits the lifetime of such components. Environmental Barrier Coatings (EBCs) are therefore needed if long component lifetime is to be achieved. Rare earth silicates such as Yb2Si2O7 and Yb2SiO5 have been proposed for such applications; in an effort to better understand diffusion in such materials, we have performed kinetic Monte Carlo (kMC) simulations of oxygen diffusion in Ytterbium disilicate, Yb2- Si2O7. The diffusive process is assumed to take place via the thermally activated hopping of oxygen atoms among oxygen vacancy sites or among interstitial sites. Migration barrier energies are computed using density functional theory (DFT).
Spin-orbit-coupled Fermi gases of two-electron ytterbium atoms
NASA Astrophysics Data System (ADS)
He, Chengdong; Song, Bo; Haciyev, Elnur; Ren, Zejian; Seo, Bojeong; Zhang, Shanchao; Liu, Xiong-Jun; Jo, Gyu-Boong
2017-04-01
Spin-orbit coupling (SOC) has been realized in bosonic and fermionic atomic gases opening an avenue to novel physics associated with spin-momentum locking. In this talk, we will demonstrate all-optical method coupling two hyperfine ground states of 173Yb fermions through a narrow optical transition 1S0 -> 3P1. An optical AC Stark shift is applied to split the ground hyperfine levels and separate out an effective spin-1/2 subspace from other spin states for the realization of SOC. The spin dephasing dynamics and the asymmetric momentum distribution of the spin-orbit coupled Fermi gas are observed as a hallmark of SOC. The implementation of all-optical SOC for ytterbium fermions should offer a new route to a long-lived spin-orbit coupled Fermi gas and greatly expand our capability in studying novel spin-orbit physics with alkaline-earth-like atoms. Other ongoing experimental works related to SOC will be also discussed. Funded by Croucher Foundation and Research Grants Council (RGC) of Hong Kong (Project ECS26300014, GRF16300215, GRF16311516, and Croucher Innovation Grants); MOST (Grant No. 2016YFA0301604) and NSFC (No. 11574008).
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 10 Energy 1 2014-01-01 2014-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 10 Energy 1 2011-01-01 2011-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2013 CFR
2013-01-01
... 10 Energy 1 2013-01-01 2013-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2012 CFR
2012-01-01
... 10 Energy 1 2012-01-01 2012-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
NASA Astrophysics Data System (ADS)
Gastaldo, L.; Ranitzsch, P. C.-O.; von Seggern, F.; Porst, J.-P.; Schäfer, S.; Pies, C.; Kempf, S.; Wolf, T.; Fleischmann, A.; Enss, C.; Herlert, A.; Johnston, K.
2013-05-01
For the first time we have investigated the behavior of fully micro-fabricated low temperature metallic magnetic calorimeters (MMCs) after undergoing an ion-implantation process. This experiment had the aim to show the possibility to perform a high precision calorimetric measurement of the energy spectrum following the electron capture of 163Ho using MMCs having the radioactive 163Ho ions implanted in the absorber. The isotope 163Ho decays through electron capture to 163Dy and features the smallest known QEC value. This peculiarity makes 163Ho a very interesting candidate to investigate the value of the electron neutrino mass by the analysis of the energy spectrum. The implantation of 163Ho ions was performed at ISOLDE-CERN. The performance of a detector that underwent an ion-implantation process is compared to the one of a detector without implanted ions. The results show that the implantation dose of ions used in this experiment does not compromise the properties of the detector. Moreover the performance of the detector prototype having the 163Ho ions implanted in the absorber is already close to the requirements needed for an experiment with sub-eV sensitivity to the electron neutrino mass. Based on these results, an optimized detector design for future 163Ho experiments is presented.
Polfliet, Machteld M J; Fabriek, Babs O; Daniëls, Wouter P; Dijkstra, Christine D; van den Berg, Timo K
2006-01-01
The monoclonal antibody ED2 is widely used to define macrophages (mphi) in the rat. We have recently identified the ED2 antigen as the rat CD163 glycoprotein. CD163 is a member of the scavenger receptor cysteine-rich group B (SRCR-B) family and functions as a scavenger receptor for hemoglobin-haptoglobin complexes. Moreover, CD163 has also been indicated as a marker for alternatively activated mphi. In the current study, we identify rat CD163/ED2-antigen as a marker for mature tissue mphi. Rat CD163 is constitutively expressed on most subpopulations of mature tissue mphi, including splenic red pulp mphi, thymic cortical mphi, Kupffer cells in the liver, resident bone marrow mphi and central nervous system perivascular and meningeal mphi, but is apparently absent from monocytes. Rat CD163 expression can be promoted by glucocorticoids, and this can be further enhanced by IL4. Finally, engagement of rat CD163 on peritoneal mphi induces the production of pro-inflammatory mediators, including NO, IL-1beta, IL-6 and TNF-alpha. Collectively, our findings identify rat CD163 as a broadly expressed macrophage scavenger receptor that may play a role in the activation of mphi during hemolytic and/or inflammatory conditions.
25 CFR 163.19 - Contracts for the sale of forest products.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Contracts for the sale of forest products. 163.19 Section... REGULATIONS Forest Management and Operations § 163.19 Contracts for the sale of forest products. (a) In sales of forest products with an appraised stumpage value exceeding $15,000, the contract forms approved by...
Development of Holmium-163 electron-capture spectroscopy with transition-edge sensors
Croce, Mark Philip; Rabin, Michael W.; Mocko, Veronika; ...
2016-08-01
Calorimetric decay energy spectroscopy of electron-capture-decaying isotopes is a promising method to achieve the sensitivity required for electron neutrino mass measurement. The very low total nuclear decay energy (Q EC < 3 keV) and short half-life (4570 years) of 163Ho make it attractive for high-precision electron-capture spectroscopy (ECS) near the kinematic endpoint, where the neutrino momentum goes to zero. In the ECS approach, an electron-capture-decaying isotope is embedded inside a microcalorimeter designed to capture and measure the energy of all the decay radiation except that of the escaping neutrino. We have developed a complete process for proton irradiation-based isotope production,more » isolation, and purification of 163Ho. We have developed transition-edge sensors for this measurement and methods for incorporating 163Ho into high-resolution microcalorimeters, and have measured the electron-capture spectrum of 163Ho. Finally, we present our work in these areas and discuss the measured spectrum and its comparison to current theory.« less
Development of Holmium-163 electron-capture spectroscopy with transition-edge sensors
DOE Office of Scientific and Technical Information (OSTI.GOV)
Croce, Mark Philip; Rabin, Michael W.; Mocko, Veronika
Calorimetric decay energy spectroscopy of electron-capture-decaying isotopes is a promising method to achieve the sensitivity required for electron neutrino mass measurement. The very low total nuclear decay energy (Q EC < 3 keV) and short half-life (4570 years) of 163Ho make it attractive for high-precision electron-capture spectroscopy (ECS) near the kinematic endpoint, where the neutrino momentum goes to zero. In the ECS approach, an electron-capture-decaying isotope is embedded inside a microcalorimeter designed to capture and measure the energy of all the decay radiation except that of the escaping neutrino. We have developed a complete process for proton irradiation-based isotope production,more » isolation, and purification of 163Ho. We have developed transition-edge sensors for this measurement and methods for incorporating 163Ho into high-resolution microcalorimeters, and have measured the electron-capture spectrum of 163Ho. Finally, we present our work in these areas and discuss the measured spectrum and its comparison to current theory.« less
Isolation of 163Ho from dysprosium target material by HPLC for neutrino mass measurements
Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.; ...
2015-04-29
The rare earth isotope 163Ho is of interest for neutrino mass measurements. This report describes the isolation of 163Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, 163Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm –3 α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized bymore » MC-ICP-MS to determine the 163Ho/ 165Ho ratio, 163Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4E5 for Dy. As a result, the isolated Ho fraction contained 24.8 ±1.3 ng of 163Ho corresponding to holmium recovery of 72 ± 3%.« less
Isolation of 163Ho from dysprosium target material by HPLC for neutrino mass measurements
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.
The rare earth isotope 163Ho is of interest for neutrino mass measurements. This report describes the isolation of 163Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, 163Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm –3 α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized bymore » MC-ICP-MS to determine the 163Ho/ 165Ho ratio, 163Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4E5 for Dy. As a result, the isolated Ho fraction contained 24.8 ±1.3 ng of 163Ho corresponding to holmium recovery of 72 ± 3%.« less
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2011 CFR
2011-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2012 CFR
2012-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2013 CFR
2013-04-01
..., DEPARTMENT OF THE TREASURY ALCOHOL LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2010 CFR
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2014 CFR
2014-04-01
..., DEPARTMENT OF THE TREASURY ALCOHOL LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
Injection locking of a high power ultraviolet laser diode for laser cooling of ytterbium atoms
DOE Office of Scientific and Technical Information (OSTI.GOV)
Hosoya, Toshiyuki; Miranda, Martin; Inoue, Ryotaro
2015-07-15
We developed a high-power laser system at a wavelength of 399 nm for laser cooling of ytterbium atoms with ultraviolet laser diodes. The system is composed of an external cavity laser diode providing frequency stabilized output at a power of 40 mW and another laser diode for amplifying the laser power up to 220 mW by injection locking. The systematic method for optimization of our injection locking can also be applied to high power light sources at any other wavelengths. Our system does not depend on complex nonlinear frequency-doubling and can be made compact, which will be useful for providing light sources formore » laser cooling experiments including transportable optical lattice clocks.« less
Yin, Shupeng; Yan, Ping; Gong, Mali
2008-10-27
An end-pumped ytterbium-doped all-fiber laser with 300 W output in continuous regime was reported, which was based on master oscillator multi-stage power amplifiers configuration. Monolithic fiber laser system consisted of an oscillator stage and two amplifier stages. Total optical-optical efficiency of monolithic fiber laser was approximately 65%, corresponding to 462 W of pump power coupled into laser system. We proposed a new method to connect power amplifier stage, which was crucial for the application of end-pumped combiner in high power MOPAs all-fiber laser.
Mukhopadhyay, Pranab K; Gupta, Pradeep K; Singh, Amarjeet; Sharma, Sunil K; Bindra, Kushvinder S; Oak, Shrikant M
2014-05-01
A multimode interference filter with narrow transmission bandwidth and large self-imaging wavelength interval is constructed and implemented in an ytterbium doped fiber laser in all-fiber format for broad wavelength tunability as well as narrow spectral width of the output beam. The peak transmission wavelength of the multimode interference filter was tuned with the help of a standard in-fiber polarization controller. With this simple mechanism more than 30 nm (1038 nm-1070 nm) tuning range is demonstrated. The spectral width of the output beam from the laser was measured to be 0.05 nm.
NASA Astrophysics Data System (ADS)
Mukhopadhyay, Pranab K.; Gupta, Pradeep K.; Singh, Amarjeet; Sharma, Sunil K.; Bindra, Kushvinder S.; Oak, Shrikant M.
2014-05-01
A multimode interference filter with narrow transmission bandwidth and large self-imaging wavelength interval is constructed and implemented in an ytterbium doped fiber laser in all-fiber format for broad wavelength tunability as well as narrow spectral width of the output beam. The peak transmission wavelength of the multimode interference filter was tuned with the help of a standard in-fiber polarization controller. With this simple mechanism more than 30 nm (1038 nm-1070 nm) tuning range is demonstrated. The spectral width of the output beam from the laser was measured to be 0.05 nm.
Filho, Manoel A. M.; Dutra, José Diogo L.; Rocha, Gerd B.; Simas, Alfredo M.
2016-01-01
The RM1 quantum chemical model for the calculation of complexes of Tm(III), Yb(III) and Lu(III) is advanced. Subsequently, we tested the models by fully optimizing the geometries of 126 complexes. We then compared the optimized structures with known crystallographic ones from the Cambridge Structural Database. Results indicate that, for thulium complexes, the accuracy in terms of the distances between the lanthanide ion and its directly coordinated atoms is about 2%. Corresponding results for ytterbium and lutetium are both 3%, levels of accuracy useful for the design of lanthanide complexes, targeting their countless applications. PMID:27223475
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mukhopadhyay, Pranab K., E-mail: pkm@rrcat.gov.in; Gupta, Pradeep K.; Singh, Amarjeet
2014-05-15
A multimode interference filter with narrow transmission bandwidth and large self-imaging wavelength interval is constructed and implemented in an ytterbium doped fiber laser in all-fiber format for broad wavelength tunability as well as narrow spectral width of the output beam. The peak transmission wavelength of the multimode interference filter was tuned with the help of a standard in-fiber polarization controller. With this simple mechanism more than 30 nm (1038 nm–1070 nm) tuning range is demonstrated. The spectral width of the output beam from the laser was measured to be 0.05 nm.
26 CFR 1.163-11T - Allocation of certain prepaid qualified mortgage insurance premiums (temporary).
Code of Federal Regulations, 2010 CFR
2010-04-01
... insurance premiums (temporary). 1.163-11T Section 1.163-11T Internal Revenue INTERNAL REVENUE SERVICE... insurance premiums (temporary). (a) Allocation—(1) In general. As provided in section 163(h)(3)(E), premiums... section applies whether the qualified mortgage insurance premiums are paid in cash or are financed...
26 CFR 1.163-11T - Allocation of certain prepaid qualified mortgage insurance premiums (temporary).
Code of Federal Regulations, 2011 CFR
2011-04-01
... insurance premiums (temporary). 1.163-11T Section 1.163-11T Internal Revenue INTERNAL REVENUE SERVICE... insurance premiums (temporary). (a) Allocation—(1) In general. As provided in section 163(h)(3)(E), premiums... section applies whether the qualified mortgage insurance premiums are paid in cash or are financed...
Plasma Soluble CD163 Level Independently Predicts All-Cause Mortality in HIV-1-Infected Individuals.
Knudsen, Troels Bygum; Ertner, Gideon; Petersen, Janne; Møller, Holger Jon; Moestrup, Søren K; Eugen-Olsen, Jesper; Kronborg, Gitte; Benfield, Thomas
2016-10-15
CD163, a monocyte- and macrophage-specific scavenger receptor, is shed as soluble CD163 (sCD163) during the proinflammatory response. Here, we assessed the association between plasma sCD163 levels and progression to AIDS and all-cause mortality among individuals infected with human immunodeficiency virus type 1 (HIV). Plasma sCD163 levels were measured in 933 HIV-infected individuals. Hazard ratios (HRs) with 95% confidence intervals (CIs) associated with mortality were computed by Cox proportional hazards regression. At baseline, 86% were receiving antiretroviral treatment, 73% had plasma a HIV RNA level of <50 copies/mL, and the median CD4(+) T-cell count was 503 cells/µL. During 10.5 years of follow-up, 167 (17.9%) died. Plasma sCD163 levels were higher in nonsurvivors than in survivors (4.92 mg/L [interquartile range {IQR}, 3.29-8.65 mg/L] vs 3.16 mg/L [IQR, 2.16-4.64 mg/L]; P = .0001). The cumulative incidence of death increased with increasing plasma sCD163 levels, corresponding to a 6% or 35% increased risk of death for each milligram per liter or quartile increase, respectively, in baseline plasma sCD163 level (adjusted HR, 1.06 [95% CI, 1.03-1.09] and 1.35 [95% CI, 1.13-1.63], respectively). Plasma sCD163 was an independent marker of all-cause mortality in a cohort of HIV-infected individuals, suggesting that monocyte/macrophage activation may play a role in HIV pathogenesis and be a target of intervention. © The Author 2016. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2014 CFR
2014-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2011 CFR
2011-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2013 CFR
2013-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2012 CFR
2012-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
Dual-Mode Operation of an Optical Lattice Clock Using Strontium and Ytterbium Atoms.
Akamatsu, Daisuke; Kobayashi, Takumi; Hisai, Yusuke; Tanabe, Takehiko; Hosaka, Kazumoto; Yasuda, Masami; Hong, Feng-Lei
2018-06-01
We have developed an optical lattice clock that can operate in dual modes: a strontium (Sr) clock mode and an ytterbium (Yb) clock mode. Dual-mode operation of the Sr-Yb optical lattice clock is achieved by alternately cooling and trapping 87 Sr and 171 Yb atoms inside the vacuum chamber of the clock. Optical lattices for Sr and Yb atoms were arranged with horizontal and vertical configurations, respectively, resulting in a small distance of the order of between the trapped Sr and Yb atoms. The 1 S 0 - 3 P 0 clock transitions in the trapped atoms were interrogated in turn and the clock lasers were stabilized to the transitions. We demonstrated the frequency ratio measurement of the Sr and Yb clock transitions by using the dual-mode operation of the Sr-Yb optical lattice clock. The dual-mode operation can reduce the uncertainty of the blackbody radiation shift in the frequency ratio measurement, because both Sr and Yb atoms share the same blackbody radiation.
Un nouveau cristal laser largement accordable le BOYS dopé à l'ytterbium
NASA Astrophysics Data System (ADS)
Chénais, S.; Druon, F.; Balembois, F.; Georges, P.; Gaumé, R.; Aka, G.; Viana, B.; Vivien, D.
2002-06-01
Nous avons étudié les performances laser en pompage par diode de puissance d'un nouveau cristal : le Sr3Y(BO3)3 (acronyme : BOYS), dopé à l'ytterbium. Son spectre d'émission particulièrement large en fait un matériau particulièrement prometteur pour la réalisation de lasers femtosecondes directement pompés par diode. Ses performances ont été comparées à celles d'un verre phosphate ainsi qu'à celles du cristal d' Yb:GdCOB dans les mêmes conditions. Nous démontrons que, tant du point de vue de l'efficacité laser que de la tenue aux fortes puissances, GdCOB et BOYS sont supérieurs au verre ; le BOYS est de surcroît plus accordable (sur 50 nm), mais son comportement thermique limite a priori son usage à des puissances de pompe modérées.
Publications - GMC 163 | Alaska Division of Geological & Geophysical
DGGS GMC 163 Publication Details Title: Gas chromatograms from the following 7 North Slope wells Reference Unocal Geochemistry Group, 1990, Gas chromatograms from the following 7 North Slope wells: Aufeis
Scaling up the precision in a ytterbium Bose-Einstein condensate interferometer
NASA Astrophysics Data System (ADS)
McAlpine, Katherine; Plotkin-Swing, Benjamin; Gochnauer, Daniel; Saxberg, Brendan; Gupta, Subhadeep
2016-05-01
We report on progress toward a high-precision ytterbium (Yb) Bose-Einstein condensate (BEC) interferometer, with the goal of measuring h/m and thus the fine structure constant α. Here h is Planck's constant and m is the mass of a Yb atom. The use of the non-magnetic Yb atom makes our experiment insensitive to magnetic field noise. Our chosen symmetric 3-path interferometer geometry suppresses errors from vibration, rotation, and acceleration. The precision scales with the phase accrued due to the kinetic energy difference between the interferometer arms, resulting in a quadratic sensitivity to the momentum difference. We are installing and testing the laser pulses for large momentum transfer via Bloch oscillations. We will report on Yb BEC production in a new apparatus and progress toward realizing the atom optical elements for high precision measurements. We will also discuss approaches to mitigate two important systematics: (i) atom interaction effects can be suppressed by creating the BEC in a dynamically shaped optical trap to reduce the density; (ii) diffraction phase effects from the various atom-optical elements can be accounted for through an analysis of the light-atom interaction for each pulse.
NASA Astrophysics Data System (ADS)
Najar, Adel; Charrier, Joël; Lorrain, Nathalie; Haji, Lazhar; Oueslati, Mehrezi
2007-09-01
The on-off optical gain measurements as a function of the pump power were performed on porous silicon planar waveguides codoped by erbium and ytterbium ions. These measurements were obtained for different ratios of Yb concentration to Er concentration. The highest value of the gain was reached when the Yb concentration is three times higher than that of Er at a moderate 980nm pump power value equal to 70mW. Optical losses measurements have been performed on these waveguides and were equal to 2.1dB/cm and an internal gain of about 6.4dB/cm was obtained.
27 CFR 22.163 - Time for making entries.
Code of Federal Regulations, 2010 CFR
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Records of Transactions § 22.163..., the daily posting of records may be deferred to conform to the permittee's normal accounting cycle if...
Kaminska, A; Ma, C-G; Brik, M G; Kozanecki, A; Boćkowski, M; Alves, E; Suchocki, A
2012-03-07
The results of high-pressure low-temperature optical measurements in a diamond-anvil cell of bulk gallium nitride crystals implanted with ytterbium are reported in combination with crystal field calculations of the Yb(3+) energy levels. Crystal field analysis of splitting of the (2)F(7/2) and (2)F(5/2) states has been performed, with the aim of assigning all features of the experimental luminescence spectra. A thorough analysis of the pressure behavior of the Yb(3+) luminescence lines in GaN allowed the determination of the ambient-pressure positions and pressure dependence of the Yb(3+) energy levels in the trigonal crystal field as well as the pressure-induced changes of the spin-orbit coupling coefficient.
Park, Hyun Ji; Lee, Sang Sook; You, Young Nim; Yoon, Dae Hwa; Kim, Beom-Gi; Ahn, Jun Cheul; Cho, Hye Sun
2013-01-01
The putative thylakoid lumen immunophilin, FKBP16-3, has not yet been characterized, although this protein is known to be regulated by thioredoxin and possesses a well-conserved CxxxC motif in photosynthetic organisms. Here, we characterized rice OsFKBP16-3 and examined the role of this gene in the regulation of abiotic stress in plants. FKBP16-3s are well conserved in eukaryotic photosynthetic organisms, including the presence of a unique disulfide-forming CxxxC motif in their N-terminal regions. OsFKBP16-3 was mainly expressed in rice leaf tissues and was upregulated by various abiotic stresses, including salt, drought, high light, hydrogen peroxide, heat and methyl viologen. The chloroplast localization of OsFKBP16-3-GFP was confirmed through the transient expression of OsFKBP16-3 in Nicotiana benthamiana leaves. Transgenic Arabidopsis and transgenic rice plants that constitutively expressed OsFKBP16-3 exhibited increased tolerance to salinity, drought and oxidative stresses, but showed no change in growth or phenotype, compared with vector control plants, when grown under non-stressed conditions. This is the first report to demonstrate the potential role of FKBP16-3 in the environmental stress response, which may be regulated by a redox relay process in the thylakoid lumen, suggesting that artificial regulation of FKBP16-3 expression is a candidate for stress-tolerant crop breeding. PMID:23485991
Efficient single-mode operation of a cladding-pumped ytterbium-doped helical-core fiber laser.
Wang, P; Cooper, L J; Sahu, J K; Clarkson, W A
2006-01-15
A novel approach to achieving robust single-spatial-mode operation of cladding-pumped fiber lasers with multimode cores is reported. The approach is based on the use of a fiber geometry in which the core has a helical trajectory within the inner cladding to suppress laser oscillation on higher-order modes. In a preliminary proof-of-principle study, efficient single-mode operation of a cladding-pumped ytterbium-doped helical-core fiber laser with a 30 microm diameter core and a numerical aperture of 0.087 has been demonstrated. The laser yielded 60.4 W of output at 1043 nm in a beam with M2 < 1.4 for 92.6 W launched pump power from a diode stack at 976 nm. The slope efficiency at pump powers well above threshold was approximately 84%, which compares favorably with the slope efficiencies achievable with conventional straight-core Yb-doped double-clad fiber lasers.
Bryant, Alex K; Moore, David J; Burdo, Tricia H; Lakritz, Jessica R; Gouaux, Ben; Soontornniyomkij, Virawudh; Achim, Cristian L; Masliah, Eliezer; Grant, Igor; Levine, Andrew J; Ellis, Ronald J
2017-04-24
Higher plasma soluble cluster of differentiation (CD)163 (sCD163), shed by monocytes and macrophages, correlates with neurocognitive impairment in HIV infection. We hypothesized that higher antemortem plasma or cerebrospinal fluid (CSF) sCD163 would be associated with greater postmortem neurodegeneration and/or microgliosis. Retrospective, postmortem observational study. We measured sCD163 levels in antemortem plasma (n = 54) and CSF (n = 32) samples from 74 HIV-seropositive participants (median 5 months before death) who donated their brains to research at autopsy. Postmortem, we quantified markers of synaptodendritic damage (microtubule-associated protein 2, synaptophysin), microgliosis [human leukocyte antigen DR (HLA-DR), ionized calcium-binding adaptor molecule 1], astrocytosis (glial fibrillary acidic protein), and impaired protein clearance (β-amyloid) in frontal cortex, hippocampus, putamen, and internal capsule. Multivariable least-squares regression was used to evaluate the association between plasma or CSF sCD163 and histological measures, correcting for multiple comparisons. Higher plasma sCD163 was associated with lower microtubule-associated protein 2 in frontal cortex [B = -0.23, 95% confidence interval (CI) -0.41 to -0.06, P = 0.04], putamen (B = 0.32, 95% CI -0.52 to -0.12, P = 0.02), and hippocampus (B = -0.23, 95% CI -0.35 to -0.10, P = 0.01), and with lower synaptophysin in hippocampus (B = -0.25, 95% CI -0.42 to -0.03, P = 0.02) but not putamen or frontal cortex (P > 0.05). Higher plasma sCD163 was associated with higher HLA-DR in putamen (B = 0.17, 95% CI 0.08 to 0.26, P = 0.008). CSF sCD163 was not associated with any histological measure (P > 0.05). Higher plasma sCD163 in life is associated with greater synaptodendritic damage and microglial activation in cortical and subcortical brain regions.
24 CFR 16.3 - Procedures for inquiries.
Code of Federal Regulations, 2010 CFR
2010-04-01
... Development IMPLEMENTATION OF THE PRIVACY ACT OF 1974 § 16.3 Procedures for inquiries. (a) Any individual... the office of, or by mail addressed to, the appropriate Privacy Act Officer. Although oral requests... request and the letter itself should both clearly indicate that the subject is a “PRIVACY ACT INQUIRY”. If...
24 CFR 16.3 - Procedures for inquiries.
Code of Federal Regulations, 2011 CFR
2011-04-01
... Development IMPLEMENTATION OF THE PRIVACY ACT OF 1974 § 16.3 Procedures for inquiries. (a) Any individual... the office of, or by mail addressed to, the appropriate Privacy Act Officer. Although oral requests... request and the letter itself should both clearly indicate that the subject is a “PRIVACY ACT INQUIRY”. If...
7 CFR 930.163 - Deferment of restricted obligation.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 930.163 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE TART CHERRIES GROWN IN THE STATES OF MICHIGAN, NEW YORK, PENNSYLVANIA, OREGON, UTAH, WASHINGTON, AND WISCONSIN...
Inside HOLMES experiment: 163Ho metallic target production for the micro-calorimeter absorber
NASA Astrophysics Data System (ADS)
Pizzigoni, G.; Alpert, B.; Balata, M.; Bennett, D.; Biasotti, M.; Boragno, C.; Brofferio, C.; De Gerone, M.; Dressler, R.; Faverazani, M.; Ferri, E.; Folwer, J.; Gatti, F.; Giachero, A.; Heinitz, S.; Hilton, G.; Köster, U.; Lusignoli, M.; Maino, M.; Mates, J.; Nisi, S.; Nizzolo, R.; Nucciotti, A.; Pessina, G.; Puiu, A.; Ragazzi, S.; Reintsema, C.; Ribeiro Gomes, M.; Shmidt, D.; Schumann, D.; Sisti, M.; Swetz, D.; Terranova, F.; Ullom, J.; Day, P. K.
2016-07-01
The main goal in the HOLMES experiment is the neutrino mass measurement using an array of 1000 micro-calorimeters with standard metallic absorber. A good isotope for such measurement is the 163Ho, those isotopes embedded in the metallic absorber will be 1011-1013. Since 163Ho is not available in nature, a dedicated process must be set up to produce the amount needed for this neutrino mass experiment. The process with the highest born-up cross-section is the neutron irradiation of Er2O3 enriched in 162Er: 162Er(n,γ)163Er →163Ho+νe, where the decay is an EC with half-life of about 75 min and the (n,γ) is about 20 barns for thermal neutron. After the neutron irradiation in the oxide powder there are several radioactive isotopes which are potentially disturbing because of the background that they cause below 5 keV. The chemical separation of holmium from the irradiation enriched Er2O3 powder is therefore mandatory and will be performed by means of ion exchange chromatography. On the end of those processes the oxide powder enriched in 162Er will have the 163Ho isotope number required. The holmium chemical state influences the end point of the EC spectrum, in order to avoid such effect it is necessary to embed in the absorber only the metallic isotope. Reduction and distillation technique allowed us to obtain a pure metallic holmium, starting from natural oxide holmium. This technique will be applied on the irradiated oxide powder to obtain the metallic 163Ho, ready to be embedded in the micro-calorimeter absorber.
do Prado Gomes Pedreira, Renato; de Carli, Marina Lara; Beijo, Luiz Alberto; Nonogaki, Suely; Pereira, Alessandro Antônio Costa; Junior, Noé Vital Ribeiro; Sperandio, Felipe Fornias; Hanemann, João Adolfo Costa
2016-10-01
Multinucleated giant cells (MGC) are considered to be a hallmark of granulomatous inflammation; thus, they may play an essential role in the host response against pathogens, particularly Paracoccidioides brasiliensis. This study characterizes the MGC found in oral paracoccidioidomycosis and assesses the correlation of MGC with the amount of fungi within oral tissues. Twenty-six cases were included. They were classified as loose or dense granulomas, and the total MGC, including foreign-body and Langhans giant cells, besides the total and intracellular fungi, were taken into consideration. CD163 immunoexpression was performed, and CD163+ multinucleated giant cells were also quantified. Dense granulomas revealed more foreign-body type and total giant cells than loose granulomas (P < 0.05). Total giant cells showed a positive linear correlation with the CD163+ cells (P = 0.003; r = 0.56) and intracellular fungi quantification (P = 0.045; r = 0.40). Oral paracoccidioidomycosis lesions contain MGC that mainly belong to a CD163+ phenotype, also showing both Langhans and foreign-body arrangements. Additionally, the higher the presence of MGC, the higher the amount of phagocytized fungi.
20 CFR 1002.163 - What types of health plans are covered by USERRA?
Code of Federal Regulations, 2010 CFR
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What types of health plans are covered by USERRA? 1002.163 Section 1002.163 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS... by USERRA? (a) USERRA defines a health plan to include an insurance policy or contract, medical or...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2010 CFR
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on Form 5000.24, as provided in §§ 25...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2012 CFR
2012-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§ 25...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2013 CFR
2013-04-01
..., DEPARTMENT OF THE TREASURY ALCOHOL BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§ 25...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2011 CFR
2011-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§ 25...
Development of ytterbium-doped oxyfluoride glasses for laser cooling applications.
Krishnaiah, Kummara Venkata; de Lima Filho, Elton Soares; Ledemi, Yannick; Nemova, Galina; Messaddeq, Younes; Kashyap, Raman
2016-02-26
Oxyfluoride glasses doped with 2, 5, 8, 12, 16 and 20 mol% of ytterbium (Yb(3+)) ions have been prepared by the conventional melt-quenching technique. Their optical, thermal and thermo-mechanical properties were characterized. Luminescence intensity at 1020 nm under laser excitation at 920 nm decreases with increasing Yb(3+) concentration, suggesting a decrease in the photoluminescence quantum yield (PLQY). The PLQY of the samples was measured with an integrating sphere using an absolute method. The highest PLQY was found to be 0.99(11) for the 2 mol% Yb(3+): glass and decreases with increasing Yb(3+) concentration. The mean fluorescence wavelength and background absorption of the samples were also evaluated. Upconversion luminescence under 975 nm laser excitation was observed and attributed to the presence of Tm(3+) and Er(3+) ions which exist as impurity traces with YbF3 starting powder. Decay curves for the Yb(3+): (2)F5/2 → (2)F7/2 transition exhibit single exponential behavior for all the samples, although lifetime decrease was observed for the excited level of Yb(3+) with increasing Yb(3+) concentration. Also observed are an increase in the PLQY and a slight decrease in lifetime with increasing the pump power. Finally, the potential of these oxyfluoride glasses with high PLQY and low background absorption for laser cooling applications is discussed.
Dultz, G; Gerber, L; Farnik, H; Berger, A; Vermehren, J; Pleli, T; Zeuzem, S; Piiper, A; Kronenberger, B; Waidmann, O
2015-04-01
Soluble CD163 (sCD163), a marker for macrophage activation, was found to be associated with the severity of liver cirrhosis. The aim of the current study was to investigate whether serum sCD163 levels correlate with liver inflammation and fibrosis in patients with chronic hepatitis B virus (HBV) infection. In a retrospective cohort study, serum sCD163 levels were assessed by ELISA together with clinical and laboratory data in 186 patients with chronic HBV infection and 15 healthy controls. The relation between parameters for liver fibrosis and necroinflammation and sCD163 levels was analysed. Additionally, sCD163 was quantified in a subset of follow-up serum samples after initiation of antiviral treatment. sCD163 levels differed among phases of chronic HBV infection (P < 0.0001), and sCD163 concentrations were associated with inflammatory activity and fibrosis in the liver. sCD163 levels ≥ 1961 ng/l had a high specificity in the identification of subjects with substantial fibrosis (F ≥ 2). sCD163 concentrations decreased significantly after initiation of antiviral treatment. The correlation of sCD163 levels with necroinflammation and fibrosis and the sCD163 decline under treatment indicates that macrophage activation plays a role in HBV-related liver pathogenesis. © 2014 John Wiley & Sons Ltd.
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2012 CFR
2012-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2014 CFR
2014-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2013 CFR
2013-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2011 CFR
2011-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
Synthesis and photocatalytic activity of ytterbium-doped titania/diatomite composite photocatalysts
NASA Astrophysics Data System (ADS)
Tang, Wenjian; Qiu, Kehui; Zhang, Peicong; Yuan, Xiqiang
2016-01-01
Ytterbium-doped titanium dioxide (Yb-TiO2)/diatomite composite materials with different Yb concentrations were prepared by sol-gel method. The phase structure, morphology, and chemical composition of the as-prepared composites were well characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy, Raman spectroscopy, scanning electron microscopy (SEM), and ultraviolet-visible (UV-vis) diffuse reflection spectroscopy. The XRD and Raman spectroscopy analysis indicated that the TiO2 existed in the form of pure anatase in the composites. The SEM images exhibited the well deposition and dispersion of TiO2 nanoparticles with little agglomeration on the surfaces of diatoms. The UV-vis diffuse reflection spectra showed that the band gap of TiO2 could be narrowed by the introduction of Yb species, which was further affected by doping concentration of Yb. The photocatalytic activity of synthesized samples was investigated by the degradation of methylene blue (MB) under UV light irradiation. It was observed that the photocatalytic degradation followed a pseudo-first-order kinetics according to the Langmuir-Hinshelwood model. Compared to TiO2 and TiO2/diatomite, the Yb-TiO2/diatomite composites exhibited higher photocatalytic activity toward degradation of MB using UV light irradiation.
WD60/FAP163 is a dynein intermediate chain required for retrograde intraflagellar transport in cilia
Patel-King, Ramila S.; Gilberti, Renée M.; Hom, Erik F. Y.; King, Stephen M.
2013-01-01
Retrograde intraflagellar transport (IFT) is required for assembly of cilia. We identify a Chlamydomonas flagellar protein (flagellar-associated protein 163 [FAP163]) as being closely related to the D1bIC(FAP133) intermediate chain (IC) of the dynein that powers this movement. Biochemical analysis revealed that FAP163 is present in the flagellar matrix and is actively trafficked by IFT. Furthermore, FAP163 copurified with D1bIC(FAP133) and the LC8 dynein light chain, indicating that it is an integral component of the retrograde IFT dynein. To assess the functional role of FAP163, we generated an RNA interference knockdown of the orthologous protein (WD60) in planaria. The Smed-wd60(RNAi) animals had a severe ciliary assembly defect that dramatically compromised whole-organism motility. Most cilia were present as short stubs that had accumulated large quantities of IFT particle–like material between the doublet microtubules and the membrane. The few remaining approximately full-length cilia had a chaotic beat with a frequency reduced from 24 to ∼10 Hz. Thus WD60/FAP163 is a dynein IC that is absolutely required for retrograde IFT and ciliary assembly. PMID:23864713
Two-dimensional ytterbium oxide nanodisks based biosensor for selective detection of urea.
Ibrahim, Ahmed A; Ahmad, Rafiq; Umar, Ahmad; Al-Assiri, M S; Al-Salami, A E; Kumar, Rajesh; Ansari, S G; Baskoutas, S
2017-12-15
Herein, we demonstrate synthesis and application of two-dimensional (2D) rectangular ytterbium oxide (Yb 2 O 3 ) nanodisks via a facile hydrothermal method. The structural, morphological, compositional, crystallinity, and phase properties of as-synthesized nanodisks were carried out using several analytical techniques that showed well defined 2D rectangular nanodisks/sheet like morphologies. The average thickness and edge length of the nanosheet structures were 20 ± 5nm and 600 ± 50nm, respectively. To develop urea biosensor, glassy carbon electrodes (GCE) were modified with Yb 2 O 3 nanodisks, followed by urease immobilization and Nafion membrane covering (GCE/Yb 2 O 3 /Urease/Nafion). The fabricated biosensor showed sensitivity of 124.84μAmM -1 cm -2 , wide linear range of 0.05-19mM, detection limit down to ~ 2μM, and fast response time of ~ 3s. The developed biosensor was also used for the urea detection in water samples through spike-recovery experiments, which illustrates satisfactory recoveries. In addition, the obtained desirable selectivity towards specific interfering species, long-term stability, reproducibility, and repeatability further confirm the potency of as-fabricated urea biosensor. Copyright © 2017 Elsevier B.V. All rights reserved.
25 CFR 163.22 - Payment for forest products.
Code of Federal Regulations, 2010 CFR
2010-04-01
...) Terms and conditions for payment of forest products under lump sum (predetermined volume) sales shall be... Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume determination for forest products sold shall be the Scribner Decimal C log rules, cubic volume, lineal...
Fjeldborg, Karen; Pedersen, Steen B; Møller, Holger J; Rask, Peter; Danielsen, Allan Vestergaard; Stødkilde-Jørgensen, Hans; Richelsen, Bjørn
2015-01-01
Soluble CD163 (sCD163) is a new marker of obesity-related metabolic complications. sCD163 and CD163 mRNA were investigated in relation to the fat distribution at baseline and 12 months after Roux-en-Y gastric bypass (RYGB). Thirty-one obese subjects (BMI: 42.3 ± 4.7 kg/m(2)) were enrolled. Subcutaneous (SAT) and visceral adipose tissue (VAT) volume were determined by MRI, intrahepatic lipid content (IHL) by MR-spectroscopy, and body composition by DXA. Fasting blood samples and adipose tissue samples were obtained, and ELISA and RT-PCR were performed. RYGB-induced weight loss (36 ± 11 kg) was accompanied by a significant reduction in sCD163 (2.1 ± 0.8 mg/l vs. 1.7 ± 0.7 mg/l), SAT, VAT, and IHL (all, P < 0.001). At baseline, sCD163 was associated with VAT (r = 0.40, P < 0.05) but not with SAT or IHL. Moreover, CD163 mRNA was significantly upregulated in VAT compared with SAT at baseline (P < 0.05) and significantly downregulated in SAT after RYGB (P < 0.001). ΔsCD163 was significantly associated with ΔIHL after RYGB compared with baseline (r = 0.40, P < 0.05). RYGB-induced weight loss results in a reduction of sCD163 and CD163 mRNA. The association between ΔsCD163 and ΔIHL may reflect a reduction in sCD163-producing Kupffer cells in the liver. Moreover, sCD163 may be a marker of "unhealthy" fat distribution in obese subjects. © 2014 The Obesity Society.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Gomez-Millan, Jaime; Goldblatt, Erin M.; Gryaznov, Sergei M.
Purpose: Telomerase is expressed in 80-90% of tumor cells, but is absent in most somatic cells. The absence of telomerase activity results in progressive telomere shortening, leading to cellular senescence or death through deoxyribonucleic acid (DNA) damage signals. In addition, a role for telomerase in DNA damage repair has also been suggested. A specific telomerase inhibitor, GRN163L that is complementary to the template region of the telomerase ribonucleic acid component (hTR). We hypothesized that exposure to GRN163L, either through immediate inhibition of telomerase activity or through eventual telomere shortening and dysfunction, may enhance radiation sensitivity. Our goal was to testmore » whether the treatment with GRN163L enhances sensitivity to irradiation (IR) in MDA-MB-231 breast cancer cells. Methods and Materials: The MDA-MB-231 breast cancer cells were treated with or without GRN163L for 2-42 days. Inhibition of telomerase activity and shortening of telomeres were confirmed. Cells were then irradiated and clonogenic assays were performed to show cell survival differences. In vivo studies using MDA-MB-231 xenografts were performed to corroborate the in vitro results. Results: We show that cells with shortened telomeres due to GRN163L enhance the effect on IR reducing survival by an additional 30% (p < 0.01). These results are confirmed in vivo, with a significant decrease in tumor growth in mice exposed to GRN163L. Conclusions: We found that GRN163L is a promising adjuvant treatment in combination with radiation therapy that may improve the therapeutic index by enhancing the radiation sensitivity. These studies prompt further investigation as to whether this combination can be applied to other cancers and the clinic.« less
Alvarado-Vazquez, Perla Abigail; Bernal, Laura; Paige, Candler A; Grosick, Rachel L; Moracho Vilrriales, Carolina; Ferreira, David Wilson; Ulecia-Morón, Cristina; Romero-Sandoval, E Alfonso
2017-08-01
M1 macrophages release proinflammatory factors during inflammation. They transit to an M2 phenotype and release anti-inflammatory factors to resolve inflammation. An imbalance in the transition from M1 to M2 phenotype in macrophages contributes to the development of persistent inflammation. CD163, a member of the scavenger receptor cysteine-rich family, is an M2 macrophage marker. The functional role of CD163 during the resolution of inflammation is not completely known. We postulate that CD163 contributes to the transition from M1 to M2 phenotype in macrophages. We induced CD163 gene in THP-1 and primary human macrophages using polyethylenimine nanoparticles grafted with a mannose ligand (Man-PEI). This nanoparticle specifically targets cells of monocytic origin via mannose receptors. Cells were challenged with a single or a double stimulation of lipopolysaccharide (LPS). A CD163 or empty plasmid was complexed with Man-PEI nanoparticles for cell transfections. Quantitative RT-PCR, immunocytochemistry, and ELISAs were used for molecular assessments. CD163-overexpressing macrophages displayed reduced levels of tumor necrosis factor-alpha (TNF)-α and monocytes chemoattractant protein (MCP)-1 after a single stimulation with LPS. Following a double stimulation paradigm, CD163-overexpressing macrophages showed an increase of interleukin (IL)-10 and IL-1ra and a reduction of MCP-1. This anti-inflammatory phenotype was partially blocked by an anti-CD163 antibody (effects on IL-10 and IL-1ra). A decrease in the release of TNF-α, IL-1β, and IL-6 was observed in CD163-overexpressing human primary macrophages. The release of IL-6 was blocked by an anti-CD163 antibody in the CD163-overexpressing group. Our data show that the induction of the CD163 gene in human macrophages under inflammatory conditions produces changes in cytokine secretion in favor of an anti-inflammatory phenotype. Targeting macrophages to induce CD163 using cell-directed nanotechnology is an attractive
Development of ytterbium-doped oxyfluoride glasses for laser cooling applications
Krishnaiah, Kummara Venkata; Soares de Lima Filho, Elton; Ledemi, Yannick; Nemova, Galina; Messaddeq, Younes; Kashyap, Raman
2016-01-01
Oxyfluoride glasses doped with 2, 5, 8, 12, 16 and 20 mol% of ytterbium (Yb3+) ions have been prepared by the conventional melt-quenching technique. Their optical, thermal and thermo-mechanical properties were characterized. Luminescence intensity at 1020 nm under laser excitation at 920 nm decreases with increasing Yb3+ concentration, suggesting a decrease in the photoluminescence quantum yield (PLQY). The PLQY of the samples was measured with an integrating sphere using an absolute method. The highest PLQY was found to be 0.99(11) for the 2 mol% Yb3+: glass and decreases with increasing Yb3+ concentration. The mean fluorescence wavelength and background absorption of the samples were also evaluated. Upconversion luminescence under 975 nm laser excitation was observed and attributed to the presence of Tm3+ and Er3+ ions which exist as impurity traces with YbF3 starting powder. Decay curves for the Yb3+: 2F5/2 → 2F7/2 transition exhibit single exponential behavior for all the samples, although lifetime decrease was observed for the excited level of Yb3+ with increasing Yb3+ concentration. Also observed are an increase in the PLQY and a slight decrease in lifetime with increasing the pump power. Finally, the potential of these oxyfluoride glasses with high PLQY and low background absorption for laser cooling applications is discussed. PMID:26915817
Oblique view looking northeast at Machine Shop (Bldg. 163) from ...
Oblique view looking northeast at Machine Shop (Bldg. 163) from Second Street - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Federal Register 2010, 2011, 2012, 2013, 2014
2013-03-08
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-80-2012] Foreign-Trade Zone 163--Ponce, Puerto Rico; Authorization of Production Activity; Zimmer Manufacturing BV (Medical Devices); Ponce, Puerto... Subzone 163A, in Ponce, Puerto Rico. The notification was processed in accordance with the regulations of...
49 CFR 1.63 - Delegations to Assistant to the Secretary and Director of Public Affairs.
Code of Federal Regulations, 2010 CFR
2010-10-01
... Director of Public Affairs. 1.63 Section 1.63 Transportation Office of the Secretary of Transportation... and Director of Public Affairs. The Assistant to the Secretary and Director of Public Affairs is delegated authority to: (a) [Reserved] (b) Monitor the overall public information program and review and...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mady, Franck, E-mail: franck.mady@unice.fr; Duchez, Jean-Bernard, E-mail: franck.mady@unice.fr; Mebrouk, Yasmine, E-mail: franck.mady@unice.fr
2014-10-21
We propose a model to describe the photo- or/and the radiation-induced darkening of ytterbium-doped silica optical fibers. This model accounts for the well-established experimental features of photo-darkening. Degradation behaviors predicted for fibers pumped in harsh environments are also fully confirmed by experimental data reported in the work by Duchez et al. (this proceeding), which gives a detailed characterization of the interplay between the effects of the pump and those of a superimposed ionizing irradiation (actual operation conditions in space-based applications for instance). In particular, dependences of the darkening build-up on the pump power, the total ionizing dose and the dosemore » rate are all correctly reproduced. The presented model is a ‘sufficient’ one, including the minimal physical ingredients required to reproduce experimental features. Refinements could be proposed to improve, e.g., quantitative kinetics.« less
Craig, D G; Lee, P; Pryde, E A; Hayes, P C; Simpson, K J
2013-12-01
Macrophage activation is implicated in the pathogenesis of the systemic inflammatory response syndrome (SIRS) following paracetamol (acetaminophen) overdose (POD). Neopterin is synthesised from macrophages and reflects the intensity of monocyte/macrophage activation. Soluble CD163 (sCD163) is a marker of alternatively activated M2 macrophages. To examine neopterin and sCD163 levels in a cohort of acute liver injury patients. Consecutive patients (n = 41, (18 (43.9%) male) with acute liver injury were enrolled. Neopterin and sCD163 levels were measured by ELISA. A total of 24/33 (72.7%) POD patients developed hepatic encephalopathy (HE), and therefore acute liver failure. Both neopterin and sCD163 levels were significantly higher in PODs compared with chronic liver disease (neopterin P < 0.001, sCD163 P = 0.038) and healthy (both P < 0.001) controls. Admission neopterin levels were significantly higher in PODs: with HE (P = 0.001); with the SIRS (P = 0.005); who required renal replacement therapy (P = 0.003); who died or required liver transplantation (P = 0.006; AUROC 78.6% (95% CI 62.2-94.9%). Serum sCD163 levels were significantly higher in those PODs with the SIRS (P = 0.033) on admission, and were higher in those PODs who died or required OLT (P = 0.024). Both admission neopterin and sCD163 levels in PODs correlated with organ failure scores but not with serum ALT. There was no significant correlation between neopterin and sCD163 values. Both serum neopterin and sCD163 levels are significantly elevated following paracetamol overdose, and reflect the degree of macrophage activation in this condition. Serum neopterin in particular may have value as an early proxy marker of macrophage activation following paracetamol overdose. © 2013 John Wiley & Sons Ltd.
CsPbBr3 nanocrystal saturable absorber for mode-locking ytterbium fiber laser
NASA Astrophysics Data System (ADS)
Zhou, Yan; Hu, Zhiping; Li, Yue; Xu, Jianqiu; Tang, Xiaosheng; Tang, Yulong
2016-06-01
Cesium lead halide perovskite nanocrystals (CsPbX3, X = Cl, Br, I) have been reported as efficient light-harvesting and light-emitting semiconductor materials, but their nonlinear optical properties have been seldom touched upon. In this paper, we prepare layered CsPbBr3 nanocrystal films and characterize their physical properties. Broadband linear absorption from ˜0.8 to over 2.2 μm and nonlinear optical absorption at the 1-μm wavelength region are measured. The CsPbBr3 saturable absorber (SA), manufactured by drop-casting of colloidal CsPbBr3 liquid solution on a gold mirror, shows modulation depth and saturation intensity of 13.1% and 10.7 MW/cm2, respectively. With this SA, mode-locking operation of a polarization-maintained ytterbium fiber laser produces single pulses with duration of ˜216 ps, maximum average output power of 10.5 mW, and the laser spectrum is centered at ˜1076 nm. This work shows that CsPbBr3 films can be efficient SA candidates for fiber lasers and also have great potential to become broadband linear and nonlinear optical materials for photonics and optoelectronics.
Noise-like pulse generation in an ytterbium-doped fiber laser using tungsten disulphide
NASA Astrophysics Data System (ADS)
Zhang, Wenping; Song, Yanrong; Guoyu, Heyang; Xu, Runqin; Dong, Zikai; Li, Kexuan; Tian, Jinrong; Gong, Shuang
2017-12-01
We demonstrated the noise-like pulse (NLP) generation in an ytterbium-doped fiber (YDF) laser with tungsten disulphide (WS2). Stable fundamental mode locking and second-order harmonic mode locking were observed. The saturable absorber (SA) was a WS2-polyvinyl alcohol film. The modulation depth of the WS2 film was 2.4%, and the saturable optical intensity was 155 MW cm-2. Based on this SA, the fundamental NLP with a pulse width of 20 ns and repetition rate of 7 MHz were observed. The autocorrelation trace of output pulses had a coherent spike, which came from NLP. The average pulse width of the spike was 550 fs on the top of a broad pedestal. The second-order harmonic NLP had a spectral bandwidth of 1.3 nm and pulse width of 10 ns. With the pump power of 400 mW, the maximum output power was 22.2 mW. To the best of our knowledge, this is the first time a noise-like mode locking in an YDF laser based on WS2-SA in an all normal dispersion regime was obtained.
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2014 CFR
2014-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2013 CFR
2013-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2010 CFR
2010-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2012 CFR
2012-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2011 CFR
2011-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
West elevation of Machine Shop (Bldg. 163) north bay. Boiler ...
West elevation of Machine Shop (Bldg. 163) north bay. Boiler Shop (Bldg. 152) is at left - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Code of Federal Regulations, 2010 CFR
2010-04-01
... conditions not contained in the model compact? 1000.163 Section 1000.163 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF... Funding Agreements Negotiating A Self-Governance Compact § 1000.163 Can a Tribe/Consortium negotiate other...
Looking northeast from roof of Machine Shop (Bldg. 163) at ...
Looking northeast from roof of Machine Shop (Bldg. 163) at transfer table pit and Boiler Shop (Bldg. 152) - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Detail of heating coil for Machine Shop (Bldg. 163) ventilation ...
Detail of heating coil for Machine Shop (Bldg. 163) ventilation system Note portion of fan visible behind coil - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Looking north at east end of Machine Shop (Bldg. 163). ...
Looking north at east end of Machine Shop (Bldg. 163). Note overhead crane rail extension and pit between rails - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Looking south from roof of Machine Shop (Bldg. 163) at ...
Looking south from roof of Machine Shop (Bldg. 163) at 120-foot turntable and site of 35-stall roundhouse - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Code of Federal Regulations, 2013 CFR
2013-07-01
... achievable (BAT). 429.163 Section 429.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... application of the best available technology economically achievable (BAT). Except as provided in 40 CFR 125... best available technology economically achievable (BAT): There shall be no discharge of process...
Code of Federal Regulations, 2014 CFR
2014-07-01
... achievable (BAT). 429.163 Section 429.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... application of the best available technology economically achievable (BAT). Except as provided in 40 CFR 125... best available technology economically achievable (BAT): There shall be no discharge of process...
18 CFR 367.1630 - Account 163, Stores expense undistributed.
Code of Federal Regulations, 2010 CFR
2010-04-01
... damages. (7) Insurance on materials and supplies and on stores equipment. (8) Losses due to breakage... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 163, Stores expense undistributed. 367.1630 Section 367.1630 Conservation of Power and Water Resources FEDERAL ENERGY...
Looking northeast at Machine Shop (Bldg. 163) south wall. Note ...
Looking northeast at Machine Shop (Bldg. 163) south wall. Note bridge crane at right and crane rail attached to building - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Yin, Mojuan; Huang, Shenghong; Lu, Baole; Chen, Haowei; Ren, Zhaoyu; Bai, Jintao
2013-09-20
A high-slope-efficiency single-frequency (SF) ytterbium-doped fiber laser, based on a Sagnac loop mirror filter (LMF), was demonstrated. It combined a simple linear cavity with a Sagnac LMF that acted as a narrow-bandwidth filter to select the longitudinal modes. And we introduced a polarization controller to restrain the spatial hole burning effect in the linear cavity. The system could operate at a stable SF oscillating at 1064 nm with the obtained maximum output power of 32 mW. The slope efficiency was found to be primarily dependent on the reflectivity of the fiber Bragg grating. The slope efficiency of multi-longitudinal modes was higher than 45%, and the highest slope efficiency of the single longitudinal mode we achieved was 33.8%. The power stability and spectrum stability were <2% and <0.1%, respectively, and the signal-to-noise ratio measured was around 60 dB.
Effects of adding metals to MoS2 in a ytterbium doped Q-switched fiber laser
NASA Astrophysics Data System (ADS)
Khaleque, Abdul; Liu, Liming
2018-03-01
Molybdenum disulfide (MoS2) is widely used in lubricants, metallic alloys and in electronic and optical components. It is also used as saturable absorbers (SAs) in lasers (e.g. fiber lasers): a simple deposition of MoS2 on the fiber end can create a saturable absorber without the necessity of extensive alignment of the optical beam. In this article, we study the effects of adding different metals (Cr, Au, and Al) to MoS2 in a ytterbium (Yb)-doped Q-switched fiber laser. Experimental results show that the addition of a thin layer of gold and aluminium can reduce pulse durations to about 5.8 μs and 8.5 μs, respectively, compared with pure MoS2 with pulse duration of 12 μs. Experimental analysis of the combined metal and MoS2 based composite SAs can be useful in fiber laser applications where it may also find applications in medical, three dimensional (3D) active imaging and dental applications.
Grønbaek, H; Sandahl, T D; Mortensen, C; Vilstrup, H; Møller, H J; Møller, S
2012-07-01
Activation of Kupffer cells may be involved in the pathogenesis of portal hypertension by release of vasoconstrictive substances and fibrosis due to co-activation of hepatic stellate cells. To study soluble plasma (s) CD163, a specific marker of activated macrophages, as a biomarker for portal hypertension in patients with liver cirrhosis. We measured sCD163 concentration and the hepatic venous pressure gradient (HVPG) by liver vein catheterisation in 81 cirrhosis patients (Child-Pugh CP-A: n = 26, CP-B: n = 29, CP-C: n = 26) and 22 healthy subjects. We also measured their cardiac output (CO), cardiac index and systemic vascular resistance (SVR). Liver status was examined by Child-Pugh and MELD-score. In cirrhosis, sCD163 concentration was nearly three times higher than in controls (4.7 ± 2.5 vs. 1.6 ± 0.5 mg/L, P < 0.001). sCD163 was also higher, as measured in steps by CP-score (P < 0.001). The HVPG rose steeply to an asymptote of 22 mmHg with sCD163 up to about 5 mg/L and not to higher values with higher sCD163. In a multivariate analysis, sCD163 was the only independent predictor of the HVPG but did not predict any of the systemic circulatory findings. sCD163 > 3.95 mg/L (upper normal limit) predicted HVPG ≥ 10 mmHg with a positive predictive value of 0.99. Circulating sCD163 originating from activated Kupffer cells is increased in cirrhosis with increasing Child-Pugh score and with increasing HVPG, and it is an independent predictor for HVPG. These findings support a primary role of macrophage activation in portal hypertension, and may indicate a target for biological intervention. © 2012 Blackwell Publishing Ltd.
Detail of Machine Shop (Bldg. 163) south wall and crane ...
Detail of Machine Shop (Bldg. 163) south wall and crane rail. The overlapped tracks in foreground were used to store wheelsets - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
NASA Astrophysics Data System (ADS)
Dua, Puneit
Increased demand for larger bandwidth and longer inter-amplifiers distances translates to higher power budgets for fiber optic communication systems in order to overcome large splitting losses and achieve acceptable signal-to-noise ratios. Due to their unique design ytterbium sensitized erbium doped, double clad fiber amplifiers; offer significant increase in the output powers that can be obtained. In this thesis we investigate, a one-stage, high power erbium and ytterbium co-doped double clad fiber amplifier (DCFA) with output power of 1.4W, designed and built in our lab. Experimental demonstration and numerical simulation techniques have been used to systematically study the applications of such an amplifier and the effects of incorporating it in various fiber optic communication systems. Amplitude modulated subcarrier multiplexed (AM-SCM) CATV distribution experiment has been performed to verify the feasibility of using this amplifier in an analog/digital communication system. The applications of the amplifier as a Fabry-Perot and ring fiber laser with an all-fiber cavity, a broadband supercontinuum source and for generation of high power, short pulses at 5GHz have been experimentally demonstrated. A variety of observable nonlinear effects occur due to the high intensity of the optical powers confined in micron-sized cores of the fibers, this thesis explores in detail some of these effects caused by using the high power Er/Yb double clad fiber amplifier. A fiber optic based analog/digital CATV system experiences composite second order (CSO) distortion due to the interaction between the gain tilt---the variation of gain with wavelength, of the doped fiber amplifier and the wavelength chirp of the directly modulated semiconductor laser. Gain tilt of the Er/Yb co-doped fiber amplifier has been experimentally measured and its contribution to the CSO of the system calculated. Theoretical analysis of a wavelength division multiplexed system with closely spaced
Code of Federal Regulations, 2010 CFR
2010-07-01
... economically achievable (BAT). 415.163 Section 415.163 Protection of Environment ENVIRONMENTAL PROTECTION... achievable (BAT). (a) Except as provided in 40 CFR 125.30 through 125.32, any existing point source subject... technology economically achievable (BAT): There shall be no discharge of process wastewater pollutants to...
Code of Federal Regulations, 2011 CFR
2011-07-01
... economically achievable (BAT). 415.163 Section 415.163 Protection of Environment ENVIRONMENTAL PROTECTION... achievable (BAT). (a) Except as provided in 40 CFR 125.30 through 125.32, any existing point source subject... technology economically achievable (BAT): There shall be no discharge of process wastewater pollutants to...
Code of Federal Regulations, 2012 CFR
2012-07-01
... economically achievable (BAT). 415.163 Section 415.163 Protection of Environment ENVIRONMENTAL PROTECTION... achievable (BAT). (a) Except as provided in 40 CFR 125.30 through 125.32, any existing point source subject... technology economically achievable (BAT): There shall be no discharge of process wastewater pollutants to...
Kozjak-Pavlovic, Vera; Prell, Florian; Thiede, Bernd; Götz, Monika; Wosiek, Dominik; Ott, Christine; Rudel, Thomas
2014-02-20
Oxidative phosphorylation (OXPHOS) in mitochondria takes place at the inner membrane, which folds into numerous cristae. The stability of cristae depends, among other things, on the mitochondrial intermembrane space bridging complex. Its components include inner mitochondrial membrane protein mitofilin and outer membrane protein Sam50. We identified a conserved, uncharacterized protein, C1orf163 [SEL1 repeat containing 1 protein (SELRC1)], as one of the proteins significantly reduced after the knockdown of Sam50 and mitofilin. We show that C1orf163 is a mitochondrial soluble intermembrane space protein. Sam50 depletion affects moderately the import and assembly of C1orf163 into two protein complexes of approximately 60kDa and 150kDa. We observe that the knockdown of C1orf163 leads to reduction of levels of proteins belonging to the OXPHOS complexes. The activity of complexes I and IV is reduced in C1orf163-depleted cells, and we observe the strongest defects in the assembly of complex IV. Therefore, we propose C1orf163 to be a novel factor important for the assembly of respiratory chain complexes in human mitochondria and suggest to name it RESA1 (for RESpiratory chain Assembly 1). Copyright © 2013 Elsevier Ltd. All rights reserved.
Looking west at Machine Shop (Bldg. 163) north bay interior. ...
Looking west at Machine Shop (Bldg. 163) north bay interior. Note the Shaw 15-ton bridge crane and pits between the rails of several tracks - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Bose and Fermi Gases of Ultracold Ytterbium in a Triangular Optical Lattice
NASA Astrophysics Data System (ADS)
Thobe, Alexander; Doerscher, Soeren; Hundt, Bastian; Kochanke, Andre; Becker, Christoph; Sengstock, Klaus
2013-05-01
Quantum gases of alkaline-earth like atoms such as Calcium, Strontium and Ytterbium (Yb) open up exciting new possibilities for the study of many body physics in optical lattices, ranging from SU(N) symmetric spin Hamiltonians to the Kondo Lattice Model. Here, we present experimental studies of ultracold bosonic and fermionic Yb quantum gases. Unlike other experiments studying ultracold alkaline earth-like atoms, we have implemented a 2D-MOT instead of a Zeeman slower as a source of cold atoms. From the 2D-MOT, operating on the broad 1S0 -->1P1 transtition, the atoms are directly loaded into the 3D-MOT operating on a narrow intercombination line. The atoms are then evaporatively cooled to quantum degeneracy in a crossed optical dipole trap. With this setup we routinely produce BECs and degenerate Fermi gases of different Yb isotopes. Moreover, we present first results on spectroscopy of an interacting fermi gas on the ultranarrow 1S0 -->3P0 clock transition in a magic wavelength optical lattice. In future experiments, this spectroscopy will serve as a versatile tool for interaction sensing and selective addressing of atoms in a wavelength tunable, state dependent, triangular optical lattice, which we are currently implementing. This work is supported by DFG within SFB 925 and GrK 1355, as well as EU FETOpen (iSense).
NASA Astrophysics Data System (ADS)
Hong, Z.-Y.; Iino, T.; Hagihara, H.; Maeno, T.; Okano, K.; Yasukuni, R.; Hosokawa, Y.
2018-03-01
A micrometer-scale explosion with cavitation bubble generation is induced by focusing a femtosecond laser in an aqueous solution. We have proposed to apply the explosion as an impulsive force to manipulate mammalian cells especially in microfluidic chip. Herein, we employed an amplified femtosecond ytterbium laser as an excitation source for the explosion and evaluated cell damage in the manipulation process to clarify the application potential. The damage of C2C12 myoblast cell prepared as a representative mammalian cell was investigated as a function of distance between cell and laser focal point. Although the cell received strong damage on the direct laser irradiation condition, the damage sharply decreased with increasing distance. Since the threshold distance, above which the cell had no damage, was consistent with radius of the cavitation bubble, impact of the cavitation bubble would be a critical factor for the cell damage. The damage had strong nonlinearity in the pulse energy dependence. On the other hand, cell position shift by the impact of the cavitation bubble was almost proportional to the pulse energy. In balance between the cell viability and the cell position shift, we elucidated controllability of the cell manipulation in microfluidic chip.
Flux growth of Yb(6.6)Ir(6)Sn(16) having mixed-valent ytterbium.
Peter, Sebastian C; Subbarao, Udumula; Rayaprol, Sudhindra; Martin, Joshua B; Balasubramanian, Mahalingam; Malliakas, Christos D; Kanatzidis, Mercouri G
2014-07-07
The compound Yb6.6Ir6Sn16 was obtained as single crystals in high yield from the reaction of Yb with Ir and Sn run in excess indium. Single-crystal X-ray diffraction analysis shows that Yb6.6Ir6Sn16 crystallizes in the tetragonal space group P42/nmc with a = b = 9.7105(7) Å and c = 13.7183(11) Å. The crystal structure is composed of a [Ir6Sn16] polyanionic network with cages in which the Yb atoms are embedded. The Yb sublattice features extensive vacancies on one crystallographic site. Magnetic susceptibility measurements on single crystals indicate Curie-Weiss law behavior <100 K with no magnetic ordering down to 2 K. The magnetic moment within the linear region (<100 K) is 3.21 μB/Yb, which is ∼70% of the expected value for a free Yb(3+) ion suggesting the presence of mixed-valent ytterbium atoms. X-ray absorption near edge spectroscopy confirms that Yb6.6Ir6Sn16 exhibits mixed valence. Resistivity and heat capacity measurements for Yb6.6Ir6Sn16 indicate non-Fermi liquid metallic behavior.
CD-163 correlated with symptoms (pain or discomfort) of prostatic inflammation.
Yamamichi, Fukashi; Shigemura, Katsumi; Arakawa, Soichi; Tanaka, Kazushi; Fujisawa, Masato
2015-01-01
The purpose of this study is to identify significant immune-system related for symptom of patients with prostatic inflammation in order to investigate the etiology of prostatic inflammation which may relate to potentially chronic prostatitis (CP). We investigated the expression of immune system-related biomarkers such as Interleukin (IL) -6 (humoral immunity), CD-3 (T-lymphocyte), and CD-163 (macrophage) in prostate biopsy (PBx) specimens from patients with prostatic inflammation (without cancer) which had been neither clinically diagnosed benign prostatic hyperplasia nor chronic prostatitis. We examined the correlation between these markers' expressions and the symptom scores using the National Institutes of Health-Chronic Prostatitis Symptom Index (NIH-CPSI), International Prostate Symptom Score (IPSS)/quality of life (QOL) which are the index for lower urinary tract symptoms (LUTS). Our results showed CD-163 (macrophage) reflected pain or discomfort on NIH-CPSI scores (P=0.0389 and r=0.3307) in the patients with prostatic inflammation; however, the control patients had no significant correlation between symptom scores and those immune-related markers' expression. These results suggest that pain or discomfort related to macrophages in the relationship between immune-system and the symptom of prostatic inflammation. In conclusion, CD-163, related to immune-system (macrophage), correlated with symptoms (pain or discomfort) of prostatic inflammation and might represent a significant immune-system related biomarker for pain or LUTS score in potentially CP.
Development of Trivalent Ytterbium Doped Fluorapatites for Diode-Pumped Laser Applications
DOE Office of Scientific and Technical Information (OSTI.GOV)
Bayramian, Andrew J.
One of the major motivators of this work is the Mercury Project, which is a 1 kW scalable diode-pumped solid-state laser system under development at Lawrence Livermore National Laboratory (LLNL). Major goals include 100 J pulses, 10% wallplug efficiency, 10 Hz repetition rate, and a 5 times diffraction limited beam. To achieve these goals the Mercury laser incorporates ytterbium doped Sr 5(PO 4) 3F (S-FAP) as the amplifier gain medium. The primary focus of this thesis is a full understanding of the properties of this material which are necessary for proper design and modeling of the system. Ytterbium doped fluorapatites,more » which were previously investigated at LLNL, were found to be ideal candidate materials for a high power amplifier systems providing high absorption and emission cross sections, long radiative lifetimes, and high efficiency. A family of barium substituted S-FAP crystals were grown in an effort to modify the pump and emission bandwidths for application to broadband diode pumping and short pulse generation. Crystals of Yb 3+:Sr 5-xBa x(PO 4) 3F where x < 1 showed homogeneous lines offering 8.4 nm (1.8 times enhancement) of absorption bandwidth and 6.9 nm (1.4 times enhancement) of emission bandwidth. The gain saturation fluence of Yb:S-FAP was measured to be 3.2 J/cm 2 using a pump-probe experiment where the probe laser was a high intensity Q-switched master oscillator power amplifier system. The extraction data was successfully fit to a homogeneous extraction model. The crystal quality of Czochralski grown Yb:S-FAP crystals, which have been plagued by many defects such as cracking, cloudiness, bubble core, slip dislocations, and anomalous absorption, was investigated interferometrically and quantified by means of Power Spectral Density (PSD) plots. The very best crystals grown to date were found to have adequate crystal quality for use in the Mercury laser system. In addition to phase distortions which are fixed by material growth, thermal
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2012 CFR
2012-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2014 CFR
2014-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2011 CFR
2011-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2013 CFR
2013-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
Looking north through Machine Shop (Bldg. 163) Track 409 Doors ...
Looking north through Machine Shop (Bldg. 163) Track 409 Doors at transfer table, with Boiler Shop (Bldg. 152) at left and C.W.E. Shop No. 2 (Bldg. 47) at right - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
The environment and star formation of H II region Sh2-163: a multi-wavelength study
NASA Astrophysics Data System (ADS)
Yu, Naiping; Wang, Jun-Jie; Li, Nan
2014-12-01
To investigate the environment of H II region Sh2-163 and search for evidence of triggered star formation in this region, we performed a multi-wavelength study of this H II region. Most of our data were taken from large-scale surveys: 2MASS, CGPS, MSX and SCUBA. We also made CO molecular line observations, using the 13.7-m telescope. The ionized region of Sh2-163 is detected by both the optical and radio continuum observations. Sh2-163 is partially bordered by an arc-like photodissociation region (PDR), which is coincident with the strongest optical and radio emissions, indicating interactions between the H II region and the surrounding interstellar medium. Two molecular clouds were discovered on the border of the PDR. The morphology of these two clouds suggests they are compressed by the expansion of Sh2-163. In cloud A, we found two molecular clumps. And it seems star formation in clump A2 is much more active than in clump A1. In cloud B, we found new outflow activities and massive star(s) are forming inside. Using 2MASS photometry, we tried to search for embedded young stellar object (YSO) candidates in this region. The very good agreement between CO emission, infrared shell and YSOs suggest that it is probably a star formation region triggered by the expansion of Sh2-163. We also found the most likely massive protostar related to IRAS 23314+6033.
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 42 Public Health 2 2012-10-01 2012-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 42 Public Health 2 2011-10-01 2011-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 42 Public Health 2 2013-10-01 2013-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 42 Public Health 2 2014-10-01 2014-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Obligated service and breach of contract. 163.42 Section... breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... request for waiver. (b) Breach of contract. Any individual who has participated in and accepted financial...
14 CFR 61.163 - Aeronautical experience: Powered-lift category rating.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aeronautical experience: Powered-lift... Transport Pilots § 61.163 Aeronautical experience: Powered-lift category rating. (a) A person who is applying for an airline transport pilot certificate with a powered-lift category rating must have at least...
14 CFR 61.163 - Aeronautical experience: Powered-lift category rating.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 14 Aeronautics and Space 2 2011-01-01 2011-01-01 false Aeronautical experience: Powered-lift... Transport Pilots § 61.163 Aeronautical experience: Powered-lift category rating. (a) A person who is applying for an airline transport pilot certificate with a powered-lift category rating must have at least...
Machine Shop (Bldg. 163) north bay, east end interior, with ...
Machine Shop (Bldg. 163) north bay, east end interior, with a 250-ton Shaw bridge crane on the upper rails and two smaller P&H bridge cranes on the lower rails - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Boiler Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
NASA Astrophysics Data System (ADS)
Mohsin Al-Hayali, Sarah Kadhim; Hadi Al-Janabi, Abdul
2018-07-01
We report on the generation of a triple-wavelength passively Q-switched ytterbium-doped fibre laser using a saturable absorber (SA) based on zinc oxide nanoparticles (ZnO NPs) film. The SA was fabricated by embedding ZnO NPs powder into a polyvinyl alcohol as a host polymer. By properly adjusting the pump power and the polarization state, single-, dual- and triple-wavelength Q-switching are stably generated without additional components (such as optical filter, or fibre grating). For the triple wavelength operation, the fibre laser generates a maximum pulse repetition of 87.9 kHz with the shortest pulse duration of 2.7 μs. To the best of authors' knowledge, it's the first demonstration of triple-wavelength passively Q-switching fibre laser using ZnO NPs as a SA. Our results suggest that ZnO is a promising SA for multi-wavelength laser operation.
NASA Technical Reports Server (NTRS)
Zhu, Dongming; Fox, Dennis S.; Ghosn, Louis J.; Harder, Bryan
2011-01-01
Environmental barrier coatings will play a crucial role in future advanced gas turbine engines because of their ability to significantly extend the temperature capability and stability of SiC/SiC ceramic matrix composite (CMC) engine components, thus improving the engine performance. In order to develop high performance, robust coating systems for engine components, appropriate test approaches simulating operating temperature gradient and stress environments for evaluating the critical coating properties must be established. In this paper, thermal gradient mechanical testing approaches for evaluating creep and fatigue behavior of environmental barrier coated SiC/SiC CMC systems will be described. The creep and fatigue behavior of Hafnia and ytterbium silicate environmental barrier coatings on SiC/SiC CMC systems will be reported in simulated environmental exposure conditions. The coating failure mechanisms will also be discussed under the heat flux and stress conditions.
Kumar, S Chaitanya; Samanta, G K; Ebrahim-Zadeh, M
2009-08-03
Characteristics of high-power, narrow-linewidth, continuous-wave (cw) green radiation obtained by simple single-pass second-harmonic-generation (SHG) of a cw ytterbium fiber laser at 1064 nm in the nonlinear crystals of PPKTP and MgO:sPPLT are studied and compared. Temperature tuning and SHG power scaling up to nearly 10 W for input fundamental power levels up to 30 W are performed. Various contributions to thermal effects in both crystals, limiting the SHG conversion efficiency, are studied. Optimal focusing conditions and thermal management schemes are investigated to maximize SHG performance in MgO:sPPLT. Stable green output power and high spatial beam quality with M(2)<1.33 and M(2)<1.34 is achieved in MgO:sPPLT and PPKTP, respectively.
Hou, Lei; Guo, Hongyu; Wang, Yonggang; Sun, Jiang; Lin, Qimeng; Bai, Yang; Bai, Jintao
2018-04-02
Ultrafast fiber laser light sources attract enormous interest due to the booming applications they are enabling, including long-distance communication, optical metrology, detecting technology of infra-biophotons, and novel material processing. In this paper, we demonstrate 175 fs dispersion-managed soliton (DMS) mode-locked ytterbium-doped fiber (YDF) laser based on single-walled carbon nanotubes (SWCNTs) saturable absorber (SA). The output DMSs have been achieved with repetition rate of 21.2 MHz, center wavelength of 1025.5 nm, and a spectral width of 32.7 nm. The operation directly pulse duration of 300 fs for generated pulse is the reported shortest pulse width for broadband SA based YDF lasers. By using an external grating-based compressor, the pulse duration could be compressed down to 175 fs. To the best of our knowledge, it is the shortest pulse duration obtained directly from YDF laser based on broadband SAs. In this paper, SWCNTs-SA has been utilized as the key optical component (mode locker) and the grating pair providing negative dispersion acts as the dispersion controller.
Fu, Xinmiao; Chang, Zengyi
2004-04-02
Small heat shock proteins (sHsps) usually exist as oligomers that undergo dynamic oligomeric dissociation/re-association, with the dissociated oligomers as active forms to bind substrate proteins under heat shock conditions. In this study, however, we found that Hsp16.3, one sHsp from Mycobacterium tuberculosis, is able to sensitively modulate its chaperone-like activity in a range of physiological temperatures (from 25 to 37.5 degrees C) while its native oligomeric size is still maintained. Further analysis demonstrated that Hsp16.3 exposes higher hydrophobic surfaces upon temperatures increasing and that a large soluble complex between Hsp16.3 and substrate is formed only in the condition of heating temperature up to 35 and 37.5 degrees C. Structural analysis by fluorescence anisotropy showed that Hsp16.3 nonameric structure becomes more dynamic and variable at elevated temperatures. Moreover, subunit exchange between Hsp16.3 oligomers was found to occur faster upon temperatures increasing as revealed by fluorescence energy resonance transfer. These observations indicate that Hsp16.3 is able to modulate its chaperone activity by adjusting the dynamics of oligomeric dissociation/re-association process while maintaining its static oligomeric size unchangeable. A kinetic model is therefore proposed to explain the mechanism of sHsps-binding substrate proteins through oligomeric dissociation. The present study also implied that Hsp16.3 is at least capable of binding non-native proteins in vivo while expressing in the host organism that survives at 37 degrees C.
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2012 CFR
2012-07-01
....160. This section does not apply to automatic sprinkler systems which are covered under § 1910.159. (b...] Other Fire Protection Systems ... 29 Labor 5 2012-07-01 2012-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2014 CFR
2014-07-01
....160. This section does not apply to automatic sprinkler systems which are covered under § 1910.159. (b...] Other Fire Protection Systems ... 29 Labor 5 2014-07-01 2014-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163...
Looking west at Machine Shop (Bldg. 163) south bay interior. ...
Looking west at Machine Shop (Bldg. 163) south bay interior. Note the Shaw 15-ton bridge crane. This portion of the building housed machine tools and locomotive component repair functions that supported the erecting shop operations - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... preparation of the product, cocoa or a mixture of cocoa and chocolate liquor is used in such quantity that the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet cocoa and vegetable fat coating. 163.150... (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products...
42 CFR 410.163 - Payment for services furnished to kidney donors.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Payment for services furnished to kidney donors... Benefits § 410.163 Payment for services furnished to kidney donors. Notwithstanding any other provisions of... an individual who donates a kidney for transplant surgery. ...
42 CFR 410.163 - Payment for services furnished to kidney donors.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 42 Public Health 2 2011-10-01 2011-10-01 false Payment for services furnished to kidney donors... Benefits § 410.163 Payment for services furnished to kidney donors. Notwithstanding any other provisions of... an individual who donates a kidney for transplant surgery. ...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2010 CFR
2010-07-01
... Section 1910.163 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Fixed Fire... extinguishing agent, installed to meet a particular OSHA standard. These systems shall also comply with § 1910...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2011 CFR
2011-07-01
... Section 1910.163 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Fixed Fire... extinguishing agent, installed to meet a particular OSHA standard. These systems shall also comply with § 1910...
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio
2016-01-01
Macrophages play an important role in rhabdomyolysis-acute kidney injury (AKI), although the molecular mechanisms involved in macrophage differentiation are poorly understood. We analyzed the expression and regulation of CD163, a membrane receptor mainly expressed by anti-inflammatory M2 macrophages, in rhabdomyolysis-AKI and developed targeted probes for its specific detection in vivo by MRI. Intramuscular injection of glycerol in mice promoted an early inflammatory response, with elevated proportion of M1 macrophages, and partial differentiation towards a M2 phenotype in later stages, where increased CD163 expression was observed. Immunohistological studies confirmed the presence of CD163-macrophages in human rhabdomyolysis-AKI. In cultured macrophages, myoglobin upregulated CD163 expression via HO-1/IL-10 axis. Moreover, we developed gold-coated iron oxide nanoparticles vectorized with an anti-CD163 antibody that specifically targeted CD163 in kidneys from glycerol-injected mice, as determined by MRI studies, and confirmed by electron microscopy and immunological analysis. Our findings are the first to demonstrate that CD163 is present in both human and experimental rhabdomyolysis-induced AKI, suggesting an important role of this molecule in this pathological condition. Therefore, the use of probes targeting CD163-macrophages by MRI may provide important information about the cellular composition of renal lesion in rhabdomyolysis.
CsPbBr{sub 3} nanocrystal saturable absorber for mode-locking ytterbium fiber laser
DOE Office of Scientific and Technical Information (OSTI.GOV)
Zhou, Yan; Li, Yue; Xu, Jianqiu
Cesium lead halide perovskite nanocrystals (CsPbX{sub 3}, X = Cl, Br, I) have been reported as efficient light-harvesting and light-emitting semiconductor materials, but their nonlinear optical properties have been seldom touched upon. In this paper, we prepare layered CsPbBr{sub 3} nanocrystal films and characterize their physical properties. Broadband linear absorption from ∼0.8 to over 2.2 μm and nonlinear optical absorption at the 1-μm wavelength region are measured. The CsPbBr{sub 3} saturable absorber (SA), manufactured by drop-casting of colloidal CsPbBr{sub 3} liquid solution on a gold mirror, shows modulation depth and saturation intensity of 13.1% and 10.7 MW/cm{sup 2}, respectively. With this SA, mode-locking operationmore » of a polarization-maintained ytterbium fiber laser produces single pulses with duration of ∼216 ps, maximum average output power of 10.5 mW, and the laser spectrum is centered at ∼1076 nm. This work shows that CsPbBr{sub 3} films can be efficient SA candidates for fiber lasers and also have great potential to become broadband linear and nonlinear optical materials for photonics and optoelectronics.« less
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that: (1) In the preparation of the product, cocoa or a mixture of cocoa and chocolate liquor is used in such quantity that the...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
Qiang, Zexuan; Geng, Jihong; Luo, Tao; Zhang, Jun; Jiang, Shibin
2014-02-01
A highly efficient ytterbium-free erbium-doped silicate glass fiber has been developed for high-power fiber laser applications at an eye-safe wavelength near 1.55 μm. Our preliminary experiments show that high laser efficiency can be obtained from a relatively short length of the gain fiber when resonantly pumped at 1535 nm in both core- and cladding-pumping configurations. With a core-pumping configuration as high as 75%, optical-to-optical efficiency and 4 W output power were obtained at 1560 nm from a 1 m long gain fiber. When using a cladding-pumping configuration, approximately 13 W output power with 67.7% slope efficiency was demonstrated from a piece of 2 m long fiber. The lengths of silicate-based gain fiber are much shorter than their silica-based counterparts used in other experiments, which is significantly important for high-power narrow-band and/or pulsed laser applications.
Machine Shop (Bldg. 163) north bay, east end interior looking ...
Machine Shop (Bldg. 163) north bay, east end interior looking northeast. Note the 250-ton Shaw bridge crane on the upper rails and two smaller P&H bridge cranes on the lower rails. Three cranes shared the lower rails - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Ultracold Mixtures of Rubidium and Ytterbium for Open Quantum System Engineering
NASA Astrophysics Data System (ADS)
Herold, Creston David
Exquisite experimental control of quantum systems has led to sharp growth of basic quantum research in recent years. Controlling dissipation has been crucial in producing ultracold, trapped atomic samples. Recent theoretical work has suggested dissipation can be a useful tool for quantum state preparation. Controlling not only how a system interacts with a reservoir, but the ability to engineer the reservoir itself would be a powerful platform for open quantum system research. Toward this end, we have constructed an apparatus to study ultracold mixtures of rubidium (Rb) and ytterbium (Yb). We have developed a Rb-blind optical lattice at 423.018(7) nm, which will enable us to immerse a lattice of Yb atoms (the system) into a Rb BEC (superfluid reservoir). We have produced Bose-Einstein condensates of 170Yb and 174Yb, two of the five bosonic isotopes of Yb, which also has two fermionic isotopes. Flexible optical trapping of Rb and Yb was achieved with a two-color dipole trap of 532 and 1064 nm, and we observed thermalization in ultracold mixtures of Rb and Yb. Using the Rb-blind optical lattice, we measured very small light shifts of 87Rb BECs near the light shift zero-wavelengths adjacent the 6p electronic states, through a coherent series of lattice pulses. The positions of the zero-wavelengths are sensitive to the electric dipole matrix elements between the 5s and 6p states, and we made the first experimental measurement of their strength. By measuring a light shift, we were not sensitive to excited state branching ratios, and we achieved a precision better than 0.3%.
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio
2016-01-01
Macrophages play an important role in rhabdomyolysis-acute kidney injury (AKI), although the molecular mechanisms involved in macrophage differentiation are poorly understood. We analyzed the expression and regulation of CD163, a membrane receptor mainly expressed by anti-inflammatory M2 macrophages, in rhabdomyolysis-AKI and developed targeted probes for its specific detection in vivo by MRI. Intramuscular injection of glycerol in mice promoted an early inflammatory response, with elevated proportion of M1 macrophages, and partial differentiation towards a M2 phenotype in later stages, where increased CD163 expression was observed. Immunohistological studies confirmed the presence of CD163-macrophages in human rhabdomyolysis-AKI. In cultured macrophages, myoglobin upregulated CD163 expression via HO-1/IL-10 axis. Moreover, we developed gold-coated iron oxide nanoparticles vectorized with an anti-CD163 antibody that specifically targeted CD163 in kidneys from glycerol-injected mice, as determined by MRI studies, and confirmed by electron microscopy and immunological analysis. Our findings are the first to demonstrate that CD163 is present in both human and experimental rhabdomyolysis-induced AKI, suggesting an important role of this molecule in this pathological condition. Therefore, the use of probes targeting CD163-macrophages by MRI may provide important information about the cellular composition of renal lesion in rhabdomyolysis. PMID:27162559
25 CFR 163.11 - Forest management planning and sustained yield management.
Code of Federal Regulations, 2011 CFR
2011-04-01
... GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.11 Forest management planning and... 25 Indians 1 2011-04-01 2011-04-01 false Forest management planning and sustained yield management... management planning for Indian forest land shall be carried out through participation in the development and...
Popescu, Luca; Gaudreault, Natasha N; Whitworth, Kristen M; Murgia, Maria V; Nietfeld, Jerome C; Mileham, Alan; Samuel, Melissa; Wells, Kevin D; Prather, Randall S; Rowland, Raymond R R
2017-01-15
African swine fever is a highly contagious, often fatal disease of swine for which there is no vaccine or other curative treatment. The macrophage marker, CD163, is a putative receptor for African swine fever virus (ASFV). Pigs possessing a complete knockout of CD163 on macrophages were inoculated with Georgia 2007/1, a genotype 2 isolate. Knockout and wild type pen mates became infected and showed no differences in clinical signs, mortality, pathology or viremia. There was also no difference following in vitro infection of macrophages. The results do not rule out the possibility that other ASFV strains utilize CD163, but demonstrate that CD163 is not necessary for infection with the Georgia 2007/1 isolate. This work rules out a significant role for CD163 in ASFV infection and creates opportunities to focus on alternative receptors and entry mechanisms. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Machine Shop (Bldg. 163) north bay interior looking east, with ...
Machine Shop (Bldg. 163) north bay interior looking east, with a 250-ton Shaw bridge crane on the upper rails and two smaller P&H bridge cranes on the lower rails. This high-bay, north portion of the building served as the erecting shop - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Federal Register 2010, 2011, 2012, 2013, 2014
2012-08-28
... DEPARTMENT OF LABOR Employee Benefits Security Administration 163rd Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Teleconference Meeting Pursuant to the.... 1142, the 163rd open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2011 CFR
2011-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2013 CFR
2013-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2010 CFR
2010-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2012 CFR
2012-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2014 CFR
2014-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
31 CFR 363.163 - How do I convert an eligible definitive savings bond?
Code of Federal Regulations, 2010 CFR
2010-07-01
... REGULATIONS GOVERNING SECURITIES HELD IN TREASURYDIRECT Conversion of a Definitive Savings Bond § 363.163 How do I convert an eligible definitive savings bond? We will provide online instructions for converting...
Dultz, G; Gerber, L; Zeuzem, S; Sarrazin, C; Waidmann, O
2016-04-01
Recent data highlighted the association of the macrophage activation marker CD163 with histological inflammation and fibrosis in chronic hepatitis C virus (HCV) infection. The aim of this study was to investigate the influence of successful antiviral treatment and IL28B genotypes on macrophage activation reflected by CD163 levels in HCV infected patients. In a retrospective cohort study, serum sCD163 levels were correlated with results of liver histopathology, IL28B genotyping and clinical parameters in 329 patients with HCV infection, 15 healthy controls and in 161 patients who achieved a sustained virologic response after antiviral treatment. sCD163 levels were significantly higher in patients with chronic HCV infection in comparison to healthy controls (5202 vs 896 ng/mL, P < 0.001). In the multivariate logistic regression analyses, sCD163 was independently associated with histologically determined inflammation (P = 0.043) but not with fibrosis (P = 0.091). sCD163 dropped significantly after successful antiviral treatment in comparison to baseline values (5202 vs 3093 ng/mL, P < 0.001). In the univariate analyses, sCD163 was significantly associated with IL28B genotype (C/C vs C/T+T/T) with higher values in the C/C group (6098 vs 4812 ng/mL, P = 0.003). In the multivariate logistic regression model, sCD163 levels were significantly associated with IL28B genotype (P = 0.003) and sustained virologic response (SVR) (P < 0.001). Our data support the association of activated liver macrophages with hepatic necroinflammation in chronic HCV infection as sCD163 levels drop rapidly after SVR. The irresponsiveness of IL28B minor genotypes to interferon might be related to a lower level of macrophage activation in these patients. © 2015 John Wiley & Sons Ltd.
X-ray Excitation Triggers Ytterbium Anomalous Emission in CaF2:Yb but Not in SrF2:Yb.
Hughes-Currie, Rosa B; Ivanovskikh, Konstantin V; Wells, Jon-Paul R; Reid, Michael F; Gordon, Robert A; Seijo, Luis; Barandiarán, Zoila
2017-03-16
Materials that luminesce after excitation with ionizing radiation are extensively applied in physics, medicine, security, and industry. Lanthanide dopants are known to trigger crystal scintillation through their fast d-f emissions; the same is true for other important applications as lasers or phosphors for lighting. However, this ability can be seriously compromised by unwanted anomalous emissions often found with the most common lanthanide activators. We report high-resolution X-ray-excited optical (IR to UV) luminescence spectra of CaF 2 :Yb and SrF 2 :Yb samples excited at 8949 eV and 80 K. Ionizing radiation excites the known anomalous emission of ytterbium in the CaF 2 host but not in the SrF 2 host. Wave function-based ab initio calculations of host-to-dopant electron transfer and Yb 2+ /Yb 3+ intervalence charge transfer explain the difference. The model also explains the lack of anomalous emission in Yb-doped SrF 2 excited by VUV radiation.
NASA Astrophysics Data System (ADS)
Fontaine, Arjun K.; Kirchner, Matthew S.; Caldwell, John H.; Weir, Richard F.; Gibson, Emily A.
2018-02-01
Two-photon microscopy is a powerful tool of current scientific research, allowing optical visualization of structures below the surface of tissues. This is of particular value in neuroscience, where optically accessing regions within the brain is critical for the continued advancement in understanding of neural circuits. However, two-photon imaging at significant depths have typically used Ti:Sapphire based amplifiers that are prohibitively expensive and bulky. In this study, we demonstrate deep tissue two-photon imaging using a compact, inexpensive, turnkey operated Ytterbium fiber laser (Y-Fi, KM Labs). The laser is based on all-normal dispersion (ANDi) that provides short pulse durations and high pulse energies. Depth measurements obtained in ex vivo mouse cortex exceed those obtainable with standard two-photon microscopes using Ti:Sapphire lasers. In addition to demonstrating the capability of deep-tissue imaging in the brain, we investigated imaging depth in highly-scattering white matter with measurements in sciatic nerve showing limited optical penetration of heavily myelinated nerve tissue relative to grey matter.
Singh, A K; Jain, A K; Mehtab, Sameena
2007-08-06
Plasticized membranes using 1-phenyl-3-(2-thiazolyl)-2-thiourea (PTT) and 1-phenyl-3-(2-thiazolyl)-2-urea (PTU) have been prepared and explored as ytterbium ion-selective sensors. Effect of various plasticizers, viz. chloronaphthalene (CN), o-nitrophenyloctyl ether (o-NPOE), dibutylphthalate (DBP), dioctylsebacate (DOS) and anion excluders, sodium tetraphenylborate (NaTPB) and oleic acid (OA) was studied and improved membrane performance was observed. Optimum performance was noted with membrane of PTT having composition of PTT (3.5):PVC (80):DOS (160):NaTPB (1.5) in mg. The sensor works satisfactorily in the concentration range 1.2x10(-7) to 1.0x10(-2) M (detection limit 5.5x10(-8) M) with a Nernstian slope of 19.7 mV decade(-1) of activity. Wide pH range (3.0-8.0), fast response time (10 s), non-aqueous tolerance (up to 20%) and adequate shelf life (12 weeks) indicate the vital utility of the proposed sensor. The proposed electrode comparatively shows good selectivity for Yb3+ ion with respect to alkali, alkaline earth, transition and rare earth metals ions and can be used for its determination in binary mixtures and sulfite determination in white and red wine samples.
Compact fs ytterbium fiber laser at 1010 nm for biomedical applications.
Kong, Cihang; Pilger, Christian; Hachmeister, Henning; Wei, Xiaoming; Cheung, Tom H; Lai, Cora S W; Huser, Thomas; Tsia, Kevin K; Wong, Kenneth K Y
2017-11-01
Ytterbium-doped fiber lasers (YDFLs) working in the near-infrared (NIR) spectral window and capable of high-power operation are popular in recent years. They have been broadly used in a variety of scientific and industrial research areas, including light bullet generation, optical frequency comb formation, materials fabrication, free-space laser communication, and biomedical diagnostics as well. The growing interest in YDFLs has also been cultivated for the generation of high-power femtosecond (fs) pulses. Unfortunately, the operating wavelengths of fs YDFLs have mostly been confined to two spectral bands, i.e., 970-980 nm through the three-level energy transition and 1030-1100 nm through the quasi three-level energy transition, leading to a spectral gap (990-1020 nm) in between, which is attributed to an intrinsically weak gain in this wavelength range. Here we demonstrate a high-power mode-locked fs YDFL operating at 1010 nm, which is accomplished in a compact and cost-effective package. It exhibits superior performance in terms of both short-term and long-term stability, i.e., <0.3% (peak intensity over 2.4 μs) and <4.0% (average power over 24 hours), respectively. To illustrate the practical applications, it is subsequently employed as a versatile fs laser for high-quality nonlinear imaging of biological samples, including two-photon excited fluorescence microscopy of mouse kidney and brain sections, as well as polarization-sensitive second-harmonic generation microscopy of potato starch granules and mouse tail muscle. It is anticipated that these efforts will largely extend the capability of fs YDFLs which is continuously tunable over 970-1100 nm wavelength range for wideband hyperspectral operations, serving as a promising complement to the gold-standard Ti:sapphire fs lasers.
Compact fs ytterbium fiber laser at 1010 nm for biomedical applications
Kong, Cihang; Pilger, Christian; Hachmeister, Henning; Wei, Xiaoming; Cheung, Tom H.; Lai, Cora S. W.; Huser, Thomas; Tsia, Kevin. K.; Wong, Kenneth K. Y.
2017-01-01
Ytterbium-doped fiber lasers (YDFLs) working in the near-infrared (NIR) spectral window and capable of high-power operation are popular in recent years. They have been broadly used in a variety of scientific and industrial research areas, including light bullet generation, optical frequency comb formation, materials fabrication, free-space laser communication, and biomedical diagnostics as well. The growing interest in YDFLs has also been cultivated for the generation of high-power femtosecond (fs) pulses. Unfortunately, the operating wavelengths of fs YDFLs have mostly been confined to two spectral bands, i.e., 970-980 nm through the three-level energy transition and 1030-1100 nm through the quasi three-level energy transition, leading to a spectral gap (990-1020 nm) in between, which is attributed to an intrinsically weak gain in this wavelength range. Here we demonstrate a high-power mode-locked fs YDFL operating at 1010 nm, which is accomplished in a compact and cost-effective package. It exhibits superior performance in terms of both short-term and long-term stability, i.e., <0.3% (peak intensity over 2.4 μs) and <4.0% (average power over 24 hours), respectively. To illustrate the practical applications, it is subsequently employed as a versatile fs laser for high-quality nonlinear imaging of biological samples, including two-photon excited fluorescence microscopy of mouse kidney and brain sections, as well as polarization-sensitive second-harmonic generation microscopy of potato starch granules and mouse tail muscle. It is anticipated that these efforts will largely extend the capability of fs YDFLs which is continuously tunable over 970-1100 nm wavelength range for wideband hyperspectral operations, serving as a promising complement to the gold-standard Ti:sapphire fs lasers. PMID:29188091
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2011 CFR
2011-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2014 CFR
2014-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2010 CFR
2010-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2012 CFR
2012-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2013 CFR
2013-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
Cytogenetic evaluation of 163 azoospermics.
Rivas, F; Garcia-Esquivel, L; Diaz, M; Rivera, H; Cantu, J M
1987-08-01
A constitutional chromosomal aberration was diagnosed in 38/163 (23.3%) azoospermic patients. Whereas the 47,XXY complement was the commonest (31/38 cases), the following abnormal karyotypes were also found: 46,XX; 46,X,del(Y) (q11); 46,X,r(Y); 46,XY,inv(1) (p3500q21.3)mat; and 46,Y,t(X;3) (q26;q13.2)mat (both the deleted and the annular Y were observed twice). Pooled data from the literature showed that the frequency of chromosomal abnormalities is higher in azoospermic (150.4/1000) than in infertile (55.3/1000) males, which in turn is higher than in newborns (less than 6/1000). The observed different frequency between azoospermic and infertile individuals is given by several types of chromosomal abnormalities, mainly by the complement 47,XXY. The analysis also showed that the male infertility secondary to rob translocations and supernumerary marker chromosomes is usually not related to azoospermia. The contrary occurs in certain rcp and gonosome;autosome translocations and in autosome inversions.
NASA Astrophysics Data System (ADS)
Cinkaya, Hatun; Eryurek, Gonul; Bilir, Gokhan; Collins, John; Di Bartolo, Baldassare
2017-01-01
We have studied nanophosphors of yttrium silicate (YSO) undoped and doped with different concentration of ytterbium (Yb3+) synthesized by using the sol-gel method. Structural and luminescence properties of the nanophosphors were studied experimentally by using different analytical techniques. For the structural analysis, we performed X-ray diffraction (XRD), Transmission Electron Microscopy (TEM) and Energy Dispersive X-ray Spectrometry (EDS) measurements. Upconversion (UC) and the white light (WL) emission properties were investigated by using the near infrared cw laser excitation of 975 nm. The spectral properties have been found to depend on several physical parameters.
Bi, Weimin; Cheung, Sau-Wai; Breman, Amy M; Bacino, Carlos A
2016-10-01
Deletions in the 4p16.3 region cause Wolf-Hirschhorn syndrome, a well known contiguous microdeletion syndrome with the critical region for common phenotype mapped in WHSCR2. Recently, duplications in 4p16.3 were reported in three patients with developmental delay and dysmorphic features. Through chromosomal microarray analysis, we identified 156 patients with a deletion (n = 109) or duplication (n = 47) in 4p16.3 out of approximately 60,000 patients analyzed by Baylor Miraca Genetics Laboratories. Seventy-five of the postnatally detected deletions encompassed the entire critical region, 32 (43%) of which were associated with other chromosome rearrangements, including six patients (8%) that had a duplication adjacent to the terminal deletion. Our data indicate that Wolf-Hirschhorn syndrome deletions with an adjacent duplication occur at a higher frequency than previously appreciated. Pure deletions (n = 14) or duplications (n = 15) without other copy number changes distal to or inside the WHSCR2 were identified for mapping of critical regions. Our data suggest that deletion of the segment from 0.6 to 0.9 Mb from the terminus of 4p causes a seizure phenotype and duplications of a region distal to the previously defined smallest region of overlap for 4p16.3 microduplication syndrome are associated with neurodevelopmental problems. We detected seven Wolf-Hirschhorn syndrome deletions and one 4p16.3 duplication prenatally; all of the seven are either >8 Mb in size and/or associated with large duplications. In conclusion, our study provides deeper insight into the molecular mechanisms, the critical regions and effective prenatal diagnosis for 4p16.3 deletions/ duplications. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type C supplied-air respirators, demand and pressure-demand classes; test requirements. 84.163 Section 84.163 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF...
A NEW LARGE SUPER-FAST ROTATOR: (335433) 2005 UW163
DOE Office of Scientific and Technical Information (OSTI.GOV)
Chang, Chan-Kao; Lin, Hsing-Wen; Ip, Wing-Huen
2014-08-20
Asteroids of size larger than 150 m generally do not have rotation periods smaller than 2.2 hr. This spin cutoff is believed to be due to the gravitationally bound rubble-pile structures of the asteroids. Rotation with periods exceeding this critical value will cause asteroid breakup. Up until now, only one object, 2001 OE84, has been found to be an exception to this spin cutoff. We report the discovery of a new super-fast rotator, (335433) 2005 UW163, spinning with a period of 1.290 hr and a light curve variation of r' ∼ 0.8 mag from the observations made at the P48 telescope andmore » the P200 telescope of the Palomar Observatory. Its H{sub r{sup ′}}=17.69±0.27 mag and multi-band colors (i.e., g' – r' = 0.68 ± 0.03 mag, r' – i' = 0.19 ± 0.02 mag and SDSS i – z = –0.45 mag) show it is a V-type asteroid with a diameter of 0.6 + 0.3/ – 0.2 km. This indicates (335433) 2005 UW163 is a super-fast rotator beyond the regime of the small monolithic asteroid.« less
Graversen, Jonas H; Svendsen, Pia; Dagnæs-Hansen, Frederik; Dal, Jakob; Anton, Gabriele; Etzerodt, Anders; Petersen, Mikkel D; Christensen, Peter A; Møller, Holger J; Moestrup, Søren K
2012-01-01
Synthetic glucocorticoids are potent anti-inflammatory drugs but serious side effects such as bone mobilization, muscle mass loss, immunosuppression, and metabolic alterations make glucocorticoid therapy a difficult balance. The therapeutic anti-inflammatory effect of glucocorticoids relies largely on the suppressed release of tumor-necrosis factor-α and other cytokines by macrophages at the sites of inflammation. We have now developed a new biodegradable anti-CD163 antibody-drug conjugate that specifically targets the glucocorticoid, dexamethasone to the hemoglobin scavenger receptor CD163 in macrophages. The conjugate, that in average contains four dexamethasone molecules per antibody, exhibits retained high functional affinity for CD163. In vitro studies in rat macrophages and in vivo studies of Lewis rats showed a strong anti-inflammatory effect of the conjugate measured as reduced lipopolysaccharide-induced secretion of tumor-necrosis factor-α. The in vivo potency of conjugated dexamethasone was about 50-fold that of nonconjugated dexamethasone. In contrast to a strong systemic effect of nonconjugated dexamethasone, the equipotent dose of the conjugate had no such effect, measured as thymus lymphocytes apoptosis, body weight loss, and suppression of endogenous cortisol levels. In conclusion, the study shows antibody-drug conjugates as a future approach in anti-inflammatory macrophage-directed therapy. Furthermore, the data demonstrate CD163 as an excellent macrophage target for anti-inflammatory drug delivery. PMID:22643864
Persistent high plasma levels of sCD163 and sCD14 in adult patients with measles virus infection.
Mascia, Claudia; Pozzetto, Irene; Kertusha, Blerta; Marocco, Raffaella; Del Borgo, Cosmo; Tieghi, Tiziana; Vita, Serena; Savinelli, Stefano; Iannetta, Marco; Vullo, Vincenzo; Lichtner, Miriam; Mastroianni, Claudio Maria
2018-01-01
Measles is an infectious disease that represents a serious public health problem worldwide, being associated with increased susceptibility to secondary infections, especially in the respiratory and gastrointestinal tracts. The aim of this study was to evaluate sCD163 and sCD14 levels in measles virus (MV) infected patients, as markers of immune activation, in order to better understand their role in the pathogenesis of the disease. TNF-α plasma levels were also evaluated. sCD163, sCD14 and TNF-α were measured by ELISA in plasma samples of 27 MV infected patients and 27 healthy donors (HD) included as controls. At the time of hospital admission, sCD163 and sCD14 levels were significantly higher in MV infected patients than in HD, while a decrease in TNF-α levels were found even if without statistical significance. sCD163 and sCD14 levels were significantly decreased after two months from acute infection compared to hospital admission although they remained significantly higher compared to HD. TNF-α levels increased significantly during the follow-up period. Considering clinical parameters, sCD163 levels positively correlated with aspartate aminotransferase, white blood cell count and neutrophils rate, while negatively correlated with the lymphocyte percentage. sCD14 levels positively correlated with the neutrophil and lymphocyte percentages. These results indicate that, despite the resolution of symptoms, an important macrophage/monocyte activation persists in measles patients, even after two months from infection.
Beltrán, Luis M.; García Morillo, José S.; Egido, Jesús; Noval, Manuel Leal; Ferrando-Martinez, Sara; Blanco-Colio, Luis M.; Genebat, Miguel; Villar, José R.; Moreno-Luna, Rafael; Moreno, Juan Antonio
2014-01-01
Background Patients infected with the human immunodeficiency virus (HIV) have an increased risk of cardiovascular disease due to increased inflammation and persistent immune activation. CD163 is a macrophage scavenger receptor that is involved in monocyte-macrophage activation in HIV-infected patients. CD163 interacts with TWEAK, a member of the TNF superfamily. Circulating levels of sTWEAK and sCD163 have been previously associated with cardiovascular disease, but no previous studies have fully analyzed their association with HIV. Objective The aim of this study was to analyze circulating levels of sTWEAK and sCD163 as well as other known markers of inflammation (hsCRP, IL-6 and sTNFRII) and endothelial dysfunction (sVCAM-1 and ADMA) in 26 patients with HIV before and after 48 weeks of antiretroviral treatment (ART) and 23 healthy subjects. Results Patients with HIV had reduced sTWEAK levels and increased sCD163, sVCAM-1, ADMA, hsCRP, IL-6 and sTNFRII plasma concentrations, as well as increased sCD163/sTWEAK ratio, compared with healthy subjects. Antiretroviral treatment significantly reduced the concentrations of sCD163, sVCAM-1, hsCRP and sTNFRII, although they remained elevated when compared with healthy subjects. Antiretroviral treatment had no effect on the concentrations of ADMA and sTWEAK, biomarkers associated with endothelial function. The use of protease inhibitors as part of antiretroviral therapy and the presence of HCV-HIV co-infection and/or active HIV replication attenuated the ART-mediated decrease in sCD163 plasma concentrations. Conclusion HIV-infected patients showed a proatherogenic profile characterized by increased inflammatory, immune-activation and endothelial-dysfunction biomarkers that partially improved after ART. HCV-HIV co-infection and/or active HIV replication enhanced immune activation despite ART. PMID:24594990
NASA Astrophysics Data System (ADS)
Al-Hayali, S. K. M.; Al-Janabi, A. H.
2018-03-01
We have experimentally demonstrated the operation of a dual-wavelength passively Q-switched ytterbium-doped fiber laser by using a saturable absorber (SA) based on Fe3O4 nanoparticles in a magnetic fluid. The SA was fabricated by depositing magnetic fluid at the end of an optical fiber ferrule. By performing adjustments to the pump power and polarization controller state in the cavity, a stable dual-wavelength lasing operation was generated without intracavity spectral filters or modulation elements. The Q-switched laser output was achieved at a pump threshold of 80 mW with a maximum output pulse energy of 38.8 nJ, a repetition rate of 73.4 kHz and a minimum pulse width of 3.4 µs. To the best of the authors’ knowledge, this is the first demonstration of a dual-wavelength passively Q-switched fiber laser using Fe3O4 nanoparticles as the SA in the 1.0 µm operation region.
47 CFR 80.163 - Operator requirements of the Bridge-to-Bridge Act.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 47 Telecommunication 5 2011-10-01 2011-10-01 false Operator requirements of the Bridge-to-Bridge... Requirements § 80.163 Operator requirements of the Bridge-to-Bridge Act. Each ship subject to the Bridge-to-Bridge Act must have on board a radio operator who holds a restricted radiotelephone operator permit or...
47 CFR 80.163 - Operator requirements of the Bridge-to-Bridge Act.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Operator requirements of the Bridge-to-Bridge... Requirements § 80.163 Operator requirements of the Bridge-to-Bridge Act. Each ship subject to the Bridge-to-Bridge Act must have on board a radio operator who holds a restricted radiotelephone operator permit or...
Thavasi Raja, G; Halder, Raktim; Varshney, S K
2015-12-10
The bend-induced mode-area reduction and thermal effects are vital factors that affect the power scaling of fiber lasers. Recently, bend-compensated large-mode-area double-clad modified hybrid leakage channel fiber (M-HLCF) has been reported with a mode area greater than 1000 μm, while sustaining the single-mode behavior at 1064 nm for high-temperature environments. In this work, the lasing characteristics of a newly designed ytterbium-doped double-clad M-HLCF (YDMHLCF) have been numerically investigated for strongly pumped conditions. The doped region size is optimally found through simulations, equivalent to the size of core diameter ∼38 μm in order to achieve maximum conversion efficiency for the bent and straight cases. Numerical simulations further confirm that a 2 m long YDMHLCF exhibits slope efficiency of 78% and conversion efficiency of 79% for the straight case and also almost the same for the practical bending radius of 7.5 cm when pumped with a 975 nm laser source.
49 CFR 40.163 - How does the MRO report drug test results?
Code of Federal Regulations, 2012 CFR
2012-10-01
... for the test, if indicated on the CCF (e.g., random, post-accident); (4) Date of the collection; (5... 49 Transportation 1 2012-10-01 2012-10-01 false How does the MRO report drug test results? 40.163... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all...
49 CFR 40.163 - How does the MRO report drug test results?
Code of Federal Regulations, 2011 CFR
2011-10-01
... for the test, if indicated on the CCF (e.g., random, post-accident); (4) Date of the collection; (5... 49 Transportation 1 2011-10-01 2011-10-01 false How does the MRO report drug test results? 40.163... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all...
49 CFR 40.163 - How does the MRO report drug test results?
Code of Federal Regulations, 2013 CFR
2013-10-01
... for the test, if indicated on the CCF (e.g., random, post-accident); (4) Date of the collection; (5... 49 Transportation 1 2013-10-01 2013-10-01 false How does the MRO report drug test results? 40.163... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all...
26 CFR 1.163-8T - Allocation of interest expense among expenditures (temporary).
Code of Federal Regulations, 2011 CFR
2011-04-01
... applying sections 469 (the “passive loss limitation”) and 163 (d) and (h) (the “nonbusiness interest... expense is allocated for the purposes of applying the passive loss limitation and nonbusiness interest... paragraph (m) of this section (relating to limitations on interest expense other than the passive loss and...
NASA Astrophysics Data System (ADS)
Belhachi, S.
2018-04-01
Using density functional theory combined LSDA+U method, the structural, electronic and magnetic behaviors of ytterbium implanted in wurtzite AlN were investigated. Low formation energy shows that Yb atom favors to substitute for Al site and to confirm this stability, the adsorption energy has been calculated. It is found that Al0.9375Yb0.0625N possesses a semiconductor behavior. The magnetic moment 0.9891 μB per molecule principally comes from Yb ion with small contribution from the Al and N atoms. We predict that Yb ions order ferromagnetically in AlN. The hybridization between the f orbital of the Yb atom and the p orbital of the N atom is also observed. We see that AlN:Yb will be among the good candidates for spintronic applications.
Rojo-Martínez, Gemma; Maymó-Masip, Elsa; Rodríguez, M. Mar; Solano, Esther; Goday, Albert; Soriguer, Federico; Valdés, Sergio; Chaves, Felipe Javier; Delgado, Elías; Colomo, Natalia; Hernández, Pilar
2014-01-01
Objective Serum levels of soluble TNF-like weak inducer of apoptosis (sTWEAK) and its scavenger receptor CD163 (sCD163) have been linked to insulin resistance. We analysed the usefulness of these cytokines as biomarkers of type 2 diabetes in a Spanish cohort, together with their relationship to food consumption in the setting of the Di@bet.es study. Research Design and Methods This is a cross-sectional, matched case-control study of 514 type 2 diabetes subjects and 517 controls with a Normal Oral Glucose Tolerance Test (NOGTT), using data from the Di@bet.es study. Study variables included clinical and demographic structured survey, food frequency questionnaire and physical examination. Serum concentrations of sTWEAK and sCD163 were measured by ELISA. Linear regression analysis determined which variables were related to sTWEAK and sCD163 levels. Logistic regression analysis was used to estimate odd ratios of presenting type 2 diabetes. Results sCD163 concentrations and sCD163/sTWEAK ratio were 11.0% and 15.0% higher, respectively, (P<0.001) in type 2 diabetes than in controls. Following adjustment for various confounders, the OR for presenting type 2 diabetes in subjects in the highest vs the lowest tertile of sCD163 was [(OR), 2,01 (95%CI, 1,46–2,97); P for trend <0.001]. Coffee and red wine consumption was negatively associated with serum levels of sCD163 (P = 0.0001 and; P = 0.002 for coffee and red wine intake, respectively). Conclusions High circulating levels of sCD163 are associated with type 2 diabetes in the Spanish population. The association between coffee and red wine intake and these biomarkers deserves further study to confirm its potential role in type 2 diabetes. PMID:24978196
Rojo-Martínez, Gemma; Maymó-Masip, Elsa; Rodríguez, M Mar; Solano, Esther; Goday, Albert; Soriguer, Federico; Valdés, Sergio; Chaves, Felipe Javier; Delgado, Elías; Colomo, Natalia; Hernández, Pilar; Vendrell, Joan; Chacón, Matilde R
2014-01-01
Serum levels of soluble TNF-like weak inducer of apoptosis (sTWEAK) and its scavenger receptor CD163 (sCD163) have been linked to insulin resistance. We analysed the usefulness of these cytokines as biomarkers of type 2 diabetes in a Spanish cohort, together with their relationship to food consumption in the setting of the Di@bet.es study. This is a cross-sectional, matched case-control study of 514 type 2 diabetes subjects and 517 controls with a Normal Oral Glucose Tolerance Test (NOGTT), using data from the Di@bet.es study. Study variables included clinical and demographic structured survey, food frequency questionnaire and physical examination. Serum concentrations of sTWEAK and sCD163 were measured by ELISA. Linear regression analysis determined which variables were related to sTWEAK and sCD163 levels. Logistic regression analysis was used to estimate odd ratios of presenting type 2 diabetes. sCD163 concentrations and sCD163/sTWEAK ratio were 11.0% and 15.0% higher, respectively, (P<0.001) in type 2 diabetes than in controls. Following adjustment for various confounders, the OR for presenting type 2 diabetes in subjects in the highest vs the lowest tertile of sCD163 was [(OR), 2,01 (95%CI, 1,46-2,97); P for trend <0.001]. Coffee and red wine consumption was negatively associated with serum levels of sCD163 (P = 0.0001 and; P = 0.002 for coffee and red wine intake, respectively). High circulating levels of sCD163 are associated with type 2 diabetes in the Spanish population. The association between coffee and red wine intake and these biomarkers deserves further study to confirm its potential role in type 2 diabetes.
75 FR 41801 - Expansion of Foreign-Trade Zone 163, Ponce, Puerto Rico, Area
Federal Register 2010, 2011, 2012, 2013, 2014
2010-07-19
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1692] Expansion of Foreign-Trade Zone 163, Ponce, Puerto Rico, Area Pursuant to its authority under the Foreign-Trade Zones Act of June 18... include a site at the ProCaribe Industrial Park (Site 11) in Penuelas, Puerto Rico, adjacent to the Ponce...
75 FR 41801 - Expansion of Foreign-Trade Zone 163 Ponce, Puerto Rico, Area
Federal Register 2010, 2011, 2012, 2013, 2014
2010-07-19
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1693] Expansion of Foreign-Trade Zone 163 Ponce, Puerto Rico, Area Pursuant to its authority under the Foreign-Trade Zones Act of June 18..., Puerto Rico, within the Ponce Customs and Border Protection port of entry (FTZ Docket 17-2010, filed 3/8...
Castley, Alison; Williams, Leah; James, Ian; Guelfi, George; Berry, Cassandra; Nolan, David
2016-01-01
We investigate the associations of three established plasma biomarkers in the context of HIV and treatment-related variables including a comprehensive cardiovascular disease risk assessment, within a large ambulatory HIV cohort. Patients were recruited in 2010 to form the Royal Perth Hospital HIV/CVD risk cohort. Plasma sCD14, sCD163 and CXCL10 levels were measured in 475 consecutive patients with documented CVD risk (age, ethnicity, gender, smoking, blood pressure, BMI, fasting metabolic profile) and HIV treatment history including immunological/virological outcomes. The biomarkers assessed showed distinct associations with virological response: CXCL10 strongly correlated with HIV-1 RNA (p<0.001), sCD163 was significantly reduced among ‘aviraemic’ patients only (p = 0.02), while sCD14 was unaffected by virological status under 10,000 copies/mL (p>0.2). Associations between higher sCD163 and protease inhibitor therapy (p = 0.05) and lower sCD14 with integrase inhibitor therapy (p = 0.02) were observed. Levels of sCD163 were also associated with CVD risk factors (age, ethnicity, HDL, BMI), with a favourable influence of Framingham score <10% (p = 0.04). Soluble CD14 levels were higher among smokers (p = 0.002), with no effect of other CVD risk factors, except age (p = 0.045). Our findings confirm CXCL10, sCD163 and sCD14 have distinct associations with different aspects of HIV infection and treatment. Levels of CXCL10 correlated with routinely monitored variables, sCD163 levels reflect a deeper level of virological suppression and influence of CVD risk factors, while sCD14 levels were not associated with routinely monitored variables, with evidence of specific effects of smoking and integrase inhibitor therapy warranting further investigation. PMID:27355513
Distribution of CD163-positive cell and MHC class II-positive cell in the normal equine uveal tract.
Sano, Yuto; Matsuda, Kazuya; Okamoto, Minoru; Takehana, Kazushige; Hirayama, Kazuko; Taniyama, Hiroyuki
2016-02-01
Antigen-presenting cells (APCs) in the uveal tract participate in ocular immunity including immune homeostasis and the pathogenesis of uveitis. In horses, although uveitis is the most common ocular disorder, little is known about ocular immunity, such as the distribution of APCs. In this study, we investigated the distribution of CD163-positive and MHC II-positive cells in the normal equine uveal tract using an immunofluorescence technique. Eleven eyes from 10 Thoroughbred horses aged 1 to 24 years old were used. Indirect immunofluorescence was performed using the primary antibodies CD163, MHC class II (MHC II) and CD20. To demonstrate the site of their greatest distribution, positive cells were manually counted in 3 different parts of the uveal tract (ciliary body, iris and choroid), and their average number was assessed by statistical analysis. The distribution of pleomorphic CD163- and MHC II-expressed cells was detected throughout the equine uveal tract, but no CD20-expressed cells were detected. The statistical analysis demonstrated the distribution of CD163- and MHC II-positive cells focusing on the ciliary body. These results demonstrated that the ciliary body is the largest site of their distribution in the normal equine uveal tract, and the ciliary body is considered to play important roles in uveal and/or ocular immune homeostasis. The data provided in this study will help further understanding of equine ocular immunity in the normal state and might be beneficial for understanding of mechanisms of ocular disorders, such as equine uveitis.
Garvin, Stina; Oda, Husam; Arnesson, Lars-Gunnar; Lindström, Annelie; Shabo, Ivan
2018-07-01
Cancer cell fusion with macrophages results in highly tumorigenic hybrids that acquire genetic and phenotypic characteristics from both maternal cells. Macrophage traits, exemplified by CD163 expression, in tumor cells are associated with advanced stages and poor prognosis in breast cancer (BC). In vitro data suggest that cancer cells expressing CD163 acquire radioresistance. Tissue microarray was constructed from primary BC obtained from 83 patients treated with breast-conserving surgery, 50% having received postoperative radiotherapy (RT) and none of the patients had lymph node or distant metastasis. Immunostaining of CD163 in cancer cells and macrophage infiltration (MI) in tumor stroma were evaluated. Macrophage:MCF-7 hybrids were generated by spontaneous in vitro cell fusion. After irradiation (0, 2.5 and 5 Gy γ-radiation), both hybrids and their maternal MCF-7 cells were examined by clonogenic survival. CD163-expression by cancer cells was significantly associated with MI and clinicopathological data. Patients with CD163-positive tumors had significantly shorter disease-free survival (DFS) after RT. In vitro generated macrophage:MCF-7 hybrids developed radioresistance and exhibited better survival and colony forming ability after radiation compared to maternal MCF-7 cancer cells. Our results suggest that macrophage phenotype in tumor cells results in radioresistance in breast cancer and shorter DFS after radiotherapy.
NASA Technical Reports Server (NTRS)
Ranitzsch, P. C.-O.; Porst, J.-P.; Kempf, S.; Pies, C.; Schafer, S.; Hengstler, D.; Fleischmann, A.; Enss, C.; Gastaldo, L.
2012-01-01
The measurement of calorimetric spectra following atomic weak decays, beta (b) and electron capture (EC), of nuclides having a very low Q-value, can provide an impressively high sensitivity to a non-vanishing neutrino mass. The achievable sensitivity in this kind of experiments is directly connected to the performance of the used detectors. In particular an energy resolution of a few eV and a pulse formation time well below 1 microsecond are required. Low temperature Metallic Magnetic Calorimeters (MMCs) for soft X-rays have already shown an energy resolution of 2.0 eV FWHM and a pulse rise-time of about 90 ns for fully micro-fabricated detectors. We present the use of MMCs for high precision measurements of calorimetric spectra following the beta-decay of Re-187 and the EC of Ho-163. We show results obtained with detectors optimized for Re-187 and for Ho-163 experiments respectively. While the detectors equipped with superconducting Re absorbers have not yet reached the aimed performance, a first detector prototype with a Au absorber having implanted Ho-163 ions already shows excellent results. An energy resolution of 12 eV FWHM and a rise time of 90 ns were measured.
Ning, Yingying; Ke, Xian-Sheng; Hu, Ji-Yun; Liu, Yi-Wei; Ma, Fang; Sun, Hao-Ling; Zhang, Jun-Long
2017-02-20
"Configurational isomerism" is an important approach found in naturally occurring chlorophylls to modulate light harvesting function without significant structural changes; however, this feature has been seldom applied in design of antenna ligands for lanthanide (Ln) sensitization. In this work, we introduced a bioinspired approach by orientation of β-dilactone moieties on porphyrinates, namely cis-/trans-porphodilactones, to modulate the energy transfer process from the lowest triplet excited state of the ligand (T 1 ) to the emitting level of ytterbium(III) ( 2 F 5/2 , Yb*). Interestingly, near-infrared (NIR) emission of Yb(III) could be switched "on" by the cis-porphodilactone ligand, while the trans-isomer renders Yb(III) emission "off" and the ratio of quantum yields is ∼8. Analysis of the structure-photophysical properties relationship suggests that the significant emission difference is correlated to the energy gaps between T 1 and Yb* (1152 cm -1 in the cis- vs -25 cm -1 in the trans-isomer). More interestingly, due to back energy transfer (BEnT), the Yb(III) complex of cis-porphodilactone exhibits NIR emission with high thermosensitivity (4.0%°C -1 in solution and 4.9%°C -1 in solid state), comparable to previously reported terbium (Tb) and europium (Eu) visible emitters, in contrast to the trivial emission changes of the trans-isomer and porphyrin and porpholactone analogues. This work opens up new access to design NIR emissive Ln complexes by bioinspired modification of antenna ligands.
Shu, Xinhua; Luhmann, Ulrich F. O.; Aleman, Tomas S.; Barker, Susan E.; Lennon, Alan; Tulloch, Brian; Chen, Mei; Xu, Heping; Jacobson, Samuel G.; Ali, Robin; Wright, Alan F.
2011-01-01
A single founder mutation resulting in a Ser163Arg substitution in the C1QTNF5 gene product causes autosomal dominant late-onset retinal macular degeneration (L-ORMD) in humans, which has clinical and pathological features resembling age-related macular degeneration. We generated and characterised a mouse “knock-in” model carrying the Ser163Arg mutation in the orthologous murine C1qtnf5 gene by site-directed mutagenesis and homologous recombination into mouse embryonic stem cells. Biochemical, immunological, electron microscopic, fundus autofluorescence, electroretinography and laser photocoagulation analyses were used to characterise the mouse model. Heterozygous and homozygous knock-in mice showed no significant abnormality in any of the above measures at time points up to 2 years. This result contrasts with another C1qtnf5 Ser163Arg knock-in mouse which showed most of the features of L-ORMD but differed in genetic background and targeting construct. PMID:22110650
Hattori, Akiko; Takemoto, Minoru; Tokuyama, Hirotake; Koshizaka, Masaya; Yokote, Koutaro
2017-04-01
Dipeptidyl peptidase-4 inhibitor (DPP-4i) is commonly used worldwide for the treatment of type 2 diabetes mellitus. In addition to its hypoglycemic activity, DPP-4i might have anti-inflammatory effects. In this study we examined the effects of DPP-4i on the serum levels of soluble CD163 (sCD163), a marker for activated macrophages, in individuals with type 2 diabetes mellitus. We compared these anti-inflammatory effects with those of α glucosidase inhibitor (αGI). Japanese patients with type 2 diabetes mellitus who were stably maintained on ≤2mg/day glimepiride alone were recruited and randomly assigned to receive additional sitagliptin (n=37) or αGI (n=37). Levels of sCD163 were measured before the addition and after a 24-week treatment period. Addition of sitagliptin significantly reduced the serum sCD163 (632 vs. 575ng/mL, p<0.05), while αGI did not display this effect (624 vs. 607ng/mL). The changes in levels of sCD163 were not related to changes in either HbA1c or body mass index (BMI). Our results suggested that DPP-4i might exert anti-inflammatory effects in individuals with type 2 diabetes mellitus, which are independent of its effects on glycemia and BMI. Copyright © 2017 Elsevier B.V. All rights reserved.
Conlon, J M; Eriksson, B; Grimelius, L; Oberg, K; Thim, L
1987-11-15
By using only reverse-phase h.p.l.c., three fragments of prosomatostatin were isolated from an extract of a human pancreatic neuroendocrine tumour that produced somatostatin, vasoactive intestinal polypeptide and gastrin-releasing peptide. The amino acid composition of the peptides indicated that they represented prosomatostatin-(1-63)-peptide, prosomatostain-(65-76)-peptide and prosomatostatin-(79-92)-peptide (somatostatin-14). The identity of prosomatostatin-(1-63)-peptide was confirmed by characterization of the products of digestion with Armillaria mellea (honey fungus) proteinase. Partial micro-sequencing of prosomatostatin-(1-63)-peptide showed that the Gly24-Ala25 bond of preprosomatostatin was the site of cleavage of the signal peptide. Thus human prosomatostatin is a protein of 92 amino acid residues that is proteolytically cleaved in a pancreatic tumour at the site of a dibasic-residue (arginine-lysine) processing site and at a single-monobasic-residue (arginine) processing site.
33 CFR 165.163 - Safety Zones; Port of New York/New Jersey Fleet Week.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones; Port of New York... § 165.163 Safety Zones; Port of New York/New Jersey Fleet Week. (a) The following areas are established... parade vessels as it transits the Port of New York and New Jersey from the Verrazano Narrows Bridge to...
19 CFR 163.6 - Production and examination of entry and other records and witnesses; penalties.
Code of Federal Regulations, 2010 CFR
2010-04-01
... written, oral, or electronic notice, any Customs officer may require the production of entry records by... 19 Customs Duties 2 2010-04-01 2010-04-01 false Production and examination of entry and other..., DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.6 Production and...
NASA Astrophysics Data System (ADS)
Zhang, Lei; Yang, Si-Gang; Wang, Xiao-Jian; Gou, Dou-Dou; Chen, Hong-Wei; Chen, Ming-Hua; Xie, Shi-Zhong
2014-01-01
We report the experimental demonstration of the optical parametric gain generation in the 1 μm regime based on a photonic crystal fiber (PCF) with a zero group velocity dispersion (GVD) wavelength of 1062 nm pumped by a homemade tunable picosecond mode-locked ytterbium-doped fiber laser. A broad parametric gain band is obtained by pumping the PCF in the anomalous GVD regime with a relatively low power. Two separated narrow parametric gain bands are observed by pumping the PCF in the normal GVD regime. The peak of the parametric gain profile can be tuned from 927 to 1038 nm and from 1099 to 1228 nm. This widely tunable parametric gain band can be used for a broad band optical parametric amplifier, large span wavelength conversion or a tunable optical parametric oscillator.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 12 Banks and Banking 1 2014-01-01 2014-01-01 false Inclusion of subordinated debt securities and... Borrowings § 163.81 Inclusion of subordinated debt securities and mandatorily redeemable preferred stock as... 12 CFR part 116, subpart A seeking the OCC's approval of, or non-objection to, the inclusion of...